F389191

General Info

Members Datasets Scaffolds Average Seq Length
289 162 289 277

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10271398|Ga0157374_102713983
Length 327
Sequence MVLDGRKVFAAKKRSRERRLDIGAPENDRSTRGGRKARVTFNSGAQLDPNQVTDVRGRSYGGGRGLAVVGGGIGLVIAVVYLLLGGNPADLAPSSGGAANGPIGSQATQECKTGTQANERTDCRIVGFVDSIQAYWKDEFTREGQTYQPAQTVIFSDGVDTGCGPATTEVGPFYCPPDVTVYIDLGFFDELQSRFGAEGGPLAEGYVVAHEYGHHIQDLQGLLSGGSXXXXADSRSVRTELMADCYAGIWVNHAASTGFLKAPTKEQVGQALAAAAAVGDDRIQQKTQGQVDPEGWTHGSAEQRQHWFTVGLQTGTPDSCDTFHNPI

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
67 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
70 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
73 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
74 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
77 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
78 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
87 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.46
Rhizosphere 96.19
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10005030 3300003659 Bacteria 2716
2 Ga0065707_10083472 3300005295 Bacteria 9047
3 Ga0068869_100104626 3300005334 Bacteria 2146
4 Ga0070682_100096233 3300005337 Bacteria 1946
5 Ga0070675_100654191 3300005354 Bacteria 955
6 Ga0070709_10033424 3300005434 Bacteria 3110
7 Ga0070714_100029050 3300005435 Bacteria 4593
8 Ga0070699_100071121 3300005518 Bacteria 3025
9 Ga0070699_100146838 3300005518 Bacteria 2084
10 Ga0070699_100149828 3300005518 Bacteria 2063
11 Ga0070697_100091018 3300005536 Bacteria 2522
12 Ga0070686_100053180 3300005544 Bacteria 2584
13 Ga0070695_100118753 3300005545 Unclassified 1806
14 Ga0070693_100166341 3300005547 Bacteria 1409
15 Ga0070704_100217047 3300005549 Bacteria 1553
16 Ga0070664_100414003 3300005564 Bacteria 1234
17 Ga0068859_100062870 3300005617 Bacteria 3742
18 Ga0068864_100015646 3300005618 Bacteria 6311
19 Ga0068864_100134129 3300005618 Bacteria 2228
20 Ga0068858_100449471 3300005842 Bacteria 1242
21 Ga0068858_100576611 3300005842 Bacteria 1090
22 Ga0068862_100225921 3300005844 Bacteria 1697
23 Ga0081455_10069609 3300005937 Bacteria 2925
24 Ga0081538_10001583 3300005981 Bacteria 23361
25 Ga0081540_1000184 3300005983 Bacteria 65215
26 Ga0081539_10001485 3300005985 Bacteria 39732
27 Ga0081539_10027273 3300005985 Bacteria 3622
28 Ga0070715_10020897 3300006163 Bacteria 2531
29 Ga0070716_100074097 3300006173 Bacteria 2010
30 Ga0070712_100246800 3300006175 Bacteria 1424
31 Ga0075428_100000323 3300006844 Bacteria 47418
32 Ga0075428_100080515 3300006844 Bacteria 3554
33 Ga0075428_100164090 3300006844 Bacteria 2410
34 Ga0075430_100006922 3300006846 Bacteria 9557
35 Ga0075430_100372828 3300006846 Unclassified 1178
36 Ga0075431_100039124 3300006847 Bacteria 4885
37 Ga0075433_10278964 3300006852 Bacteria 1480
38 Ga0075434_100426180 3300006871 Bacteria 1348
39 Ga0075434_100475405 3300006871 Bacteria 1271
40 Ga0075434_100789474 3300006871 Bacteria 966
41 Ga0075429_100002969 3300006880 Bacteria 14385
42 Ga0075429_100120245 3300006880 Bacteria 2296
43 Ga0075429_100171209 3300006880 Bacteria 1902
44 Ga0075429_100301280 3300006880 Bacteria 1403
45 Ga0097620_100062870 3300006931 Bacteria 3742
46 Ga0075435_100285302 3300007076 Bacteria 1410
47 Ga0111539_10097099 3300009094 Bacteria 3461
48 Ga0105245_10050711 3300009098 Bacteria 3720
49 Ga0114129_10000680 3300009147 Bacteria 42864
50 Ga0114129_10007047 3300009147 Bacteria 16003
51 Ga0114129_10095678 3300009147 Bacteria 4113
52 Ga0114129_10317947 3300009147 Bacteria 2070
53 Ga0105246_10180340 3300011119 Bacteria 1626
54 Ga0157374_10271398 3300013296 Bacteria 1672
55 Ga0163162_10519099 3300013306 Bacteria 1321
56 Ga0157372_10223398 3300013307 Bacteria 2183
57 Ga0157375_10126025 3300013308 Bacteria 2675
58 Ga0163163_10012158 3300014325 Bacteria 7832
59 Ga0163163_10043337 3300014325 Bacteria 4412
60 Ga0163163_10079988 3300014325 Bacteria 3267
61 Ga0163163_10137034 3300014325 Bacteria 2489
62 Ga0157379_10053856 3300014968 Bacteria 3595
63 Ga0157379_10074013 3300014968 Bacteria 3049
64 Ga0207653_10049301 3300025885 Bacteria 1398
65 Ga0207692_10028521 3300025898 Bacteria 2642
66 Ga0207646_10165164 3300025922 Bacteria 1998
67 Ga0207650_10232447 3300025925 Bacteria 1487
68 Ga0207664_10003559 3300025929 Bacteria 10407
69 Ga0207664_10354156 3300025929 Bacteria 1300
70 Ga0207686_10212162 3300025934 Bacteria 1392
71 Ga0207665_10010197 3300025939 Bacteria 6169
72 Ga0207711_10108045 3300025941 Bacteria 2471
73 Ga0207689_10066385 3300025942 Bacteria 2966
74 Ga0207679_10412680 3300025945 Bacteria 1190
75 Ga0207677_10259011 3300026023 Bacteria 1417
76 Ga0207708_10336104 3300026075 Bacteria 1236
77 Ga0207641_10261146 3300026088 Bacteria 1622
78 Ga0207676_10228875 3300026095 Bacteria 1660
79 Ga0207676_10304732 3300026095 Bacteria 1456
80 Ga0207683_10050706 3300026121 Bacteria 3636
81 Ga0209983_1005448 3300027665 Bacteria 2636
82 Ga0209971_1007658 3300027682 Bacteria 2563
83 Ga0209974_10007020 3300027876 Bacteria 3899
84 Ga0268265_10182298 3300028380 Bacteria 1805
85 Ga0268265_10314173 3300028380 Bacteria 1416
86 Ga0268264_10177104 3300028381 Bacteria 1933
87 Ga0307512_10127773 3300030522 Bacteria 1607
88 Ga0307408_100201048 3300031548 Unclassified 1613
89 Ga0316578_10116833 3300031728 Bacteria 1603
90 Ga0316577_10000589 3300031733 Bacteria 14923
91 Ga0307409_100101247 3300031995 Bacteria 2390
92 Ga0373926_0017101 3300035083 Bacteria 2487
93 Ga0373944_0000987 3300035089 Bacteria 7046
94 Ga0373936_0001138 3300035113 Bacteria 9533
95 Ga0373936_0018522 3300035113 Bacteria 2690
96 Ga0373941_0044910 3300035115 Bacteria 1381
97 Ga0373945_0001530 3300035116 Bacteria 7073
98 Ga0373953_0122292 3300035117 Bacteria 1106
99 Ga0373943_0001444 3300035170 Bacteria 10723
100 Ga0373946_0000281 3300035171 Bacteria 16303
101 Ga0373955_0020360 3300035172 Bacteria 3334
102 Ga0373961_0024712 3300035241 Bacteria 1628
103 Ga0373935_0010755 3300035692 Bacteria 5497
104 Ga0373935_0246765 3300035692 Bacteria 1248
105 Ga0373927_0003891 3300035695 Bacteria 10590
106 Ga0373933_0050017 3300035724 Bacteria 2493
107 Ga0373947_0000373 3300035725 Bacteria 25333
108 Ga0373947_0140784 3300035725 Bacteria 1547
109 Ga0316582_0131993 3300036647 Bacteria 1678
110 Ga0316584_0019012 3300036712 Bacteria 4963
111 Ga0373925_0014291 3300037068 Bacteria 5743
112 Ga0439431_0011755 3300041997 Bacteria 2004
113 Ga0439446_0007659 3300042156 Bacteria 2845
114 Ga0451577_0005474 3300042876 Bacteria 13009
115 Ga0451577_0196199 3300042876 Bacteria 1822
116 Ga0451577_0363951 3300042876 Bacteria 1312
117 Ga0453683_0124724 3300044673 Bacteria 1621
118 Ga0466963_0026939 3300044694 Bacteria 3677
119 Ga0453684_0001158 3300044712 Bacteria 82247
120 Ga0453684_0006545 3300044712 Bacteria 22063
121 Ga0453684_0013086 3300044712 Bacteria 13545
122 Ga0453684_0046095 3300044712 Bacteria 5804
123 Ga0453684_0057762 3300044712 Bacteria 5018
124 Ga0453684_0424969 3300044712 Bacteria 1483
125 Ga0453684_0674865 3300044712 Bacteria 1125
126 Ga0453684_0677790 3300044712 Bacteria 1122
127 Ga0451576_0004232 3300045051 Bacteria 18845
128 Ga0451576_0013230 3300045051 Bacteria 9235
129 Ga0451576_0037167 3300045051 Bacteria 5158
130 Ga0451576_0193722 3300045051 Bacteria 2123
131 Ga0451576_0287370 3300045051 Bacteria 1719
132 Ga0466967_0010870 3300045976 Bacteria 6857
133 Ga0466967_0222202 3300045976 Bacteria 1795
134 Ga0466967_0511506 3300045976 Bacteria 1179
135 Ga0495651_0097136 3300046462 Bacteria 2200
136 Ga0495651_0205371 3300046462 Bacteria 1375
137 Ga0495653_0002059 3300046463 Bacteria 15808
138 Ga0495653_0325233 3300046463 Bacteria 995
139 Ga0495582_0013402 3300046473 Bacteria 4513
140 Ga0495662_0018118 3300046476 Bacteria 3406
141 Ga0495664_0000503 3300046477 Bacteria 19507
142 Ga0495608_0029389 3300046511 Bacteria 3728
143 Ga0495608_0029416 3300046511 Bacteria 3726
144 Ga0495618_0045868 3300046514 Bacteria 2758
145 Ga0495618_0090551 3300046514 Bacteria 1956
146 Ga0495628_0104890 3300046516 Bacteria 2178
147 Ga0495630_0115577 3300046517 Bacteria 2033
148 Ga0495652_0025887 3300046529 Bacteria 5183
149 Ga0495652_0059546 3300046529 Bacteria 3231
150 Ga0495665_0018383 3300046531 Bacteria 3756
151 Ga0495640_0032785 3300046533 Bacteria 3697
152 Ga0495587_0070139 3300046536 Bacteria 2040
153 Ga0495667_0004226 3300046559 Bacteria 9678
154 Ga0495634_0016001 3300046642 Bacteria 5373
155 Ga0495634_0256406 3300046642 Bacteria 1068
156 Ga0495635_0000401 3300046663 Bacteria 27489
157 Ga0495635_0050583 3300046663 Bacteria 2864
158 Ga0495657_0010704 3300046675 Bacteria 6895
159 Ga0495657_0223556 3300046675 Bacteria 1140
160 Ga0495599_0011939 3300046678 Bacteria 5342
161 Ga0495623_0175421 3300046679 Bacteria 1249
162 Ga0495646_0065476 3300046680 Bacteria 2152
163 Ga0495624_0001046 3300046690 Bacteria 21802
164 Ga0495674_0000368 3300047319 Bacteria 40089
165 Ga0495672_0242697 3300047320 Bacteria 879
166 Ga0495676_0017112 3300047321 Bacteria 6414
167 Ga0495680_0059711 3300047322 Bacteria 2942
168 Ga0495680_0062128 3300047322 Bacteria 2872
169 Ga0495684_0003747 3300047471 Bacteria 11853
170 Ga0495684_0007014 3300047471 Bacteria 8752
171 Ga0495593_0097301 3300047673 Bacteria 1512
172 Ga0495602_0080108 3300048088 Bacteria 2752
173 Ga0496104_0004342 3300048907 Bacteria 12332
174 Ga0496105_0001443 3300048908 Bacteria 16732
175 Ga0496108_0020446 3300048911 Bacteria 5442
176 Ga0496108_0242149 3300048911 Unclassified 1569
177 Ga0496109_0002015 3300048912 Bacteria 16845
178 Ga0496110_0016550 3300048913 Bacteria 6158
179 Ga0496111_0004299 3300048914 Bacteria 8978
180 Ga0496112_0553518 3300048915 Bacteria 1084
181 Ga0496112_0702220 3300048915 Bacteria 939
182 Ga0496113_0006190 3300048916 Bacteria 7557
183 Ga0501031_0007852 3300049568 Bacteria 6945
184 Ga0501031_0016518 3300049568 Bacteria 4795
185 Ga0501031_0070325 3300049568 Bacteria 2280
186 Ga0501033_0053101 3300049570 Bacteria 3002
187 Ga0501036_0008004 3300049572 Bacteria 8650
188 Ga0501036_0016262 3300049572 Bacteria 6214
189 Ga0501036_0332078 3300049572 Bacteria 1270
190 Ga0501038_0053558 3300049574 Bacteria 3473
191 Ga0501040_0007712 3300049576 Bacteria 6966
192 Ga0501040_0015113 3300049576 Bacteria 5100
193 Ga0501040_0026516 3300049576 Bacteria 3898
194 Ga0501040_0086831 3300049576 Bacteria 2172
195 Ga0501040_0139998 3300049576 Bacteria 1704
196 Ga0501040_0210344 3300049576 Bacteria 1383
197 Ga0501040_0260379 3300049576 Bacteria 1238
198 Ga0501041_0003583 3300049577 Bacteria 8933
199 Ga0501041_0028457 3300049577 Bacteria 3371
200 Ga0501041_0031263 3300049577 Bacteria 3216
201 Ga0501042_0023322 3300049578 Bacteria 4329
202 Ga0501042_0028646 3300049578 Bacteria 3926
203 Ga0501042_0068982 3300049578 Bacteria 2529
204 Ga0501042_0122441 3300049578 Bacteria 1873
205 Ga0501042_0266277 3300049578 Bacteria 1237
206 Ga0501046_0024552 3300049580 Bacteria 4943
207 Ga0501046_0059136 3300049580 Bacteria 3004
208 Ga0501067_0069783 3300049583 Bacteria 1946
209 Ga0501067_0164858 3300049583 Bacteria 1234
210 Ga0501067_0194979 3300049583 Bacteria 1128
211 Ga0501068_0016495 3300049584 Bacteria 4258
212 Ga0501068_0031975 3300049584 Bacteria 3127
213 Ga0501068_0160204 3300049584 Bacteria 1418
214 Ga0501069_0157260 3300049585 Bacteria 1308
215 Ga0501070_0026850 3300049586 Bacteria 4829
216 Ga0501071_0001608 3300049587 Bacteria 13247
217 Ga0501071_0010449 3300049587 Bacteria 6221
218 Ga0501071_0019519 3300049587 Bacteria 4704
219 Ga0501071_0019669 3300049587 Bacteria 4686
220 Ga0501071_0032445 3300049587 Bacteria 3709
221 Ga0501071_0249616 3300049587 Bacteria 1339
222 Ga0501072_0000312 3300049588 Bacteria 34544
223 Ga0501072_0055059 3300049588 Bacteria 3135
224 Ga0501072_0077928 3300049588 Bacteria 2624
225 Ga0501072_0094903 3300049588 Bacteria 2370
226 Ga0501072_0113733 3300049588 Bacteria 2155
227 Ga0501072_0140612 3300049588 Bacteria 1925
228 Ga0501073_0014380 3300049589 Bacteria 5751
229 Ga0501075_0040298 3300049591 Bacteria 3498
230 Ga0501075_0047318 3300049591 Bacteria 3233
231 Ga0501075_0091735 3300049591 Bacteria 2305
232 Ga0501075_0121326 3300049591 Bacteria 1989
233 Ga0501075_0143765 3300049591 Bacteria 1818
234 Ga0501075_0184819 3300049591 Bacteria 1590
235 Ga0501076_0003909 3300049592 Bacteria 10503
236 Ga0501076_0006757 3300049592 Bacteria 8325
237 Ga0501076_0010944 3300049592 Bacteria 6748
238 Ga0501076_0060887 3300049592 Bacteria 3004
239 Ga0501076_0175012 3300049592 Bacteria 1749
240 Ga0501076_0228119 3300049592 Bacteria 1522
241 Ga0501076_0305586 3300049592 Bacteria 1304
242 Ga0501077_0008710 3300049593 Bacteria 6294
243 Ga0501077_0022307 3300049593 Bacteria 4009
244 Ga0501077_0023657 3300049593 Bacteria 3895
245 Ga0501077_0074857 3300049593 Bacteria 2144
246 Ga0501077_0075940 3300049593 Bacteria 2128
247 Ga0501079_0001035 3300049741 Bacteria 19256
248 Ga0501079_0005105 3300049741 Bacteria 9749
249 Ga0501079_0006699 3300049741 Bacteria 8667
250 Ga0501079_0136624 3300049741 Bacteria 1909
251 Ga0501079_0151567 3300049741 Bacteria 1807
252 Ga0501080_0070100 3300049742 Bacteria 3260
253 Ga0501080_0128841 3300049742 Bacteria 2343
254 Ga0501081_0012980 3300049743 Bacteria 5480
255 Ga0501081_0100004 3300049743 Bacteria 2049
256 Ga0501081_0105389 3300049743 Bacteria 1997
257 Ga0501081_0125226 3300049743 Bacteria 1833
258 Ga0501081_0181853 3300049743 Bacteria 1521
259 Ga0501081_0299071 3300049743 Bacteria 1180
260 Ga0501035_0100232 3300049822 Bacteria 2543
261 Ga0501045_0001320 3300049824 Bacteria 16463
262 Ga0501045_0326195 3300049824 Bacteria 1142
263 nmdc:mga05p37_243750_c1 3300050507 Bacteria 2159
264 nmdc:mga05p37_47345_c1 3300050507 Bacteria 5288
265 nmdc:mga05p37_600_c1 3300050507 Bacteria 39739
266 nmdc:mga05p37_714872_c1 3300050507 Bacteria 1110
267 nmdc:mga05p37_89470_c1 3300050507 Bacteria 3794
268 nmdc:mga09592_1060_c1 3300050508 Bacteria 21814
269 nmdc:mga09592_193361_c1 3300050508 Bacteria 1761
270 nmdc:mga09592_374744_c1 3300050508 Bacteria 1231
271 nmdc:mga0qj67_2459_c1 3300050509 Bacteria 13192
272 nmdc:mga06r32_25441_c1 3300050510 Bacteria 5507
273 nmdc:mga0n895_162442_c1 3300050512 Bacteria 2265
274 nmdc:mga0n895_72176_c1 3300050512 Bacteria 3424
275 nmdc:mga0a205_31647_c1 3300050515 Bacteria 5070
276 nmdc:mga0a205_527102_c1 3300050515 Bacteria 1037
277 nmdc:mga0a205_67158_c1 3300050515 Bacteria 3464
278 Ga0495619_0253587 3300053085 Bacteria 1219
279 Ga0501084_0030497 3300054114 Bacteria 4509
280 Ga0501084_0083879 3300054114 Bacteria 2675
281 Ga0501084_0157123 3300054114 Bacteria 1918
282 Ga0501084_0373834 3300054114 Bacteria 1204
283 Ga0501082_0018948 3300060353 Bacteria 5929
284 Ga0501082_0186842 3300060353 Bacteria 1803
285 Ga0530510_0006343 3300061734 Bacteria 8228
286 Ga0530510_0079177 3300061734 Bacteria 2390
287 Ga0530510_0183152 3300061734 Bacteria 1553
288 Ga0530510_0249949 3300061734 Bacteria 1321
289 Ga0530510_0263640 3300061734 Bacteria 1285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0242697 Ga0495672_0242697_24_731 220
2 3300006844 Ga0075428_100080515 Ga0075428_1000805152 233
3 3300049572 Ga0501036_0332078 Ga0501036_0332078_548_1255 234
4 3300013307 Ga0157372_10223398 Ga0157372_102233982 235
5 3300025925 Ga0207650_10232447 Ga0207650_102324471 235
6 3300031548 Ga0307408_100201048 Ga0307408_1002010482 235
7 3300030522 Ga0307512_10127773 Ga0307512_101277731 237
8 3300045051 Ga0451576_0004232 Ga0451576_0004232_6901_7656 237
9 3300042876 Ga0451577_0196199 Ga0451577_0196199_1016_1771 238
10 3300044712 Ga0453684_0046095 Ga0453684_0046095_887_1642 238
11 3300044712 Ga0453684_0674865 Ga0453684_0674865_271_1026 238
12 3300045051 Ga0451576_0013230 Ga0451576_0013230_2947_3702 238
13 3300050507 nmdc:mga05p37_47345_c1 nmdc:mga05p37_47345_c1_414_1169 238
14 3300050508 nmdc:mga09592_1060_c1 nmdc:mga09592_1060_c1_12996_13751 238
15 3300050515 nmdc:mga0a205_527102_c1 nmdc:mga0a205_527102_c1_205_960 238
16 3300005337 Ga0070682_100096233 Ga0070682_1000962331 239
17 3300005937 Ga0081455_10069609 Ga0081455_100696092 239
18 3300044712 Ga0453684_0677790 Ga0453684_0677790_275_1036 239
19 3300044712 Ga0453684_0013086 Ga0453684_0013086_9424_10185 240
20 3300006871 Ga0075434_100475405 Ga0075434_1004754051 242
21 3300025939 Ga0207665_10010197 Ga0207665_100101975 242
22 3300044712 Ga0453684_0006545 Ga0453684_0006545_12935_13702 242
23 3300050512 nmdc:mga0n895_162442_c1 nmdc:mga0n895_162442_c1_1012_1812 242
24 3300009147 Ga0114129_10317947 Ga0114129_103179472 245
25 3300013306 Ga0163162_10519099 Ga0163162_105190992 245
26 3300042876 Ga0451577_0363951 Ga0451577_0363951_41_817 245
27 3300045051 Ga0451576_0037167 Ga0451576_0037167_1331_2155 245
28 3300050507 nmdc:mga05p37_714872_c1 nmdc:mga05p37_714872_c1_68_844 245
29 3300005618 Ga0068864_100134129 Ga0068864_1001341292 248
30 3300006173 Ga0070716_100074097 Ga0070716_1000740972 248
31 3300006871 Ga0075434_100789474 Ga0075434_1007894741 248
32 3300031728 Ga0316578_10116833 Ga0316578_101168331 248
33 3300031733 Ga0316577_10000589 Ga0316577_1000058914 248
34 3300036647 Ga0316582_0131993 Ga0316582_0131993_672_1547 248
35 3300036712 Ga0316584_0019012 Ga0316584_0019012_1617_2492 248
36 3300049584 Ga0501068_0031975 Ga0501068_0031975_44_808 248
37 3300049586 Ga0501070_0026850 Ga0501070_0026850_3579_4505 248
38 3300006852 Ga0075433_10278964 Ga0075433_102789642 249
39 3300006871 Ga0075434_100426180 Ga0075434_1004261803 249
40 3300007076 Ga0075435_100285302 Ga0075435_1002853021 249
41 3300031995 Ga0307409_100101247 Ga0307409_1001012472 249
42 3300050515 nmdc:mga0a205_67158_c1 nmdc:mga0a205_67158_c1_2196_3065 249
43 3300049587 Ga0501071_0032445 Ga0501071_0032445_2279_3157 250
44 3300050512 nmdc:mga0n895_72176_c1 nmdc:mga0n895_72176_c1_2035_2892 250
45 3300050515 nmdc:mga0a205_31647_c1 nmdc:mga0a205_31647_c1_847_1704 250
46 3300041997 Ga0439431_0011755 Ga0439431_0011755_958_1884 252
47 3300049584 Ga0501068_0016495 Ga0501068_0016495_1573_2448 252
48 3300049588 Ga0501072_0077928 Ga0501072_0077928_1665_2507 252
49 3300042156 Ga0439446_0007659 Ga0439446_0007659_756_1682 253
50 3300045051 Ga0451576_0193722 Ga0451576_0193722_509_1402 253
51 3300049576 Ga0501040_0260379 Ga0501040_0260379_334_1176 253
52 3300049583 Ga0501067_0194979 Ga0501067_0194979_284_1093 253
53 3300049591 Ga0501075_0143765 Ga0501075_0143765_588_1430 253
54 3300049742 Ga0501080_0128841 Ga0501080_0128841_275_1117 253
55 3300045976 Ga0466967_0222202 Ga0466967_0222202_729_1604 255
56 3300005545 Ga0070695_100118753 Ga0070695_1001187531 256
57 3300006880 Ga0075429_100002969 Ga0075429_1000029695 256
58 3300009147 Ga0114129_10007047 Ga0114129_1000704716 256
59 3300035115 Ga0373941_0044910 Ga0373941_0044910_64_990 256
60 3300035241 Ga0373961_0024712 Ga0373961_0024712_470_1396 256
61 3300048911 Ga0496108_0242149 Ga0496108_0242149_407_1333 256
62 3300049568 Ga0501031_0016518 Ga0501031_0016518_1713_2603 256
63 3300049570 Ga0501033_0053101 Ga0501033_0053101_535_1425 256
64 3300049572 Ga0501036_0008004 Ga0501036_0008004_1640_2530 256
65 3300049574 Ga0501038_0053558 Ga0501038_0053558_2416_3306 256
66 3300049577 Ga0501041_0003583 Ga0501041_0003583_3720_4610 256
67 3300049578 Ga0501042_0023322 Ga0501042_0023322_1473_2363 256
68 3300049580 Ga0501046_0024552 Ga0501046_0024552_2405_3295 256
69 3300049583 Ga0501067_0069783 Ga0501067_0069783_758_1648 256
70 3300049588 Ga0501072_0000312 Ga0501072_0000312_1764_2654 256
71 3300049592 Ga0501076_0003909 Ga0501076_0003909_7288_8178 256
72 3300049593 Ga0501077_0023657 Ga0501077_0023657_2396_3286 256
73 3300049741 Ga0501079_0001035 Ga0501079_0001035_17080_17970 256
74 3300049743 Ga0501081_0012980 Ga0501081_0012980_1056_1946 256
75 3300049822 Ga0501035_0100232 Ga0501035_0100232_1051_1941 256
76 3300049824 Ga0501045_0001320 Ga0501045_0001320_12122_13012 256
77 3300050507 nmdc:mga05p37_243750_c1 nmdc:mga05p37_243750_c1_469_1437 256
78 3300050507 nmdc:mga05p37_89470_c1 nmdc:mga05p37_89470_c1_2786_3664 256
79 3300061734 Ga0530510_0006343 Ga0530510_0006343_1668_2558 256
80 3300005295 Ga0065707_10083472 Ga0065707_100834725 257
81 3300005549 Ga0070704_100217047 Ga0070704_1002170472 257
82 3300009094 Ga0111539_10097099 Ga0111539_100970992 257
83 3300025885 Ga0207653_10049301 Ga0207653_100493012 257
84 3300026075 Ga0207708_10336104 Ga0207708_103361041 257
85 3300026095 Ga0207676_10304732 Ga0207676_103047321 257
86 3300005617 Ga0068859_100062870 Ga0068859_1000628702 258
87 3300005842 Ga0068858_100576611 Ga0068858_1005766111 258
88 3300005844 Ga0068862_100225921 Ga0068862_1002259212 258
89 3300006931 Ga0097620_100062870 Ga0097620_1000628705 258
90 3300011119 Ga0105246_10180340 Ga0105246_101803402 258
91 3300027682 Ga0209971_1007658 Ga0209971_10076582 258
92 3300028380 Ga0268265_10182298 Ga0268265_101822982 258
93 3300028380 Ga0268265_10314173 Ga0268265_103141731 258
94 3300048915 Ga0496112_0553518 Ga0496112_0553518_171_1043 258
95 3300049587 Ga0501071_0249616 Ga0501071_0249616_277_1146 258
96 3300049591 Ga0501075_0040298 Ga0501075_0040298_1173_2051 258
97 3300054114 Ga0501084_0157123 Ga0501084_0157123_988_1866 258
98 3300005564 Ga0070664_100414003 Ga0070664_1004140031 259
99 3300005618 Ga0068864_100015646 Ga0068864_1000156463 259
100 3300014325 Ga0163163_10012158 Ga0163163_100121588 259
101 3300025945 Ga0207679_10412680 Ga0207679_104126801 259
102 3300026095 Ga0207676_10228875 Ga0207676_102288752 259
103 3300049743 Ga0501081_0125226 Ga0501081_0125226_87_1016 259
104 3300005518 Ga0070699_100071121 Ga0070699_1000711212 260
105 3300014325 Ga0163163_10043337 Ga0163163_100433374 260
106 3300044712 Ga0453684_0424969 Ga0453684_0424969_351_1280 260
107 3300014325 Ga0163163_10137034 Ga0163163_101370342 261
108 3300049576 Ga0501040_0015113 Ga0501040_0015113_3634_4524 261
109 3300049577 Ga0501041_0028457 Ga0501041_0028457_2445_3335 261
110 3300049587 Ga0501071_0010449 Ga0501071_0010449_817_1707 261
111 3300049592 Ga0501076_0006757 Ga0501076_0006757_4367_5257 261
112 3300049593 Ga0501077_0022307 Ga0501077_0022307_24_914 261
113 3300044712 Ga0453684_0057762 Ga0453684_0057762_707_1666 262
114 3300005434 Ga0070709_10033424 Ga0070709_100334243 263
115 3300006175 Ga0070712_100246800 Ga0070712_1002468002 263
116 3300014325 Ga0163163_10079988 Ga0163163_100799883 263
117 3300014968 Ga0157379_10053856 Ga0157379_100538563 263
118 3300025898 Ga0207692_10028521 Ga0207692_100285212 263
119 3300026023 Ga0207677_10259011 Ga0207677_102590112 263
120 3300027876 Ga0209974_10007020 Ga0209974_100070202 263
121 3300042876 Ga0451577_0005474 Ga0451577_0005474_8946_9875 263
122 3300044712 Ga0453684_0001158 Ga0453684_0001158_24271_25200 263
123 3300048907 Ga0496104_0004342 Ga0496104_0004342_4520_5389 263
124 3300048908 Ga0496105_0001443 Ga0496105_0001443_9136_10005 263
125 3300048911 Ga0496108_0020446 Ga0496108_0020446_182_1051 263
126 3300048913 Ga0496110_0016550 Ga0496110_0016550_11_880 263
127 3300048914 Ga0496111_0004299 Ga0496111_0004299_6986_7855 263
128 3300048916 Ga0496113_0006190 Ga0496113_0006190_22_891 263
129 3300049568 Ga0501031_0007852 Ga0501031_0007852_1324_2187 263
130 3300049572 Ga0501036_0016262 Ga0501036_0016262_449_1312 263
131 3300049576 Ga0501040_0026516 Ga0501040_0026516_420_1283 263
132 3300049578 Ga0501042_0028646 Ga0501042_0028646_505_1368 263
133 3300049587 Ga0501071_0001608 Ga0501071_0001608_7233_8096 263
134 3300049591 Ga0501075_0121326 Ga0501075_0121326_540_1403 263
135 3300006844 Ga0075428_100000323 Ga0075428_10000032316 264
136 3300006880 Ga0075429_100171209 Ga0075429_1001712093 264
137 3300009147 Ga0114129_10000680 Ga0114129_1000068036 264
138 3300027665 Ga0209983_1005448 Ga0209983_10054483 264
139 3300045051 Ga0451576_0287370 Ga0451576_0287370_834_1685 264
140 3300050507 nmdc:mga05p37_600_c1 nmdc:mga05p37_600_c1_1182_2054 264
141 3300005334 Ga0068869_100104626 Ga0068869_1001046262 266
142 3300005518 Ga0070699_100146838 Ga0070699_1001468382 266
143 3300005544 Ga0070686_100053180 Ga0070686_1000531803 266
144 3300005547 Ga0070693_100166341 Ga0070693_1001663412 266
145 3300006846 Ga0075430_100006922 Ga0075430_10000692210 266
146 3300006847 Ga0075431_100039124 Ga0075431_1000391244 266
147 3300006880 Ga0075429_100301280 Ga0075429_1003012802 266
148 3300009098 Ga0105245_10050711 Ga0105245_100507112 266
149 3300025922 Ga0207646_10165164 Ga0207646_101651642 266
150 3300025934 Ga0207686_10212162 Ga0207686_102121621 266
151 3300025942 Ga0207689_10066385 Ga0207689_100663852 266
152 3300026121 Ga0207683_10050706 Ga0207683_100507064 266
153 3300050508 nmdc:mga09592_374744_c1 nmdc:mga09592_374744_c1_43_957 266
154 3300050509 nmdc:mga0qj67_2459_c1 nmdc:mga0qj67_2459_c1_5698_6612 266
155 3300050510 nmdc:mga06r32_25441_c1 nmdc:mga06r32_25441_c1_2731_3645 266
156 3300005518 Ga0070699_100149828 Ga0070699_1001498282 267
157 3300005842 Ga0068858_100449471 Ga0068858_1004494711 267
158 3300013308 Ga0157375_10126025 Ga0157375_101260253 267
159 3300014968 Ga0157379_10074013 Ga0157379_100740132 267
160 3300025941 Ga0207711_10108045 Ga0207711_101080453 267
161 3300026088 Ga0207641_10261146 Ga0207641_102611462 267
162 3300028381 Ga0268264_10177104 Ga0268264_101771042 267
163 3300044694 Ga0466963_0026939 Ga0466963_0026939_317_1192 267
164 3300045976 Ga0466967_0010870 Ga0466967_0010870_3816_4691 267
165 3300048912 Ga0496109_0002015 Ga0496109_0002015_5959_6828 267
166 3300048915 Ga0496112_0702220 Ga0496112_0702220_21_896 267
167 3300005985 Ga0081539_10001485 Ga0081539_1000148520 268
168 3300005981 Ga0081538_10001583 Ga0081538_1000158317 269
169 3300049576 Ga0501040_0086831 Ga0501040_0086831_232_1074 269
170 3300049578 Ga0501042_0068982 Ga0501042_0068982_1612_2454 269
171 3300049592 Ga0501076_0228119 Ga0501076_0228119_607_1449 269
172 3300049741 Ga0501079_0151567 Ga0501079_0151567_520_1362 269
173 3300049743 Ga0501081_0100004 Ga0501081_0100004_201_1043 269
174 3300054114 Ga0501084_0373834 Ga0501084_0373834_89_931 269
175 3300060353 Ga0501082_0018948 Ga0501082_0018948_4995_5837 269
176 3300061734 Ga0530510_0263640 Ga0530510_0263640_89_931 269
177 3300049576 Ga0501040_0210344 Ga0501040_0210344_337_1188 270
178 3300049583 Ga0501067_0164858 Ga0501067_0164858_28_879 270
179 3300049584 Ga0501068_0160204 Ga0501068_0160204_285_1136 270
180 3300049585 Ga0501069_0157260 Ga0501069_0157260_252_1103 270
181 3300049587 Ga0501071_0019669 Ga0501071_0019669_1611_2462 270
182 3300049588 Ga0501072_0140612 Ga0501072_0140612_337_1227 270
183 3300049589 Ga0501073_0014380 Ga0501073_0014380_2805_3656 270
184 3300049591 Ga0501075_0184819 Ga0501075_0184819_509_1360 270
185 3300049592 Ga0501076_0305586 Ga0501076_0305586_401_1252 270
186 3300049593 Ga0501077_0008710 Ga0501077_0008710_2559_3410 270
187 3300049741 Ga0501079_0005105 Ga0501079_0005105_4398_5249 270
188 3300049742 Ga0501080_0070100 Ga0501080_0070100_2129_2980 270
189 3300049743 Ga0501081_0181853 Ga0501081_0181853_590_1441 270
190 3300060353 Ga0501082_0186842 Ga0501082_0186842_230_1081 270
191 3300006844 Ga0075428_100164090 Ga0075428_1001640902 271
192 3300006880 Ga0075429_100120245 Ga0075429_1001202452 271
193 3300049576 Ga0501040_0139998 Ga0501040_0139998_437_1327 271
194 3300049577 Ga0501041_0031263 Ga0501041_0031263_1091_1981 271
195 3300049578 Ga0501042_0266277 Ga0501042_0266277_275_1165 271
196 3300049591 Ga0501075_0091735 Ga0501075_0091735_1196_2086 271
197 3300049592 Ga0501076_0175012 Ga0501076_0175012_143_1033 271
198 3300049741 Ga0501079_0136624 Ga0501079_0136624_571_1461 271
199 3300050508 nmdc:mga09592_193361_c1 nmdc:mga09592_193361_c1_713_1594 271
200 3300054114 Ga0501084_0083879 Ga0501084_0083879_1489_2379 271
201 3300061734 Ga0530510_0249949 Ga0530510_0249949_414_1304 271
202 3300005985 Ga0081539_10027273 Ga0081539_100272733 272
203 3300006846 Ga0075430_100372828 Ga0075430_1003728281 272
204 3300005536 Ga0070697_100091018 Ga0070697_1000910182 273
205 3300049588 Ga0501072_0113733 Ga0501072_0113733_808_1704 273
206 3300009147 Ga0114129_10095678 Ga0114129_100956783 275
207 3300013296 Ga0157374_10271398 Ga0157374_102713983 275
208 3300044673 Ga0453683_0124724 Ga0453683_0124724_303_1181 275
209 3300049568 Ga0501031_0070325 Ga0501031_0070325_1096_1941 275
210 3300049576 Ga0501040_0007712 Ga0501040_0007712_371_1219 275
211 3300049578 Ga0501042_0122441 Ga0501042_0122441_595_1440 275
212 3300049580 Ga0501046_0059136 Ga0501046_0059136_2026_2874 275
213 3300049587 Ga0501071_0019519 Ga0501071_0019519_1336_2181 275
214 3300049588 Ga0501072_0055059 Ga0501072_0055059_1095_1943 275
215 3300049588 Ga0501072_0094903 Ga0501072_0094903_639_1484 275
216 3300049591 Ga0501075_0047318 Ga0501075_0047318_850_1695 275
217 3300049592 Ga0501076_0010944 Ga0501076_0010944_5499_6347 275
218 3300049592 Ga0501076_0060887 Ga0501076_0060887_1339_2184 275
219 3300049593 Ga0501077_0074857 Ga0501077_0074857_242_1090 275
220 3300049593 Ga0501077_0075940 Ga0501077_0075940_871_1716 275
221 3300049741 Ga0501079_0006699 Ga0501079_0006699_2826_3671 275
222 3300049743 Ga0501081_0105389 Ga0501081_0105389_602_1450 275
223 3300049743 Ga0501081_0299071 Ga0501081_0299071_168_1013 275
224 3300049824 Ga0501045_0326195 Ga0501045_0326195_29_874 275
225 3300054114 Ga0501084_0030497 Ga0501084_0030497_1656_2501 275
226 3300061734 Ga0530510_0079177 Ga0530510_0079177_507_1352 275
227 3300061734 Ga0530510_0183152 Ga0530510_0183152_522_1370 275
228 3300005354 Ga0070675_100654191 Ga0070675_1006541911 276
229 3300035113 Ga0373936_0018522 Ga0373936_0018522_508_1395 278
230 3300035117 Ga0373953_0122292 Ga0373953_0122292_192_1079 278
231 3300035724 Ga0373933_0050017 Ga0373933_0050017_1389_2276 278
232 3300046462 Ga0495651_0097136 Ga0495651_0097136_1163_2050 278
233 3300046463 Ga0495653_0325233 Ga0495653_0325233_42_929 278
234 3300046511 Ga0495608_0029389 Ga0495608_0029389_2535_3422 278
235 3300046514 Ga0495618_0090551 Ga0495618_0090551_918_1805 278
236 3300046529 Ga0495652_0059546 Ga0495652_0059546_734_1621 278
237 3300046536 Ga0495587_0070139 Ga0495587_0070139_566_1453 278
238 3300046642 Ga0495634_0256406 Ga0495634_0256406_130_1017 278
239 3300046663 Ga0495635_0050583 Ga0495635_0050583_1649_2536 278
240 3300046675 Ga0495657_0223556 Ga0495657_0223556_230_1117 278
241 3300046679 Ga0495623_0175421 Ga0495623_0175421_257_1144 278
242 3300046680 Ga0495646_0065476 Ga0495646_0065476_273_1160 278
243 3300047322 Ga0495680_0062128 Ga0495680_0062128_230_1117 278
244 3300047471 Ga0495684_0007014 Ga0495684_0007014_4822_5709 278
245 3300048088 Ga0495602_0080108 Ga0495602_0080108_816_1703 278
246 3300035692 Ga0373935_0246765 Ga0373935_0246765_130_1017 279
247 3300035725 Ga0373947_0140784 Ga0373947_0140784_388_1275 279
248 3300045976 Ga0466967_0511506 Ga0466967_0511506_190_1074 280
249 3300025929 Ga0207664_10354156 Ga0207664_103541561 281
250 3300003659 JGI25404J52841_10005030 JGI25404J52841_100050302 282
251 3300005435 Ga0070714_100029050 Ga0070714_1000290503 282
252 3300005983 Ga0081540_1000184 Ga0081540_100018440 282
253 3300006163 Ga0070715_10020897 Ga0070715_100208973 282
254 3300025929 Ga0207664_10003559 Ga0207664_100035592 282
255 3300035083 Ga0373926_0017101 Ga0373926_0017101_76_951 282
256 3300035089 Ga0373944_0000987 Ga0373944_0000987_5372_6247 282
257 3300035113 Ga0373936_0001138 Ga0373936_0001138_7215_8090 282
258 3300035116 Ga0373945_0001530 Ga0373945_0001530_3745_4620 282
259 3300035170 Ga0373943_0001444 Ga0373943_0001444_9588_10463 282
260 3300035171 Ga0373946_0000281 Ga0373946_0000281_8161_9036 282
261 3300035172 Ga0373955_0020360 Ga0373955_0020360_888_1763 282
262 3300035692 Ga0373935_0010755 Ga0373935_0010755_2945_3820 282
263 3300035695 Ga0373927_0003891 Ga0373927_0003891_2176_3051 282
264 3300035725 Ga0373947_0000373 Ga0373947_0000373_18021_18896 282
265 3300037068 Ga0373925_0014291 Ga0373925_0014291_3709_4584 282
266 3300046462 Ga0495651_0205371 Ga0495651_0205371_303_1178 282
267 3300046463 Ga0495653_0002059 Ga0495653_0002059_4549_5424 282
268 3300046473 Ga0495582_0013402 Ga0495582_0013402_844_1719 282
269 3300046476 Ga0495662_0018118 Ga0495662_0018118_2454_3329 282
270 3300046477 Ga0495664_0000503 Ga0495664_0000503_1586_2461 282
271 3300046511 Ga0495608_0029416 Ga0495608_0029416_1474_2349 282
272 3300046514 Ga0495618_0045868 Ga0495618_0045868_1448_2323 282
273 3300046516 Ga0495628_0104890 Ga0495628_0104890_905_1780 282
274 3300046517 Ga0495630_0115577 Ga0495630_0115577_746_1621 282
275 3300046529 Ga0495652_0025887 Ga0495652_0025887_2857_3732 282
276 3300046531 Ga0495665_0018383 Ga0495665_0018383_2605_3480 282
277 3300046533 Ga0495640_0032785 Ga0495640_0032785_1969_2844 282
278 3300046559 Ga0495667_0004226 Ga0495667_0004226_1563_2438 282
279 3300046642 Ga0495634_0016001 Ga0495634_0016001_2471_3346 282
280 3300046663 Ga0495635_0000401 Ga0495635_0000401_18106_18981 282
281 3300046675 Ga0495657_0010704 Ga0495657_0010704_577_1452 282
282 3300046678 Ga0495599_0011939 Ga0495599_0011939_507_1382 282
283 3300046690 Ga0495624_0001046 Ga0495624_0001046_8505_9380 282
284 3300047319 Ga0495674_0000368 Ga0495674_0000368_12576_13451 282
285 3300047321 Ga0495676_0017112 Ga0495676_0017112_1651_2526 282
286 3300047322 Ga0495680_0059711 Ga0495680_0059711_1440_2315 282
287 3300047471 Ga0495684_0003747 Ga0495684_0003747_1449_2324 282
288 3300047673 Ga0495593_0097301 Ga0495593_0097301_426_1301 282
289 3300053085 Ga0495619_0253587 Ga0495619_0253587_41_916 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04228

Zn_peptidase

Putative neutral zinc metallopeptidase

44

323

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eom-assembly1.cif.gz_A structure of dpp iii from caldithrix abyssi 0.3828 83 278
6c4l-assembly1.cif.gz_C-2 yersinopine dehydrogenase (ypodh) - apo 0.3213 193 271
4nsc-assembly1.cif.gz_D crystal structure of cbara1 in the apo-form 0.3087 140 267
6gcn-assembly2.cif.gz_D-2 truncated ftsh from a. aeolicus in r32 0.3018 190 270
4ww0-assembly1.cif.gz_C-2 truncated ftsh from a. aeolicus 0.2992 137 270
ID Description Score Start End Superfamily
af_P9WL85_4_287_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.7964 4 278 3.40.390.10
af_P9WL85_4_287_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.7743 4 278 3.40.390.10
af_P64429_1_283_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.7162 1 278 3.40.390.10
af_P64429_1_283_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.7044 1 278 3.40.390.10
af_A0A0R0G7E0_1084_1251_1.10.357.90 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Telomerase reverse transcriptase (TERT), thumb domain 0.4794 153 269 1.10.357.90
ID Description Score Start End GO Terms
AF-A0A1M3LFZ0-F1-model_v4 Neutral zinc metallopeptidase 0.9657 66 281 GO:0016020
AF-A0A1B9EWV7-F1-model_v4 Putative neutral zinc metallopeptidase 0.9648 114 278 GO:0016020
AF-A0A535JW09-F1-model_v4 Flagellar biosynthesis protein FlgM 0.9646 107 281 GO:0016020
AF-A0A251XGV7-F1-model_v4 Putative neutral zinc metallopeptidase 0.9606 86 281 GO:0016020
AF-A0A7C5GX17-F1-model_v4 Flagellar biosynthesis protein FlgM 0.9589 191 278 GO:0016020

Feature Viewer

pLDDT pTM Quality
83.09 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map