F389175

General Info

Members Datasets Scaffolds Average Seq Length
289 190 578 137

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10100035|Ga0105237_101000352
Length 154
Sequence MYRADAGGAVDAGQKMTDAGAIWPDDDVILFDGVCIFCSRWVRFVAARDTAAHFRFTAIQSPYGARLAQALGIDADDPDTNAVIHGGAAYFKSDGALTVLSCLPGWSWVRVLFAVPRFMRDGVYNLVAKNRYRIFGKYDTCIVPDAGLRARVME

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
29 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
68 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
69 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
70 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
75 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
76 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
79 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
80 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
81 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
82 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
83 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
84 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
85 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
155 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
156 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
159 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
160 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
161 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
162 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
163 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
164 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
165 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
166 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
167 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
168 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
169 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
170 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
171 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
172 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
173 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
174 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
175 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
176 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
177 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
178 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
179 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
180 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
183 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
184 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
185 2904699407
186 2906610324
187 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
188 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
189 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
190 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.56
Metatranscriptomes 0
Isolates 2.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.34
Nodule 3.11
Rhizoplane 2.77
Rhizosphere 76.47
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10100035 3300009545 Bacteria 2891
2 JGI25406J46586_10000084 3300003203 Bacteria 42873
3 JGI25404J52841_10027874 3300003659 Bacteria 1213
4 Ga0065165_1027935 3300005262 Bacteria 1830
5 Ga0070683_100026934 3300005329 Bacteria 5181
6 Ga0070683_100436102 3300005329 Bacteria 1250
7 Ga0070683_100620757 3300005329 Bacteria 1035
8 Ga0070680_100068427 3300005336 Bacteria 2915
9 Ga0070680_100169175 3300005336 Bacteria 1838
10 Ga0070682_100027431 3300005337 Bacteria 3417
11 Ga0070682_101461169 3300005337 Bacteria 586
12 Ga0070660_101616155 3300005339 Bacteria 552
13 Ga0070691_10073981 3300005341 Bacteria 1657
14 Ga0070691_10243300 3300005341 Bacteria 962
15 Ga0070661_100687974 3300005344 Bacteria 832
16 Ga0070709_10036054 3300005434 Bacteria 3010
17 Ga0070709_10056340 3300005434 Bacteria 2485
18 Ga0070709_10179457 3300005434 Bacteria 1486
19 Ga0070709_10719323 3300005434 Bacteria 778
20 Ga0070714_100055257 3300005435 Bacteria 3393
21 Ga0070714_100095127 3300005435 Bacteria 2615
22 Ga0070714_100144970 3300005435 Bacteria 2135
23 Ga0070714_100810719 3300005435 Bacteria 907
24 Ga0070714_102108901 3300005435 Bacteria 549
25 Ga0070713_100011594 3300005436 Bacteria 6426
26 Ga0070713_100103722 3300005436 Bacteria 2468
27 Ga0070713_100127660 3300005436 Bacteria 2239
28 Ga0070713_100131499 3300005436 Bacteria 2208
29 Ga0070713_100349244 3300005436 Bacteria 1372
30 Ga0070710_10158608 3300005437 Bacteria 1401
31 Ga0070711_100217688 3300005439 Bacteria 1482
32 Ga0070711_100713686 3300005439 Bacteria 845
33 Ga0070681_10027149 3300005458 Bacteria 5756
34 Ga0070681_10062558 3300005458 Bacteria 3696
35 Ga0070681_10087827 3300005458 Bacteria 3062
36 Ga0070681_10810565 3300005458 Bacteria 853
37 Ga0070679_100036684 3300005530 Bacteria 4865
38 Ga0070684_100112441 3300005535 Bacteria 2443
39 Ga0070684_100148682 3300005535 Bacteria 2121
40 Ga0070684_100572675 3300005535 Bacteria 1049
41 Ga0068857_100323580 3300005577 Bacteria 1424
42 Ga0068857_100730869 3300005577 Bacteria 942
43 Ga0068857_101206486 3300005577 Bacteria 733
44 Ga0068856_102343689 3300005614 Bacteria 542
45 Ga0068860_102396895 3300005843 Bacteria 548
46 Ga0081540_1027164 3300005983 Bacteria 3249
47 Ga0081539_10000265 3300005985 Bacteria 120457
48 Ga0081539_10031169 3300005985 Bacteria 3293
49 Ga0070717_10000269 3300006028 Bacteria 35470
50 Ga0070717_10238755 3300006028 Bacteria 1602
51 Ga0070712_100042814 3300006175 Bacteria 3115
52 Ga0070712_100634610 3300006175 Bacteria 907
53 Ga0075434_100215409 3300006871 Bacteria 1940
54 Ga0075436_100100544 3300006914 Bacteria 2014
55 Ga0099824_1006119 3300006942 Bacteria 16669
56 Ga0099822_1006113 3300006943 Bacteria 15697
57 Ga0075435_100044163 3300007076 Bacteria 3569
58 Ga0099795_10048438 3300007788 Bacteria 1539
59 Ga0105240_10022674 3300009093 Bacteria 8318
60 Ga0105240_10165672 3300009093 Bacteria 2622
61 Ga0105240_10974971 3300009093 Bacteria 908
62 Ga0105240_11057666 3300009093 Bacteria 865
63 Ga0105245_12052169 3300009098 Bacteria 625
64 Ga0105247_11642311 3300009101 Bacteria 529
65 Ga0105242_12569542 3300009176 Bacteria 558
66 Ga0105248_10069715 3300009177 Bacteria 3948
67 Ga0105237_10019263 3300009545 Bacteria 7049
68 Ga0105237_10034392 3300009545 Bacteria 5132
69 Ga0105237_10405977 3300009545 Bacteria 1367
70 Ga0105238_10030061 3300009551 Bacteria 5528
71 Ga0105238_10210481 3300009551 Bacteria 1920
72 Ga0157370_10794772 3300013104 Bacteria 861
73 Ga0157369_10005855 3300013105 Bacteria 14284
74 Ga0157369_10030968 3300013105 Bacteria 5896
75 Ga0157374_12382236 3300013296 Bacteria 557
76 Ga0163162_12860541 3300013306 Bacteria 555
77 Ga0157372_10128601 3300013307 Bacteria 2913
78 Ga0157372_10306030 3300013307 Bacteria 1849
79 Ga0157376_10067353 3300014969 Bacteria 3028
80 Ga0213874_10047714 3300021377 Bacteria 1304
81 Ga0213876_10208095 3300021384 Bacteria 1040
82 Ga0213875_10021774 3300021388 Bacteria 3067
83 Ga0207692_10136286 3300025898 Bacteria 1392
84 Ga0207692_10696885 3300025898 Bacteria 659
85 Ga0207647_10119082 3300025904 Bacteria 1557
86 Ga0207699_10016497 3300025906 Bacteria 3866
87 Ga0207699_10058617 3300025906 Bacteria 2304
88 Ga0207699_10138170 3300025906 Bacteria 1598
89 Ga0207707_10010242 3300025912 Bacteria 8138
90 Ga0207707_10037030 3300025912 Bacteria 4263
91 Ga0207707_10067620 3300025912 Bacteria 3112
92 Ga0207695_10018913 3300025913 Bacteria 7947
93 Ga0207695_10847540 3300025913 Bacteria 794
94 Ga0207695_11426979 3300025913 Bacteria 573
95 Ga0207671_10112204 3300025914 Bacteria 2075
96 Ga0207671_10120280 3300025914 Bacteria 2007
97 Ga0207671_10692115 3300025914 Bacteria 811
98 Ga0207693_10037980 3300025915 Bacteria 3794
99 Ga0207663_11236744 3300025916 Bacteria 601
100 Ga0207652_10010137 3300025921 Bacteria 7592
101 Ga0207652_10154247 3300025921 Bacteria 2057
102 Ga0207652_10200488 3300025921 Bacteria 1796
103 Ga0207652_11379857 3300025921 Bacteria 608
104 Ga0207694_10030285 3300025924 Bacteria 4133
105 Ga0207694_10308973 3300025924 Bacteria 1303
106 Ga0207700_10001978 3300025928 Bacteria 11673
107 Ga0207700_10011092 3300025928 Bacteria 5730
108 Ga0207700_10037992 3300025928 Bacteria 3492
109 Ga0207700_10066827 3300025928 Bacteria 2749
110 Ga0207664_10053779 3300025929 Bacteria 3189
111 Ga0207664_10082011 3300025929 Bacteria 2626
112 Ga0207664_10658029 3300025929 Bacteria 942
113 Ga0207664_10804514 3300025929 Bacteria 845
114 Ga0207709_11241248 3300025935 Bacteria 615
115 Ga0207665_10314187 3300025939 Unclassified 1174
116 Ga0207665_10379736 3300025939 Bacteria 1072
117 Ga0207711_10095604 3300025941 Bacteria 2621
118 Ga0207661_10005395 3300025944 Bacteria 9003
119 Ga0207661_10033607 3300025944 Bacteria 3982
120 Ga0207661_10703822 3300025944 Bacteria 929
121 Ga0207678_10491356 3300026067 Bacteria 1069
122 Ga0207702_10034178 3300026078 Bacteria 4250
123 Ga0207702_10259015 3300026078 Bacteria 1637
124 Ga0207674_10650231 3300026116 Bacteria 1018
125 Ga0207674_10736419 3300026116 Bacteria 951
126 Ga0207698_11919086 3300026142 Bacteria 607
127 Ga0209589_1000021 3300027357 Bacteria 186431
128 Ga0209489_100028 3300027361 Bacteria 186431
129 Ga0209700_100037 3300027363 Bacteria 186431
130 Ga0307517_10000175 3300028786 Bacteria 105567
131 Ga0265339_10233712 3300031249 Bacteria 895
132 Ga0307508_10144838 3300031616 Bacteria 1980
133 Ga0307414_10102200 3300032004 Bacteria 2160
134 Ga0307510_10251907 3300033180 Bacteria 1253
135 Ga0373926_0009339 3300035083 Bacteria 3276
136 Ga0373923_0154423 3300035111 Bacteria 1044
137 Ga0373936_0025808 3300035113 Bacteria 2299
138 Ga0373939_0285080 3300035114 Bacteria 654
139 Ga0373945_0015040 3300035116 Bacteria 2600
140 Ga0373953_0068888 3300035117 Bacteria 1457
141 Ga0373953_0120959 3300035117 Bacteria 1112
142 Ga0373954_0023261 3300035118 Bacteria 2816
143 Ga0373954_0151597 3300035118 Bacteria 1132
144 Ga0373957_0072166 3300035120 Bacteria 1352
145 Ga0373946_0015093 3300035171 Bacteria 2923
146 Ga0373955_0034934 3300035172 Bacteria 2659
147 Ga0373955_0096580 3300035172 Bacteria 1691
148 Ga0373955_0303390 3300035172 Bacteria 963
149 Ga0373924_0116967 3300035410 Bacteria 1155
150 Ga0373924_0309526 3300035410 Bacteria 702
151 Ga0373935_0022440 3300035692 Bacteria 3871
152 Ga0373935_0205862 3300035692 Bacteria 1361
153 Ga0373927_0050171 3300035695 Bacteria 2698
154 Ga0373927_0296054 3300035695 Bacteria 1065
155 Ga0373933_0006512 3300035724 Bacteria 6359
156 Ga0373947_0036763 3300035725 Bacteria 2904
157 Ga0373937_0222689 3300036401 Bacteria 1776
158 Ga0373937_0375533 3300036401 Bacteria 1348
159 Ga0373925_0006615 3300037068 Bacteria 8518
160 Ga0373925_0277952 3300037068 Bacteria 1348
161 Ga0373925_0581442 3300037068 Bacteria 922
162 Ga0395900_0199558 3300037418 Bacteria 2025
163 Ga0395898_0091699 3300037466 Bacteria 2923
164 Ga0395905_1638828 3300037471 Bacteria 548
165 Ga0436364_1013168 3300037853 Bacteria 963
166 Ga0436364_1386109 3300037853 Bacteria 2512
167 Ga0436364_1431717 3300037853 Bacteria 519
168 Ga0395901_0292434 3300038443 Bacteria 1690
169 Ga0436365_0286958 3300039437 Bacteria 2961
170 Ga0436365_0802562 3300039437 Bacteria 3274
171 Ga0436365_1502349 3300039437 Bacteria 1221
172 Ga0436360_0197728 3300039438 Bacteria 1274
173 Ga0436363_0608387 3300039450 Bacteria 847
174 Ga0436363_0719125 3300039450 Bacteria 844
175 Ga0436363_1123481 3300039450 Bacteria 2965
176 Ga0451853_3473383 3300041512 Bacteria 573
177 Ga0466963_0052558 3300044694 Bacteria 2704
178 Ga0466963_1000634 3300044694 Bacteria 589
179 Ga0466964_0915001 3300044706 Bacteria 503
180 Ga0466968_0254396 3300044735 Bacteria 835
181 Ga0466968_0416163 3300044735 Bacteria 661
182 Ga0466970_0610101 3300044765 Bacteria 633
183 Ga0466959_0102609 3300045049 Bacteria 2047
184 Ga0466967_0019082 3300045976 Bacteria 5505
185 Ga0466967_0334656 3300045976 Bacteria 1463
186 Ga0495592_0432473 3300046454 Bacteria 828
187 Ga0495592_0808822 3300046454 Bacteria 556
188 Ga0495629_0107910 3300046459 Bacteria 1942
189 Ga0495638_0088397 3300046460 Bacteria 1871
190 Ga0495651_0043012 3300046462 Bacteria 3505
191 Ga0495651_0111433 3300046462 Bacteria 2023
192 Ga0495651_0134652 3300046462 Bacteria 1799
193 Ga0495653_0252825 3300046463 Bacteria 1169
194 Ga0495580_0032873 3300046472 Bacteria 3738
195 Ga0495582_0009820 3300046473 Bacteria 5272
196 Ga0495639_0008629 3300046475 Bacteria 4371
197 Ga0495662_0230979 3300046476 Bacteria 912
198 Ga0495662_0394371 3300046476 Bacteria 680
199 Ga0495664_0060630 3300046477 Bacteria 2252
200 Ga0495664_0227199 3300046477 Bacteria 1129
201 Ga0495664_0290666 3300046477 Bacteria 987
202 Ga0495608_0214387 3300046511 Bacteria 1210
203 Ga0495618_0035002 3300046514 Bacteria 3151
204 Ga0495628_0054700 3300046516 Bacteria 3146
205 Ga0495628_0169497 3300046516 Bacteria 1656
206 Ga0495630_0034668 3300046517 Bacteria 3769
207 Ga0495640_0801812 3300046533 Bacteria 561
208 Ga0495587_0402674 3300046536 Bacteria 760
209 Ga0495587_0633049 3300046536 Bacteria 588
210 Ga0495645_0152274 3300046543 Bacteria 1605
211 Ga0495645_0268495 3300046543 Bacteria 1127
212 Ga0495667_0129301 3300046559 Bacteria 1629
213 Ga0495634_0039720 3300046642 Bacteria 3203
214 Ga0495634_0196996 3300046642 Bacteria 1253
215 Ga0495635_0085349 3300046663 Bacteria 2160
216 Ga0495635_0455645 3300046663 Bacteria 845
217 Ga0495588_0152171 3300046674 Bacteria 1223
218 Ga0495623_0135473 3300046679 Bacteria 1470
219 Ga0495658_0221965 3300046683 Bacteria 1183
220 Ga0495604_0111791 3300047317 Bacteria 1991
221 Ga0495604_0887173 3300047317 Bacteria 558
222 Ga0495674_0092757 3300047319 Bacteria 2577
223 Ga0495672_0008306 3300047320 Bacteria 7687
224 Ga0495672_0213229 3300047320 Bacteria 958
225 Ga0495673_0067749 3300047469 Bacteria 1510
226 Ga0495684_0021095 3300047471 Bacteria 5018
227 Ga0495684_0307433 3300047471 Bacteria 1137
228 Ga0495686_0172829 3300047472 Bacteria 1256
229 Ga0495593_0201669 3300047673 Bacteria 1000
230 Ga0495602_0454504 3300048088 Bacteria 903
231 Ga0495602_0576148 3300048088 Bacteria 777
232 Ga0496100_0463329 3300048903 Bacteria 973
233 Ga0496101_0361195 3300048904 Bacteria 1142
234 Ga0496104_0138476 3300048907 Bacteria 2339
235 Ga0496105_0137150 3300048908 Bacteria 2015
236 Ga0496111_0798436 3300048914 Bacteria 683
237 Ga0496112_0189341 3300048915 Bacteria 2020
238 Ga0496112_0340803 3300048915 Bacteria 1442
239 Ga0496115_0176653 3300048918 Bacteria 1766
240 Ga0496126_0036145 3300048929 Bacteria 4621
241 Ga0496126_0214619 3300048929 Bacteria 1619
242 Ga0496126_0366892 3300048929 Bacteria 1175
243 Ga0501046_0346130 3300049580 Bacteria 1080
244 Ga0501070_0147121 3300049586 Bacteria 1944
245 Ga0501080_0067076 3300049742 Bacteria 3337
246 Ga0501044_0037204 3300049823 Bacteria 5088
247 nmdc:mga04h51_71730_c1 3300050495 Bacteria 1210
248 nmdc:mga0n895_86240_c1 3300050512 Bacteria 3136
249 nmdc:mga0rr50_30545_c1 3300050513 Bacteria 3816
250 Ga0495601_0107633 3300053077 Bacteria 1804
251 Ga0495612_0263764 3300053078 Bacteria 768
252 Ga0500635_0075716 3300053080 Bacteria 1201
253 Ga0495595_0383202 3300053084 Bacteria 711
254 Ga0495619_0058770 3300053085 Bacteria 2553
255 Ga0495619_0075121 3300053085 Bacteria 2267
256 Ga0500647_0013581 3300053091 Bacteria 3685
257 Ga0500566_0000649 3300053094 Bacteria 19469
258 Ga0500640_082804 3300053095 Bacteria 1357
259 Ga0500641_0292629 3300053096 Bacteria 671
260 Ga0500648_218414 3300053097 Bacteria 937
261 Ga0500572_001552 3300053111 Bacteria 6144
262 Ga0500591_172810 3300053115 Bacteria 795
263 Ga0500594_0020489 3300053118 Bacteria 1651
264 Ga0500595_001755 3300053119 Bacteria 11291
265 Ga0500608_053514 3300053122 Bacteria 1938
266 Ga0500614_025276 3300053123 Bacteria 1410
267 Ga0500642_0094694 3300053130 Bacteria 1383
268 Ga0500559_0240312 3300053136 Bacteria 853
269 Ga0500590_049421 3300053148 Bacteria 2141
270 Ga0500603_026408 3300053150 Bacteria 1467
271 Ga0500622_0259150 3300053156 Bacteria 759
272 Ga0500627_0243538 3300053158 Bacteria 797
273 Ga0500630_073462 3300053159 Bacteria 1613
274 Ga0500638_039551 3300053162 Bacteria 2289
275 Ga0500638_345551 3300053162 Bacteria 554
276 Ga0500639_017821 3300053163 Bacteria 3747
277 Ga0500636_0064631 3300053177 Bacteria 2131
278 Ga0500637_0134655 3300053178 Bacteria 1431
279 Ga0500596_000269 3300053735 Bacteria 9174
280 Ga0466962_0159615 3300061719 Bacteria 1096
281 2888379497 2888378607 Bacteria 9652610
282 2889035399 2889033259 Bacteria 9099371
283 2903749118 2903748898 Bacteria 9972761
284 2904708532
285 2906613991
286 2908747544 2908739725 Bacteria 8628932
287 2922363918 2922361189 Bacteria 7436256
288 8006991008 8006984368 Bacteria 9651211
289 8056676040 8056673599 Bacteria 7871253
290 Ga0105237_10100035
291 JGI25406J46586_10000084
292 JGI25404J52841_10027874
293 Ga0065165_1027935
294 Ga0070683_100026934
295 Ga0070683_100436102
296 Ga0070683_100620757
297 Ga0070680_100068427
298 Ga0070680_100169175
299 Ga0070682_100027431
300 Ga0070682_101461169
301 Ga0070660_101616155
302 Ga0070691_10073981
303 Ga0070691_10243300
304 Ga0070661_100687974
305 Ga0070709_10036054
306 Ga0070709_10056340
307 Ga0070709_10179457
308 Ga0070709_10719323
309 Ga0070714_100055257
310 Ga0070714_100095127
311 Ga0070714_100144970
312 Ga0070714_100810719
313 Ga0070714_102108901
314 Ga0070713_100011594
315 Ga0070713_100103722
316 Ga0070713_100127660
317 Ga0070713_100131499
318 Ga0070713_100349244
319 Ga0070710_10158608
320 Ga0070711_100217688
321 Ga0070711_100713686
322 Ga0070681_10027149
323 Ga0070681_10062558
324 Ga0070681_10087827
325 Ga0070681_10810565
326 Ga0070679_100036684
327 Ga0070684_100112441
328 Ga0070684_100148682
329 Ga0070684_100572675
330 Ga0068857_100323580
331 Ga0068857_100730869
332 Ga0068857_101206486
333 Ga0068856_102343689
334 Ga0068860_102396895
335 Ga0081540_1027164
336 Ga0081539_10000265
337 Ga0081539_10031169
338 Ga0070717_10000269
339 Ga0070717_10238755
340 Ga0070712_100042814
341 Ga0070712_100634610
342 Ga0075434_100215409
343 Ga0075436_100100544
344 Ga0099824_1006119
345 Ga0099822_1006113
346 Ga0075435_100044163
347 Ga0099795_10048438
348 Ga0105240_10022674
349 Ga0105240_10165672
350 Ga0105240_10974971
351 Ga0105240_11057666
352 Ga0105245_12052169
353 Ga0105247_11642311
354 Ga0105242_12569542
355 Ga0105248_10069715
356 Ga0105237_10019263
357 Ga0105237_10034392
358 Ga0105237_10405977
359 Ga0105238_10030061
360 Ga0105238_10210481
361 Ga0157370_10794772
362 Ga0157369_10005855
363 Ga0157369_10030968
364 Ga0157374_12382236
365 Ga0163162_12860541
366 Ga0157372_10128601
367 Ga0157372_10306030
368 Ga0157376_10067353
369 Ga0213874_10047714
370 Ga0213876_10208095
371 Ga0213875_10021774
372 Ga0207692_10136286
373 Ga0207692_10696885
374 Ga0207647_10119082
375 Ga0207699_10016497
376 Ga0207699_10058617
377 Ga0207699_10138170
378 Ga0207707_10010242
379 Ga0207707_10037030
380 Ga0207707_10067620
381 Ga0207695_10018913
382 Ga0207695_10847540
383 Ga0207695_11426979
384 Ga0207671_10112204
385 Ga0207671_10120280
386 Ga0207671_10692115
387 Ga0207693_10037980
388 Ga0207663_11236744
389 Ga0207652_10010137
390 Ga0207652_10154247
391 Ga0207652_10200488
392 Ga0207652_11379857
393 Ga0207694_10030285
394 Ga0207694_10308973
395 Ga0207700_10001978
396 Ga0207700_10011092
397 Ga0207700_10037992
398 Ga0207700_10066827
399 Ga0207664_10053779
400 Ga0207664_10082011
401 Ga0207664_10658029
402 Ga0207664_10804514
403 Ga0207709_11241248
404 Ga0207665_10314187
405 Ga0207665_10379736
406 Ga0207711_10095604
407 Ga0207661_10005395
408 Ga0207661_10033607
409 Ga0207661_10703822
410 Ga0207678_10491356
411 Ga0207702_10034178
412 Ga0207702_10259015
413 Ga0207674_10650231
414 Ga0207674_10736419
415 Ga0207698_11919086
416 Ga0209589_1000021
417 Ga0209489_100028
418 Ga0209700_100037
419 Ga0307517_10000175
420 Ga0265339_10233712
421 Ga0307508_10144838
422 Ga0307414_10102200
423 Ga0307510_10251907
424 Ga0373926_0009339
425 Ga0373923_0154423
426 Ga0373936_0025808
427 Ga0373939_0285080
428 Ga0373945_0015040
429 Ga0373953_0068888
430 Ga0373953_0120959
431 Ga0373954_0023261
432 Ga0373954_0151597
433 Ga0373957_0072166
434 Ga0373946_0015093
435 Ga0373955_0034934
436 Ga0373955_0096580
437 Ga0373955_0303390
438 Ga0373924_0116967
439 Ga0373924_0309526
440 Ga0373935_0022440
441 Ga0373935_0205862
442 Ga0373927_0050171
443 Ga0373927_0296054
444 Ga0373933_0006512
445 Ga0373947_0036763
446 Ga0373937_0222689
447 Ga0373937_0375533
448 Ga0373925_0006615
449 Ga0373925_0277952
450 Ga0373925_0581442
451 Ga0395900_0199558
452 Ga0395898_0091699
453 Ga0395905_1638828
454 Ga0436364_1013168
455 Ga0436364_1386109
456 Ga0436364_1431717
457 Ga0395901_0292434
458 Ga0436365_0286958
459 Ga0436365_0802562
460 Ga0436365_1502349
461 Ga0436360_0197728
462 Ga0436363_0608387
463 Ga0436363_0719125
464 Ga0436363_1123481
465 Ga0451853_3473383
466 Ga0466963_0052558
467 Ga0466963_1000634
468 Ga0466964_0915001
469 Ga0466968_0254396
470 Ga0466968_0416163
471 Ga0466970_0610101
472 Ga0466959_0102609
473 Ga0466967_0019082
474 Ga0466967_0334656
475 Ga0495592_0432473
476 Ga0495592_0808822
477 Ga0495629_0107910
478 Ga0495638_0088397
479 Ga0495651_0043012
480 Ga0495651_0111433
481 Ga0495651_0134652
482 Ga0495653_0252825
483 Ga0495580_0032873
484 Ga0495582_0009820
485 Ga0495639_0008629
486 Ga0495662_0230979
487 Ga0495662_0394371
488 Ga0495664_0060630
489 Ga0495664_0227199
490 Ga0495664_0290666
491 Ga0495608_0214387
492 Ga0495618_0035002
493 Ga0495628_0054700
494 Ga0495628_0169497
495 Ga0495630_0034668
496 Ga0495640_0801812
497 Ga0495587_0402674
498 Ga0495587_0633049
499 Ga0495645_0152274
500 Ga0495645_0268495
501 Ga0495667_0129301
502 Ga0495634_0039720
503 Ga0495634_0196996
504 Ga0495635_0085349
505 Ga0495635_0455645
506 Ga0495588_0152171
507 Ga0495623_0135473
508 Ga0495658_0221965
509 Ga0495604_0111791
510 Ga0495604_0887173
511 Ga0495674_0092757
512 Ga0495672_0008306
513 Ga0495672_0213229
514 Ga0495673_0067749
515 Ga0495684_0021095
516 Ga0495684_0307433
517 Ga0495686_0172829
518 Ga0495593_0201669
519 Ga0495602_0454504
520 Ga0495602_0576148
521 Ga0496100_0463329
522 Ga0496101_0361195
523 Ga0496104_0138476
524 Ga0496105_0137150
525 Ga0496111_0798436
526 Ga0496112_0189341
527 Ga0496112_0340803
528 Ga0496115_0176653
529 Ga0496126_0036145
530 Ga0496126_0214619
531 Ga0496126_0366892
532 Ga0501046_0346130
533 Ga0501070_0147121
534 Ga0501080_0067076
535 Ga0501044_0037204
536 nmdc:mga04h51_71730_c1
537 nmdc:mga0n895_86240_c1
538 nmdc:mga0rr50_30545_c1
539 Ga0495601_0107633
540 Ga0495612_0263764
541 Ga0500635_0075716
542 Ga0495595_0383202
543 Ga0495619_0058770
544 Ga0495619_0075121
545 Ga0500647_0013581
546 Ga0500566_0000649
547 Ga0500640_082804
548 Ga0500641_0292629
549 Ga0500648_218414
550 Ga0500572_001552
551 Ga0500591_172810
552 Ga0500594_0020489
553 Ga0500595_001755
554 Ga0500608_053514
555 Ga0500614_025276
556 Ga0500642_0094694
557 Ga0500559_0240312
558 Ga0500590_049421
559 Ga0500603_026408
560 Ga0500622_0259150
561 Ga0500627_0243538
562 Ga0500630_073462
563 Ga0500638_039551
564 Ga0500638_345551
565 Ga0500639_017821
566 Ga0500636_0064631
567 Ga0500637_0134655
568 Ga0500596_000269
569 Ga0466962_0159615
570 2888379497
571 2889035399
572 2903749118
573 2904708532
574 2906613991
575 2908747544
576 2922363918
577 8006991008
578 8056676040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04134

DCC1-like

DCC1-like thiol-disulfide oxidoreductase

29

137

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3grx-assembly1.cif.gz_A nmr structure of escherichia coli glutaredoxin 3-glutathione mixed disulfide complex, 20 structures 0.6586 7 81
3grx-assembly1.cif.gz_A nmr structure of escherichia coli glutaredoxin 3-glutathione mixed disulfide complex, 20 structures 0.5857 7 81
7rka-assembly1.cif.gz_A crystal structure analysis of colorado potato beetle glutathione-s transferase ldgstu1 0.5753 10 88
7ebu-assembly3.cif.gz_C crystal structure of aedes aegypti noppera-bo, glutathione s-transferase epsilon 8, in daidzein- and glutathione-bound form 0.5564 7 82
4i2t-assembly1.cif.gz_A crystal structure of the oxidized glutaredoxin from chlorella sorokiniana t-89 0.5521 10 81
ID Description Score Start End Superfamily
af_Q9LR85_76_187_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9256 12 119 3.40.30.10
af_Q54M17_35_145_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8948 12 119 3.40.30.10
af_Q9LR85_76_187_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8864 12 119 3.40.30.10
af_A0A0R0FU59_17_124_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8673 15 118 3.40.30.10
af_Q54M17_35_145_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8649 12 119 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A023XUP7-F1-model_v4 deleted 0.9906 3 136
AF-A0A7T8A492-F1-model_v4 Thiol-disulfide oxidoreductase DCC family protein 0.9816 4 136 GO:0015035
AF-A0A4Q7G1J4-F1-model_v4 DUF393 domain-containing protein 0.9772 3 136 GO:0015035
AF-A0A023XUP7-F1-model_v4 deleted 0.969 3 136
AF-A0A1I6QCW7-F1-model_v4 Predicted thiol-disulfide oxidoreductase YuxK, DCC family 0.9646 4 136 GO:0015035
GO:0016020

Map