F389088

General Info

Members Datasets Scaffolds Average Seq Length
289 196 578 218

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10025075|Ga0081455_100250758
Length 230
Sequence VPGLPELNLILLGPPGSGKGTQGERLQEDFRLPYYATGDILRAAVKEGTEVGKQAKEFMDRGDLVPDEVIIGVIAERIQQAEAEDGFILDGFPRTVPQAEALDQKMKELRREITEAILIDVSEDEVVRRLGGRRTCEANPSHIYHVEFDPPKKEGVCDLDEGKLIVRDDDKPDVIKNRLATYREKTEPLVDYYDERGILNHVDGKQSPDEVEERIHGIIATLRREEEEGM

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
77 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
78 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
107 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
108 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
109 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
110 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
111 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
112 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
113 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
114 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
115 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
116 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
117 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
118 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
121 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
122 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
123 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 7.61
Rhizosphere 87.89
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10025075 3300005937 Bacteria 5511
2 JGI24034J26672_10000068 3300002239 Bacteria 28347
3 Ga0070683_100078393 3300005329 Bacteria 3091
4 Ga0070683_100497361 3300005329 Bacteria 1165
5 Ga0068869_100037655 3300005334 Bacteria 3440
6 Ga0070682_100189503 3300005337 Bacteria 1443
7 Ga0070691_10031811 3300005341 Bacteria 2476
8 Ga0070675_100248981 3300005354 Bacteria 1554
9 Ga0070674_100206310 3300005356 Bacteria 1520
10 Ga0070694_100103127 3300005444 Bacteria 2021
11 Ga0070708_100028598 3300005445 Bacteria 4798
12 Ga0070662_100422242 3300005457 Bacteria 1103
13 Ga0068867_100569562 3300005459 Bacteria 984
14 Ga0070685_10579014 3300005466 Bacteria 805
15 Ga0070706_100004376 3300005467 Bacteria 13643
16 Ga0070706_100005176 3300005467 Bacteria 12446
17 Ga0070706_100050867 3300005467 Bacteria 3823
18 Ga0070706_100545360 3300005467 Bacteria 1079
19 Ga0070707_100003278 3300005468 Bacteria 15318
20 Ga0070707_100302628 3300005468 Bacteria 1554
21 Ga0070707_100444009 3300005468 Unclassified 1258
22 Ga0070699_100409549 3300005518 Bacteria 1226
23 Ga0070697_100016911 3300005536 Bacteria 5734
24 Ga0070697_100071837 3300005536 Unclassified 2839
25 Ga0070697_100117075 3300005536 Bacteria 2226
26 Ga0070696_100066258 3300005546 Bacteria 2533
27 Ga0070704_100036146 3300005549 Bacteria 3364
28 Ga0070704_100183342 3300005549 Bacteria 1676
29 Ga0068857_100561608 3300005577 Bacteria 1076
30 Ga0068854_100518819 3300005578 Bacteria 1006
31 Ga0068856_100410433 3300005614 Bacteria 1374
32 Ga0068864_100000023 3300005618 Bacteria 257064
33 Ga0068858_100000287 3300005842 Bacteria 54456
34 Ga0068862_100397204 3300005844 Bacteria 1289
35 Ga0081455_10016984 3300005937 Bacteria 6996
36 Ga0081455_10115117 3300005937 Bacteria 2129
37 Ga0081455_10502660 3300005937 Bacteria 814
38 Ga0081538_10037727 3300005981 Bacteria 3128
39 Ga0081538_10123970 3300005981 Bacteria 1234
40 Ga0081540_1000553 3300005983 Bacteria 36267
41 Ga0075365_10007654 3300006038 Bacteria 6072
42 Ga0075363_100051070 3300006048 Bacteria 2204
43 Ga0075364_10020340 3300006051 Bacteria 4175
44 Ga0070716_100091540 3300006173 Bacteria 1842
45 Ga0070712_100015327 3300006175 Bacteria 4932
46 Ga0070712_100129766 3300006175 Bacteria 1909
47 Ga0075428_100001452 3300006844 Bacteria 25354
48 Ga0075428_100283985 3300006844 Bacteria 1781
49 Ga0075433_10019501 3300006852 Bacteria 5653
50 Ga0075433_10252712 3300006852 Bacteria 1564
51 Ga0075433_10277007 3300006852 Bacteria 1486
52 Ga0075434_100004854 3300006871 Bacteria 12183
53 Ga0075434_100024374 3300006871 Bacteria 5914
54 Ga0075429_100717535 3300006880 Bacteria 876
55 Ga0075435_100042654 3300007076 Bacteria 3630
56 Ga0075435_100163491 3300007076 Bacteria 1876
57 Ga0105240_10006736 3300009093 Bacteria 16822
58 Ga0111539_10003177 3300009094 Bacteria 21748
59 Ga0111539_10077543 3300009094 Bacteria 3911
60 Ga0105245_10241665 3300009098 Bacteria 1750
61 Ga0105245_10599341 3300009098 Bacteria 1128
62 Ga0114129_10095204 3300009147 Bacteria 4124
63 Ga0114129_10154738 3300009147 Bacteria 3136
64 Ga0105243_10076908 3300009148 Bacteria 2713
65 Ga0105243_10466052 3300009148 Bacteria 1189
66 Ga0105243_11357847 3300009148 Bacteria 730
67 Ga0105242_10244623 3300009176 Bacteria 1614
68 Ga0105242_10304596 3300009176 Bacteria 1456
69 Ga0105237_10000795 3300009545 Bacteria 43136
70 Ga0105249_10428485 3300009553 Bacteria 1358
71 Ga0157378_10140061 3300013297 Bacteria 2246
72 Ga0163162_10356283 3300013306 Bacteria 1596
73 Ga0157372_10206608 3300013307 Bacteria 2275
74 Ga0163163_10758062 3300014325 Bacteria 1034
75 Ga0157380_10034677 3300014326 Bacteria 3893
76 Ga0157380_10062972 3300014326 Bacteria 2973
77 Ga0157377_10208961 3300014745 Bacteria 1244
78 Ga0206354_11515112 3300020081 Bacteria 1091
79 Ga0207684_10000604 3300025910 Bacteria 42710
80 Ga0207684_10013283 3300025910 Bacteria 7124
81 Ga0207684_10055984 3300025910 Bacteria 3345
82 Ga0207684_10172726 3300025910 Bacteria 1863
83 Ga0207671_10007459 3300025914 Bacteria 9487
84 Ga0207671_10446721 3300025914 Bacteria 1030
85 Ga0207693_10009704 3300025915 Bacteria 7836
86 Ga0207663_10031921 3300025916 Bacteria 3122
87 Ga0207646_10014695 3300025922 Bacteria 7417
88 Ga0207646_10066311 3300025922 Bacteria 3223
89 Ga0207646_10454268 3300025922 Bacteria 1156
90 Ga0207646_10605990 3300025922 Bacteria 983
91 Ga0207681_10190548 3300025923 Bacteria 1569
92 Ga0207659_10203177 3300025926 Bacteria 1584
93 Ga0207659_10357643 3300025926 Bacteria 1213
94 Ga0207687_10225537 3300025927 Bacteria 1478
95 Ga0207664_10090847 3300025929 Bacteria 2503
96 Ga0207706_10485613 3300025933 Bacteria 1067
97 Ga0207686_10151774 3300025934 Bacteria 1614
98 Ga0207709_10549530 3300025935 Unclassified 908
99 Ga0207665_10170536 3300025939 Bacteria 1571
100 Ga0207665_10312868 3300025939 Bacteria 1177
101 Ga0207665_10356704 3300025939 Bacteria 1105
102 Ga0207689_10055755 3300025942 Bacteria 3252
103 Ga0207679_10043796 3300025945 Bacteria 3225
104 Ga0207651_10203653 3300025960 Bacteria 1588
105 Ga0207712_10513429 3300025961 Bacteria 1026
106 Ga0207703_10000122 3300026035 Bacteria 92656
107 Ga0207648_10371287 3300026089 Bacteria 1292
108 Ga0207676_10000025 3300026095 Bacteria 261714
109 Ga0209971_1010921 3300027682 Bacteria 2151
110 Ga0207428_10011229 3300027907 Bacteria 7941
111 Ga0207428_10151744 3300027907 Bacteria 1763
112 Ga0268265_10448868 3300028380 Bacteria 1204
113 Ga0265337_1000032 3300028556 Bacteria 61342
114 Ga0265326_10000040 3300028558 Bacteria 85624
115 Ga0265322_10000012 3300028654 Bacteria 152373
116 Ga0265338_10120739 3300028800 Bacteria 2089
117 Ga0265324_10000202 3300029957 Bacteria 45480
118 Ga0265330_10140216 3300031235 Bacteria 1028
119 Ga0265332_10089556 3300031238 Bacteria 1302
120 Ga0265328_10002899 3300031239 Bacteria 7647
121 Ga0265320_10000001 3300031240 Bacteria 847191
122 Ga0265331_10001467 3300031250 Bacteria 17360
123 Ga0265327_10000003 3300031251 Bacteria 852750
124 Ga0265316_10388421 3300031344 Bacteria 1006
125 Ga0307408_100005693 3300031548 Bacteria 8304
126 Ga0307408_100565518 3300031548 Bacteria 1005
127 Ga0265314_10000178 3300031711 Bacteria 94070
128 Ga0265342_10125489 3300031712 Bacteria 1442
129 Ga0307405_10002287 3300031731 Bacteria 8392
130 Ga0307410_10003574 3300031852 Bacteria 7832
131 Ga0307410_10099041 3300031852 Bacteria 2086
132 Ga0307406_10013544 3300031901 Bacteria 4674
133 Ga0307407_10024124 3300031903 Bacteria 3184
134 Ga0307412_10040592 3300031911 Bacteria 3011
135 Ga0307409_100124851 3300031995 Bacteria 2187
136 Ga0307416_100031790 3300032002 Bacteria 3978
137 Ga0307414_10881820 3300032004 Bacteria 819
138 Ga0307411_10013792 3300032005 Bacteria 4475
139 Ga0395900_0658717 3300037418 Bacteria 983
140 Ga0395898_0038575 3300037466 Bacteria 4734
141 Ga0395905_0454232 3300037471 Bacteria 1179
142 Ga0395905_0722621 3300037471 Bacteria 898
143 Ga0395901_0025795 3300038443 Bacteria 6034
144 Ga0395901_0058980 3300038443 Bacteria 3993
145 Ga0395901_0444393 3300038443 Bacteria 1327
146 Ga0439466_0089564 3300041411 Bacteria 965
147 Ga0451853_3641588 3300041512 Bacteria 3868
148 Ga0439431_0015805 3300041997 Bacteria 1760
149 Ga0439443_000170 3300042003 Bacteria 4719
150 Ga0450919_017476 3300042121 Bacteria 809
151 Ga0450920_002464 3300042122 Bacteria 3152
152 Ga0450923_003908 3300042125 Bacteria 2296
153 Ga0450897_004942 3300042128 Bacteria 1137
154 Ga0450894_002093 3300042131 Bacteria 2735
155 Ga0450896_000004 3300042133 Bacteria 16869
156 Ga0450896_004056 3300042133 Bacteria 1973
157 Ga0450898_026634 3300042134 Bacteria 1043
158 Ga0450906_010683 3300042145 Bacteria 1730
159 Ga0450910_001813 3300042147 Bacteria 2756
160 Ga0439446_0000186 3300042156 Bacteria 11024
161 Ga0439446_0005807 3300042156 Bacteria 3191
162 Ga0450908_000512 3300042184 Bacteria 7481
163 Ga0450908_015412 3300042184 Bacteria 1369
164 Ga0439434_0006811 3300042435 Bacteria 3339
165 Ga0439434_0010174 3300042435 Bacteria 2772
166 Ga0439434_0035521 3300042435 Bacteria 1523
167 Ga0439435_0037296 3300042436 Bacteria 1346
168 Ga0439444_0000388 3300042437 Bacteria 4800
169 Ga0439460_0002140 3300042461 Bacteria 4740
170 Ga0450918_003504 3300042531 Bacteria 2913
171 Ga0450918_005518 3300042531 Bacteria 2272
172 Ga0453684_1012294 3300044712 Bacteria 883
173 Ga0451576_0567079 3300045051 Bacteria 1193
174 Ga0495603_0403104 3300046455 Bacteria 784
175 Ga0495641_0187283 3300046461 Bacteria 927
176 Ga0495664_0000007 3300046477 Bacteria 386710
177 Ga0495585_0271648 3300046492 Bacteria 840
178 Ga0495618_0000035 3300046514 Bacteria 102739
179 Ga0495652_0023756 3300046529 Bacteria 5433
180 Ga0495667_0000067 3300046559 Bacteria 81751
181 Ga0495656_0002090 3300046615 Bacteria 6591
182 Ga0495634_0000993 3300046642 Bacteria 26739
183 Ga0495634_0030858 3300046642 Bacteria 3696
184 Ga0495600_0136165 3300046809 Bacteria 1595
185 Ga0495676_0439344 3300047321 Bacteria 862
186 Ga0495679_032699 3300047446 Bacteria 1666
187 Ga0495684_0211846 3300047471 Bacteria 1424
188 Ga0496100_0001215 3300048903 Bacteria 12520
189 Ga0496101_0748253 3300048904 Bacteria 771
190 Ga0496102_0010286 3300048905 Bacteria 8044
191 Ga0496102_0237252 3300048905 Bacteria 1720
192 Ga0496103_0008187 3300048906 Bacteria 6205
193 Ga0496103_0111862 3300048906 Bacteria 1735
194 Ga0496103_0181461 3300048906 Bacteria 1353
195 Ga0496103_0452251 3300048906 Bacteria 824
196 Ga0496104_0248728 3300048907 Bacteria 1691
197 Ga0496106_0548866 3300048909 Bacteria 927
198 Ga0496107_0235215 3300048910 Bacteria 1363
199 Ga0496107_0636363 3300048910 Bacteria 787
200 Ga0496109_0107375 3300048912 Bacteria 2593
201 Ga0496109_0200703 3300048912 Bacteria 1875
202 Ga0496111_0112816 3300048914 Bacteria 2003
203 Ga0496112_0047484 3300048915 Bacteria 4212
204 Ga0496112_0544355 3300048915 Bacteria 1095
205 Ga0496113_0127056 3300048916 Bacteria 1998
206 Ga0496114_0443348 3300048917 Bacteria 1150
207 Ga0496115_0000258 3300048918 Bacteria 47079
208 Ga0496115_0002589 3300048918 Bacteria 12979
209 Ga0496115_0013335 3300048918 Bacteria 6217
210 Ga0496117_0040141 3300048920 Bacteria 3447
211 Ga0496118_0006751 3300048921 Bacteria 12485
212 Ga0496119_0043379 3300048922 Bacteria 2842
213 Ga0496120_0003833 3300048923 Bacteria 13218
214 Ga0496126_0016119 3300048929 Bacteria 7488
215 Ga0496126_0136365 3300048929 Bacteria 2116
216 Ga0501031_0240695 3300049568 Bacteria 1176
217 Ga0501032_0051066 3300049569 Bacteria 2788
218 Ga0501033_0515643 3300049570 Bacteria 826
219 Ga0501036_0021783 3300049572 Bacteria 5387
220 Ga0501037_0213105 3300049573 Bacteria 1361
221 Ga0501038_0025989 3300049574 Bacteria 5215
222 Ga0501039_0015776 3300049575 Bacteria 5782
223 Ga0501039_0075906 3300049575 Bacteria 2613
224 Ga0501040_0229942 3300049576 Bacteria 1320
225 Ga0501041_0004231 3300049577 Bacteria 8310
226 Ga0501041_0068712 3300049577 Bacteria 2172
227 Ga0501041_0156403 3300049577 Bacteria 1424
228 Ga0501042_0605732 3300049578 Bacteria 796
229 Ga0501043_0233428 3300049579 Bacteria 1420
230 Ga0501043_0488421 3300049579 Bacteria 921
231 Ga0501043_0498374 3300049579 Bacteria 910
232 Ga0501043_0571379 3300049579 Bacteria 838
233 Ga0501046_0183755 3300049580 Bacteria 1562
234 Ga0501047_0123724 3300049581 Bacteria 2467
235 Ga0501047_0188097 3300049581 Bacteria 1929
236 Ga0501069_0143070 3300049585 Bacteria 1372
237 Ga0501071_0022909 3300049587 Bacteria 4357
238 Ga0501072_0016993 3300049588 Bacteria 5591
239 Ga0501074_0025643 3300049590 Bacteria 4278
240 Ga0501074_0063427 3300049590 Bacteria 2662
241 Ga0501074_0306368 3300049590 Bacteria 1128
242 Ga0501074_0753051 3300049590 Bacteria 687
243 Ga0501075_0222882 3300049591 Bacteria 1438
244 Ga0501075_0250310 3300049591 Bacteria 1350
245 Ga0501076_0005514 3300049592 Bacteria 9116
246 Ga0501076_0020922 3300049592 Bacteria 5011
247 Ga0501076_0137014 3300049592 Bacteria 1988
248 Ga0501076_0258345 3300049592 Bacteria 1426
249 Ga0501079_0027503 3300049741 Bacteria 4361
250 Ga0501079_0052208 3300049741 Bacteria 3156
251 Ga0501079_0087608 3300049741 Bacteria 2410
252 Ga0501080_0080753 3300049742 Bacteria 3022
253 Ga0501080_0327702 3300049742 Bacteria 1385
254 Ga0501080_0653397 3300049742 Bacteria 930
255 Ga0501081_0080044 3300049743 Bacteria 2286
256 Ga0501081_0178004 3300049743 Bacteria 1537
257 Ga0501081_0179717 3300049743 Bacteria 1530
258 Ga0501083_0043410 3300049744 Bacteria 3046
259 Ga0501083_0056914 3300049744 Bacteria 2619
260 Ga0501083_0145254 3300049744 Bacteria 1553
261 Ga0501035_0114349 3300049822 Bacteria 2363
262 Ga0501044_0045201 3300049823 Bacteria 4564
263 Ga0501045_0004522 3300049824 Bacteria 9612
264 Ga0501045_0043877 3300049824 Bacteria 3257
265 Ga0501045_0223307 3300049824 Bacteria 1402
266 Ga0501045_0441005 3300049824 Bacteria 968
267 nmdc:mga03n38_2180_c1 3300050490 Bacteria 5971
268 nmdc:mga00v17_52144_c1 3300050491 Bacteria 2488
269 nmdc:mga0yw44_53177_c1 3300050492 Bacteria 2458
270 nmdc:mga05p37_136134_c1 3300050507 Bacteria 3012
271 nmdc:mga05p37_49715_c1 3300050507 Bacteria 5158
272 nmdc:mga08y16_30812_c1 3300050511 Bacteria 5642
273 nmdc:mga08y16_56397_c1 3300050511 Bacteria 4106
274 nmdc:mga0n895_3786_c1 3300050512 Bacteria 12248
275 nmdc:mga0n895_8394_c1 3300050512 Bacteria 8944
276 nmdc:mga0rr50_102483_c1 3300050513 Bacteria 2251
277 nmdc:mga0rr50_116385_c1 3300050513 Bacteria 2122
278 nmdc:mga0rr50_9158_c1 3300050513 Bacteria 6205
279 nmdc:mga0a205_13358_c2 3300050515 Bacteria 5680
280 nmdc:mga0a205_300_c1 3300050515 Bacteria 32739
281 Ga0495601_0078430 3300053077 Bacteria 2116
282 Ga0495601_0097345 3300053077 Bacteria 1898
283 Ga0495612_0000233 3300053078 Bacteria 23563
284 Ga0495619_0005994 3300053085 Bacteria 7695
285 Ga0501084_0219726 3300054114 Bacteria 1603
286 Ga0501084_0751541 3300054114 Bacteria 822
287 Ga0501082_0038039 3300060353 Bacteria 4150
288 Ga0530510_0087408 3300061734 Bacteria 2271
289 Ga0530510_0159740 3300061734 Bacteria 1667
290 Ga0081455_10025075
291 JGI24034J26672_10000068
292 Ga0070683_100078393
293 Ga0070683_100497361
294 Ga0068869_100037655
295 Ga0070682_100189503
296 Ga0070691_10031811
297 Ga0070675_100248981
298 Ga0070674_100206310
299 Ga0070694_100103127
300 Ga0070708_100028598
301 Ga0070662_100422242
302 Ga0068867_100569562
303 Ga0070685_10579014
304 Ga0070706_100004376
305 Ga0070706_100005176
306 Ga0070706_100050867
307 Ga0070706_100545360
308 Ga0070707_100003278
309 Ga0070707_100302628
310 Ga0070707_100444009
311 Ga0070699_100409549
312 Ga0070697_100016911
313 Ga0070697_100071837
314 Ga0070697_100117075
315 Ga0070696_100066258
316 Ga0070704_100036146
317 Ga0070704_100183342
318 Ga0068857_100561608
319 Ga0068854_100518819
320 Ga0068856_100410433
321 Ga0068864_100000023
322 Ga0068858_100000287
323 Ga0068862_100397204
324 Ga0081455_10016984
325 Ga0081455_10115117
326 Ga0081455_10502660
327 Ga0081538_10037727
328 Ga0081538_10123970
329 Ga0081540_1000553
330 Ga0075365_10007654
331 Ga0075363_100051070
332 Ga0075364_10020340
333 Ga0070716_100091540
334 Ga0070712_100015327
335 Ga0070712_100129766
336 Ga0075428_100001452
337 Ga0075428_100283985
338 Ga0075433_10019501
339 Ga0075433_10252712
340 Ga0075433_10277007
341 Ga0075434_100004854
342 Ga0075434_100024374
343 Ga0075429_100717535
344 Ga0075435_100042654
345 Ga0075435_100163491
346 Ga0105240_10006736
347 Ga0111539_10003177
348 Ga0111539_10077543
349 Ga0105245_10241665
350 Ga0105245_10599341
351 Ga0114129_10095204
352 Ga0114129_10154738
353 Ga0105243_10076908
354 Ga0105243_10466052
355 Ga0105243_11357847
356 Ga0105242_10244623
357 Ga0105242_10304596
358 Ga0105237_10000795
359 Ga0105249_10428485
360 Ga0157378_10140061
361 Ga0163162_10356283
362 Ga0157372_10206608
363 Ga0163163_10758062
364 Ga0157380_10034677
365 Ga0157380_10062972
366 Ga0157377_10208961
367 Ga0206354_11515112
368 Ga0207684_10000604
369 Ga0207684_10013283
370 Ga0207684_10055984
371 Ga0207684_10172726
372 Ga0207671_10007459
373 Ga0207671_10446721
374 Ga0207693_10009704
375 Ga0207663_10031921
376 Ga0207646_10014695
377 Ga0207646_10066311
378 Ga0207646_10454268
379 Ga0207646_10605990
380 Ga0207681_10190548
381 Ga0207659_10203177
382 Ga0207659_10357643
383 Ga0207687_10225537
384 Ga0207664_10090847
385 Ga0207706_10485613
386 Ga0207686_10151774
387 Ga0207709_10549530
388 Ga0207665_10170536
389 Ga0207665_10312868
390 Ga0207665_10356704
391 Ga0207689_10055755
392 Ga0207679_10043796
393 Ga0207651_10203653
394 Ga0207712_10513429
395 Ga0207703_10000122
396 Ga0207648_10371287
397 Ga0207676_10000025
398 Ga0209971_1010921
399 Ga0207428_10011229
400 Ga0207428_10151744
401 Ga0268265_10448868
402 Ga0265337_1000032
403 Ga0265326_10000040
404 Ga0265322_10000012
405 Ga0265338_10120739
406 Ga0265324_10000202
407 Ga0265330_10140216
408 Ga0265332_10089556
409 Ga0265328_10002899
410 Ga0265320_10000001
411 Ga0265331_10001467
412 Ga0265327_10000003
413 Ga0265316_10388421
414 Ga0307408_100005693
415 Ga0307408_100565518
416 Ga0265314_10000178
417 Ga0265342_10125489
418 Ga0307405_10002287
419 Ga0307410_10003574
420 Ga0307410_10099041
421 Ga0307406_10013544
422 Ga0307407_10024124
423 Ga0307412_10040592
424 Ga0307409_100124851
425 Ga0307416_100031790
426 Ga0307414_10881820
427 Ga0307411_10013792
428 Ga0395900_0658717
429 Ga0395898_0038575
430 Ga0395905_0454232
431 Ga0395905_0722621
432 Ga0395901_0025795
433 Ga0395901_0058980
434 Ga0395901_0444393
435 Ga0439466_0089564
436 Ga0451853_3641588
437 Ga0439431_0015805
438 Ga0439443_000170
439 Ga0450919_017476
440 Ga0450920_002464
441 Ga0450923_003908
442 Ga0450897_004942
443 Ga0450894_002093
444 Ga0450896_000004
445 Ga0450896_004056
446 Ga0450898_026634
447 Ga0450906_010683
448 Ga0450910_001813
449 Ga0439446_0000186
450 Ga0439446_0005807
451 Ga0450908_000512
452 Ga0450908_015412
453 Ga0439434_0006811
454 Ga0439434_0010174
455 Ga0439434_0035521
456 Ga0439435_0037296
457 Ga0439444_0000388
458 Ga0439460_0002140
459 Ga0450918_003504
460 Ga0450918_005518
461 Ga0453684_1012294
462 Ga0451576_0567079
463 Ga0495603_0403104
464 Ga0495641_0187283
465 Ga0495664_0000007
466 Ga0495585_0271648
467 Ga0495618_0000035
468 Ga0495652_0023756
469 Ga0495667_0000067
470 Ga0495656_0002090
471 Ga0495634_0000993
472 Ga0495634_0030858
473 Ga0495600_0136165
474 Ga0495676_0439344
475 Ga0495679_032699
476 Ga0495684_0211846
477 Ga0496100_0001215
478 Ga0496101_0748253
479 Ga0496102_0010286
480 Ga0496102_0237252
481 Ga0496103_0008187
482 Ga0496103_0111862
483 Ga0496103_0181461
484 Ga0496103_0452251
485 Ga0496104_0248728
486 Ga0496106_0548866
487 Ga0496107_0235215
488 Ga0496107_0636363
489 Ga0496109_0107375
490 Ga0496109_0200703
491 Ga0496111_0112816
492 Ga0496112_0047484
493 Ga0496112_0544355
494 Ga0496113_0127056
495 Ga0496114_0443348
496 Ga0496115_0000258
497 Ga0496115_0002589
498 Ga0496115_0013335
499 Ga0496117_0040141
500 Ga0496118_0006751
501 Ga0496119_0043379
502 Ga0496120_0003833
503 Ga0496126_0016119
504 Ga0496126_0136365
505 Ga0501031_0240695
506 Ga0501032_0051066
507 Ga0501033_0515643
508 Ga0501036_0021783
509 Ga0501037_0213105
510 Ga0501038_0025989
511 Ga0501039_0015776
512 Ga0501039_0075906
513 Ga0501040_0229942
514 Ga0501041_0004231
515 Ga0501041_0068712
516 Ga0501041_0156403
517 Ga0501042_0605732
518 Ga0501043_0233428
519 Ga0501043_0488421
520 Ga0501043_0498374
521 Ga0501043_0571379
522 Ga0501046_0183755
523 Ga0501047_0123724
524 Ga0501047_0188097
525 Ga0501069_0143070
526 Ga0501071_0022909
527 Ga0501072_0016993
528 Ga0501074_0025643
529 Ga0501074_0063427
530 Ga0501074_0306368
531 Ga0501074_0753051
532 Ga0501075_0222882
533 Ga0501075_0250310
534 Ga0501076_0005514
535 Ga0501076_0020922
536 Ga0501076_0137014
537 Ga0501076_0258345
538 Ga0501079_0027503
539 Ga0501079_0052208
540 Ga0501079_0087608
541 Ga0501080_0080753
542 Ga0501080_0327702
543 Ga0501080_0653397
544 Ga0501081_0080044
545 Ga0501081_0178004
546 Ga0501081_0179717
547 Ga0501083_0043410
548 Ga0501083_0056914
549 Ga0501083_0145254
550 Ga0501035_0114349
551 Ga0501044_0045201
552 Ga0501045_0004522
553 Ga0501045_0043877
554 Ga0501045_0223307
555 Ga0501045_0441005
556 nmdc:mga03n38_2180_c1
557 nmdc:mga00v17_52144_c1
558 nmdc:mga0yw44_53177_c1
559 nmdc:mga05p37_136134_c1
560 nmdc:mga05p37_49715_c1
561 nmdc:mga08y16_30812_c1
562 nmdc:mga08y16_56397_c1
563 nmdc:mga0n895_3786_c1
564 nmdc:mga0n895_8394_c1
565 nmdc:mga0rr50_102483_c1
566 nmdc:mga0rr50_116385_c1
567 nmdc:mga0rr50_9158_c1
568 nmdc:mga0a205_13358_c2
569 nmdc:mga0a205_300_c1
570 Ga0495601_0078430
571 Ga0495601_0097345
572 Ga0495612_0000233
573 Ga0495619_0005994
574 Ga0501084_0219726
575 Ga0501084_0751541
576 Ga0501082_0038039
577 Ga0530510_0087408
578 Ga0530510_0159740

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00406

ADK

Adenylate kinase

11

198

0.99

PF13207

AAA_17

AAA domain

12

147

0.91

PF05191

ADK_lid

Adenylate kinase, active site lid

133

169

0.9

PF13238

AAA_18

AAA domain

9

147

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s36-assembly1.cif.gz_A crystal structure of e. coli adenylate kinase r119k mutant 0.8584 1 174
6rze-assembly1.cif.gz_A crystal structure of e. coli adenylate kinase r119a mutant 0.8508 4 174
4np6-assembly1.cif.gz_B crystal structure of adenylate kinase from vibrio cholerae o1 biovar eltor 0.8388 2 174
3tlx-assembly3.cif.gz_C crystal structure of pf10_0086, adenylate kinase from plasmodium falciparum 0.8264 42 172
4pzl-assembly2.cif.gz_D the crystal structure of adenylate kinase from francisella tularensis subsp. tularensis schu s4 0.8197 2 175
ID Description Score Start End Superfamily
af_Q4D4A2_1_210_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8749 18 175 3.40.50.300
af_B3H4S0_1_132_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8525 18 173 3.40.50.300
3tlxC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8264 42 172 3.40.50.300
af_B3H4S0_1_132_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8162 18 173 3.40.50.300
af_A4I9I1_1_215_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8122 3 179 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A538A949-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9673 66 182 GO:0004017
GO:0005524
GO:0005737
AF-A0A3D5WVM6-F1-model_v4 deleted 0.9561 46 178
AF-A0A256LP02-F1-model_v4 deleted 0.9492 45 175
AF-A0A538A949-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9437 66 182 GO:0004017
GO:0005524
GO:0005737
AF-A0A202DNJ0-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9387 54 178 GO:0004017
GO:0005524
GO:0005737

Map