F389014

General Info

Members Datasets Scaffolds Average Seq Length
289 165 558 177

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100001564|Ga0070689_1000015643
Length 209
Sequence LVFGSEFNSRRLHHNKNAGALTPGKTQRHVMSTTTHVMTAEELMNIDDEPNRHELIKGELLTMSPPGLTHGIVTVNLSTLLHNHVKANNLGLLIGEAGFKLEINPDTVLAPDIAFIARDRVGIITPGFRSGPPDLAVEVMSQWDTKPEVDRKAALWLELGAQSVWNVNPKKRTVEVNLANGEKRLFHETDELVDDTVPGFRVRVSEIFA

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
120 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
121 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
122 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
123 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
124 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
125 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
126 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
127 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
128 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
129 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
130 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
131 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
132 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
133 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
134 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
135 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
136 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
137 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
138 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
139 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
140 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
141 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
142 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
143 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
144 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
145 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
146 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
149 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
150 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
151 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
152 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
153 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.42
Rhizosphere 97.58
Stem 0
Stem Tuber 0
Unclassified 29.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100001564 3300005340 Bacteria 14589
2 CNAas_1000491 3300000532 Bacteria 3856
3 Ga0065704_10404048 3300005289 Bacteria 749
4 Ga0065712_10008450 3300005290 Bacteria 2339
5 Ga0065715_10171069 3300005293 Bacteria 1546
6 Ga0065715_10217855 3300005293 Bacteria 1285
7 Ga0065707_10349517 3300005295 Bacteria 877
8 Ga0070676_10761201 3300005328 Unclassified 712
9 Ga0070690_100825058 3300005330 Unclassified 721
10 Ga0070670_100112878 3300005331 Bacteria 2342
11 Ga0070670_100308225 3300005331 Bacteria 1385
12 Ga0070670_101013114 3300005331 Bacteria 755
13 Ga0068869_100007411 3300005334 Bacteria 7009
14 Ga0068869_101051335 3300005334 Unclassified 711
15 Ga0070687_100426035 3300005343 Bacteria 876
16 Ga0070692_10173154 3300005345 Bacteria 1245
17 Ga0070692_10243674 3300005345 Bacteria 1073
18 Ga0070673_100283883 3300005364 Bacteria 1453
19 Ga0070701_10020558 3300005438 Bacteria 3136
20 Ga0070700_100543070 3300005441 Bacteria 902
21 Ga0070694_100016462 3300005444 Bacteria 4653
22 Ga0070694_100261654 3300005444 Bacteria 1312
23 Ga0070681_10067745 3300005458 Bacteria 3537
24 Ga0070681_10146460 3300005458 Bacteria 2290
25 Ga0068867_100649190 3300005459 Unclassified 926
26 Ga0070706_100000001 3300005467 Bacteria 342302
27 Ga0070699_100010622 3300005518 Bacteria 7972
28 Ga0070699_100019594 3300005518 Bacteria 5829
29 Ga0070672_100224133 3300005543 Bacteria 1578
30 Ga0070672_100567356 3300005543 Unclassified 986
31 Ga0070695_100108163 3300005545 Bacteria 1882
32 Ga0070695_100365746 3300005545 Bacteria 1084
33 Ga0070696_100043716 3300005546 Bacteria 3100
34 Ga0070696_100078485 3300005546 Bacteria 2335
35 Ga0070693_100143949 3300005547 Bacteria 1503
36 Ga0070693_100219239 3300005547 Viruses 1245
37 Ga0070693_100345556 3300005547 Bacteria 1017
38 Ga0070693_100671516 3300005547 Unclassified 756
39 Ga0070704_100067913 3300005549 Unclassified 2576
40 Ga0070704_100306707 3300005549 Unclassified 1325
41 Ga0068857_100239834 3300005577 Bacteria 1659
42 Ga0068857_100778778 3300005577 Unclassified 912
43 Ga0068856_101042700 3300005614 Unclassified 836
44 Ga0070702_100124029 3300005615 Bacteria 1621
45 Ga0068859_100027026 3300005617 Bacteria 5756
46 Ga0068859_100034249 3300005617 Bacteria 5098
47 Ga0068859_100152003 3300005617 Bacteria 2390
48 Ga0068859_100310505 3300005617 Bacteria 1670
49 Ga0068864_100026484 3300005618 Bacteria 4890
50 Ga0068864_100349104 3300005618 Bacteria 1395
51 Ga0068861_100731180 3300005719 Unclassified 923
52 Ga0068870_10024653 3300005840 Bacteria 2978
53 Ga0068863_100029114 3300005841 Bacteria 5273
54 Ga0068863_100144660 3300005841 Bacteria 2273
55 Ga0068863_100256598 3300005841 Bacteria 1689
56 Ga0068863_100637166 3300005841 Bacteria 1056
57 Ga0068863_101234473 3300005841 Bacteria 754
58 Ga0068858_100022986 3300005842 Bacteria 5814
59 Ga0068858_100213440 3300005842 Bacteria 1826
60 Ga0068860_100099339 3300005843 Bacteria 2776
61 Ga0068860_100280760 3300005843 Bacteria 1627
62 Ga0068860_101134180 3300005843 Bacteria 802
63 Ga0068862_100512131 3300005844 Bacteria 1141
64 Ga0068862_100807231 3300005844 Bacteria 917
65 Ga0068862_100959367 3300005844 Unclassified 844
66 Ga0081538_10002018 3300005981 Bacteria 20306
67 Ga0081539_10073593 3300005985 Bacteria 1822
68 Ga0075428_101099770 3300006844 Unclassified 839
69 Ga0075428_101524110 3300006844 Unclassified 700
70 Ga0075430_100042823 3300006846 Bacteria 3828
71 Ga0075431_100145719 3300006847 Bacteria 2440
72 Ga0075431_100358366 3300006847 Bacteria 1465
73 Ga0075433_10078638 3300006852 Bacteria 2906
74 Ga0075433_10134296 3300006852 Bacteria 2199
75 Ga0075433_10317481 3300006852 Unclassified 1378
76 Ga0075433_10838146 3300006852 Bacteria 803
77 Ga0075434_100197872 3300006871 Unclassified 2029
78 Ga0075434_101068818 3300006871 Unclassified 821
79 Ga0075429_100039265 3300006880 Bacteria 4120
80 Ga0075429_100092461 3300006880 Bacteria 2638
81 Ga0075429_100164991 3300006880 Unclassified 1940
82 Ga0075429_100271468 3300006880 Bacteria 1485
83 Ga0068865_100919546 3300006881 Bacteria 762
84 Ga0097620_100027026 3300006931 Bacteria 5756
85 Ga0097620_100034248 3300006931 Bacteria 5098
86 Ga0097620_100151995 3300006931 Bacteria 2390
87 Ga0097620_100310507 3300006931 Bacteria 1670
88 Ga0075435_100085513 3300007076 Bacteria 2596
89 Ga0105240_10591789 3300009093 Viruses 1222
90 Ga0105240_10804232 3300009093 Unclassified 1018
91 Ga0111539_10043274 3300009094 Bacteria 5399
92 Ga0111539_11424779 3300009094 Unclassified 804
93 Ga0105247_10005718 3300009101 Bacteria 7781
94 Ga0105247_10371036 3300009101 Bacteria 1012
95 Ga0105247_10589400 3300009101 Unclassified 823
96 Ga0114129_10098385 3300009147 Unclassified 4049
97 Ga0114129_10134717 3300009147 Bacteria 3390
98 Ga0114129_10148933 3300009147 Bacteria 3204
99 Ga0105243_10241574 3300009148 Bacteria 1607
100 Ga0105241_10146919 3300009174 Bacteria 1925
101 Ga0105241_10327625 3300009174 Unclassified 1323
102 Ga0105241_10515860 3300009174 Bacteria 1068
103 Ga0105241_10884140 3300009174 Bacteria 829
104 Ga0105248_10108884 3300009177 Bacteria 3124
105 Ga0105248_10529765 3300009177 Bacteria 1329
106 Ga0105248_10671853 3300009177 Bacteria 1169
107 Ga0105248_11150493 3300009177 Bacteria 877
108 Ga0105238_10308574 3300009551 Bacteria 1567
109 Ga0105239_10523771 3300010375 Bacteria 1349
110 Ga0105239_10685652 3300010375 Bacteria 1171
111 Ga0105239_10817091 3300010375 Unclassified 1068
112 Ga0105246_10660555 3300011119 Bacteria 911
113 Ga0157373_10336806 3300013100 Unclassified 1075
114 Ga0157373_10402091 3300013100 Bacteria 982
115 Ga0157373_10425997 3300013100 Bacteria 953
116 Ga0157371_10278327 3300013102 Bacteria 1208
117 Ga0157378_11908985 3300013297 Unclassified 643
118 Ga0163162_10455409 3300013306 Bacteria 1411
119 Ga0157372_10005595 3300013307 Bacteria 13360
120 Ga0157372_10659453 3300013307 Unclassified 1218
121 Ga0157372_11385859 3300013307 Unclassified 811
122 Ga0157372_11893955 3300013307 Unclassified 685
123 Ga0157375_11155698 3300013308 Bacteria 907
124 Ga0163163_10003627 3300014325 Bacteria 13129
125 Ga0163163_10510872 3300014325 Bacteria 1264
126 Ga0157380_10079543 3300014326 Unclassified 2677
127 Ga0157377_10353656 3300014745 Unclassified 986
128 Ga0157379_10104236 3300014968 Bacteria 2545
129 Ga0157379_10575166 3300014968 Bacteria 1050
130 Ga0207710_10002170 3300025900 Bacteria 9221
131 Ga0207710_10037256 3300025900 Bacteria 2147
132 Ga0207710_10134078 3300025900 Bacteria 1191
133 Ga0207647_10214054 3300025904 Bacteria 1112
134 Ga0207643_10004492 3300025908 Bacteria 7498
135 Ga0207684_10000286 3300025910 Bacteria 72634
136 Ga0207654_10035970 3300025911 Bacteria 2763
137 Ga0207707_10313534 3300025912 Bacteria 1355
138 Ga0207707_10654695 3300025912 Bacteria 885
139 Ga0207695_10425698 3300025913 Viruses 1211
140 Ga0207695_10565751 3300025913 Bacteria 1018
141 Ga0207671_10252036 3300025914 Bacteria 1388
142 Ga0207660_10103536 3300025917 Bacteria 2130
143 Ga0207662_10090266 3300025918 Bacteria 1883
144 Ga0207646_10060748 3300025922 Bacteria 3375
145 Ga0207694_10008101 3300025924 Bacteria 7942
146 Ga0207650_10357481 3300025925 Unclassified 1203
147 Ga0207650_10662748 3300025925 Bacteria 880
148 Ga0207706_10248681 3300025933 Unclassified 1554
149 Ga0207709_10869236 3300025935 Unclassified 731
150 Ga0207670_10001930 3300025936 Bacteria 10857
151 Ga0207691_10341115 3300025940 Unclassified 1282
152 Ga0207691_10502275 3300025940 Bacteria 1030
153 Ga0207711_10060081 3300025941 Bacteria 3275
154 Ga0207711_10186466 3300025941 Bacteria 1889
155 Ga0207651_10602111 3300025960 Unclassified 961
156 Ga0207703_10102726 3300026035 Bacteria 2426
157 Ga0207703_10105420 3300026035 Bacteria 2396
158 Ga0207639_10933902 3300026041 Unclassified 811
159 Ga0207708_10020719 3300026075 Bacteria 4958
160 Ga0207708_10199071 3300026075 Bacteria 1597
161 Ga0207702_10945047 3300026078 Unclassified 855
162 Ga0207641_10010828 3300026088 Bacteria 7473
163 Ga0207641_10494104 3300026088 Bacteria 1187
164 Ga0207641_10698902 3300026088 Bacteria 998
165 Ga0207648_10085803 3300026089 Bacteria 2746
166 Ga0207676_10001208 3300026095 Bacteria 19341
167 Ga0207676_10016675 3300026095 Bacteria 5320
168 Ga0207676_10738198 3300026095 Unclassified 957
169 Ga0207674_10558434 3300026116 Unclassified 1106
170 Ga0207674_10731846 3300026116 Unclassified 955
171 Ga0207675_100754818 3300026118 Unclassified 984
172 Ga0207698_10484137 3300026142 Bacteria 1201
173 Ga0207428_10255723 3300027907 Bacteria 1305
174 Ga0268265_10599349 3300028380 Unclassified 1053
175 Ga0268265_10886323 3300028380 Unclassified 875
176 Ga0268265_10986810 3300028380 Unclassified 831
177 Ga0268264_10054185 3300028381 Bacteria 3348
178 Ga0268264_10397598 3300028381 Unclassified 1323
179 Ga0268264_10553673 3300028381 Bacteria 1128
180 Ga0307408_100086351 3300031548 Unclassified 2358
181 Ga0307408_100274306 3300031548 Bacteria 1402
182 Ga0307408_101039999 3300031548 Unclassified 757
183 Ga0307405_10356741 3300031731 Unclassified 1130
184 Ga0307405_10582347 3300031731 Unclassified 910
185 Ga0307413_10189723 3300031824 Unclassified 1474
186 Ga0307410_10826712 3300031852 Bacteria 789
187 Ga0307406_10028345 3300031901 Unclassified 3383
188 Ga0307406_10137231 3300031901 Bacteria 1726
189 Ga0307406_10184017 3300031901 Bacteria 1524
190 Ga0307406_10520669 3300031901 Bacteria 968
191 Ga0307407_10393764 3300031903 Bacteria 992
192 Ga0307407_10506166 3300031903 Unclassified 886
193 Ga0307412_10013120 3300031911 Bacteria 4848
194 Ga0307412_10059071 3300031911 Unclassified 2568
195 Ga0307409_100113709 3300031995 Bacteria 2276
196 Ga0307409_100125534 3300031995 Bacteria 2182
197 Ga0307409_101166232 3300031995 Unclassified 793
198 Ga0307416_100228071 3300032002 Unclassified 1793
199 Ga0307416_100766909 3300032002 Bacteria 1058
200 Ga0307416_101170460 3300032002 Unclassified 874
201 Ga0307414_10064166 3300032004 Unclassified 2613
202 Ga0307414_10185749 3300032004 Bacteria 1677
203 Ga0307414_10271851 3300032004 Bacteria 1420
204 Ga0307414_10942223 3300032004 Unclassified 793
205 Ga0307411_10037937 3300032005 Bacteria 3035
206 Ga0307411_10363829 3300032005 Bacteria 1184
207 Ga0307411_10404168 3300032005 Bacteria 1130
208 Ga0307415_100025364 3300032126 Unclassified 3718
209 Ga0307415_100079369 3300032126 Bacteria 2338
210 Ga0307415_101142356 3300032126 Unclassified 731
211 Ga0395901_0184859 3300038443 Bacteria 2186
212 Ga0496103_0375374 3300048906 Bacteria 914
213 Ga0496103_0460090 3300048906 Unclassified 816
214 Ga0496106_0037154 3300048909 Bacteria 3643
215 Ga0496107_0024898 3300048910 Bacteria 4236
216 Ga0496108_0272682 3300048911 Bacteria 1473
217 Ga0496109_0911141 3300048912 Unclassified 817
218 Ga0496112_0164419 3300048915 Bacteria 2185
219 Ga0501292_002575 3300049515 Unclassified 2352
220 Ga0501294_004039 3300049517 Unclassified 1382
221 Ga0501295_083909 3300049518 Bacteria 728
222 Ga0501298_010930 3300049521 Bacteria 1568
223 Ga0501298_050731 3300049521 Unclassified 860
224 Ga0501299_003550 3300049522 Bacteria 2268
225 Ga0501199_014267 3300049650 Bacteria 881
226 Ga0501202_077281 3300049652 Bacteria 776
227 Ga0501209_071585 3300049656 Unclassified 987
228 Ga0501214_007176 3300049659 Bacteria 1133
229 Ga0501216_050999 3300049660 Bacteria 813
230 Ga0501216_061843 3300049660 Unclassified 757
231 Ga0501217_001919 3300049661 Unclassified 3990
232 Ga0501217_170908 3300049661 Unclassified 661
233 Ga0501223_007642 3300049663 Bacteria 2211
234 Ga0501223_012151 3300049663 Bacteria 1725
235 Ga0501224_013813 3300049664 Bacteria 1193
236 Ga0501227_101340 3300049665 Bacteria 766
237 Ga0501233_025209 3300049668 Bacteria 1306
238 Ga0501235_098239 3300049669 Unclassified 713
239 Ga0501235_104259 3300049669 Bacteria 695
240 Ga0501236_027035 3300049670 Unclassified 886
241 Ga0501242_005392 3300049674 Bacteria 1439
242 Ga0501243_002911 3300049675 Bacteria 2520
243 Ga0501246_012413 3300049676 Bacteria 799
244 Ga0501249_041938 3300049679 Bacteria 1039
245 Ga0501251_010298 3300049681 Unclassified 1094
246 Ga0501255_004851 3300049684 Bacteria 1320
247 Ga0501261_018745 3300049690 Bacteria 978
248 Ga0501221_091256 3300049704 Bacteria 745
249 Ga0501225_0018087 3300049705 Unclassified 1955
250 Ga0501225_0115382 3300049705 Bacteria 794
251 Ga0501234_006425 3300049707 Bacteria 1839
252 Ga0501245_006824 3300049708 Bacteria 1604
253 Ga0501079_0242996 3300049741 Unclassified 1407
254 Ga0501268_012858 3300049765 Bacteria 1344
255 Ga0501268_123128 3300049765 Unclassified 577
256 Ga0501270_078398 3300049767 Unclassified 652
257 Ga0501273_032240 3300049770 Bacteria 750
258 Ga0501281_05559 3300049777 Unclassified 883
259 Ga0501282_007085 3300049778 Bacteria 1199
260 Ga0501212_031538 3300049851 Bacteria 856
261 nmdc:mga05p37_548431_c1 3300050507 Unclassified 1317
262 nmdc:mga05p37_985034_c1 3300050507 Bacteria 898
263 nmdc:mga09592_175810_c1 3300050508 Bacteria 1852
264 nmdc:mga09592_260448_c1 3300050508 Bacteria 1504
265 nmdc:mga09592_57605_c1 3300050508 Bacteria 1321
266 nmdc:mga0qj67_27710_c1 3300050509 Bacteria 4393
267 nmdc:mga06r32_205846_c1 3300050510 Bacteria 1956
268 nmdc:mga06r32_232125_c1 3300050510 Bacteria 1833
269 nmdc:mga06r32_312354_c1 3300050510 Unclassified 1557
270 nmdc:mga08y16_232044_c1 3300050511 Bacteria 1909
271 nmdc:mga0n895_170138_c1 3300050512 Unclassified 2211
272 nmdc:mga0rr50_224682_c1 3300050513 Bacteria 1552
273 nmdc:mga0a205_214169_c1 3300050515 Bacteria 1814
274 nmdc:mga0a205_88334_c1 3300050515 Bacteria 2996
275 nmdc:mga0a205_90582_c1 3300050515 Unclassified 2956
276 Ga0501084_0087348 3300054114 Bacteria 2618
277 Ga0590075_004866 3300059424 Bacteria 3177
278 Ga0590077_001660 3300059426 Bacteria 5091
279 Ga0530510_0539393 3300061734 Bacteria 885
280 Ga0070689_100001564
281 CNAas_1000491
282 Ga0065704_10404048
283 Ga0065712_10008450
284 Ga0065715_10171069
285 Ga0065715_10217855
286 Ga0065707_10349517
287 Ga0070676_10761201
288 Ga0070690_100825058
289 Ga0070670_100112878
290 Ga0070670_100308225
291 Ga0070670_101013114
292 Ga0068869_100007411
293 Ga0068869_101051335
294 Ga0070687_100426035
295 Ga0070692_10173154
296 Ga0070692_10243674
297 Ga0070673_100283883
298 Ga0070701_10020558
299 Ga0070700_100543070
300 Ga0070694_100016462
301 Ga0070694_100261654
302 Ga0070681_10067745
303 Ga0070681_10146460
304 Ga0068867_100649190
305 Ga0070706_100000001
306 Ga0070699_100010622
307 Ga0070699_100019594
308 Ga0070672_100224133
309 Ga0070672_100567356
310 Ga0070695_100108163
311 Ga0070695_100365746
312 Ga0070696_100043716
313 Ga0070696_100078485
314 Ga0070693_100143949
315 Ga0070693_100219239
316 Ga0070693_100345556
317 Ga0070693_100671516
318 Ga0070704_100067913
319 Ga0070704_100306707
320 Ga0068857_100239834
321 Ga0068857_100778778
322 Ga0068856_101042700
323 Ga0070702_100124029
324 Ga0068859_100027026
325 Ga0068859_100034249
326 Ga0068859_100152003
327 Ga0068859_100310505
328 Ga0068864_100026484
329 Ga0068864_100349104
330 Ga0068861_100731180
331 Ga0068870_10024653
332 Ga0068863_100029114
333 Ga0068863_100144660
334 Ga0068863_100256598
335 Ga0068863_100637166
336 Ga0068863_101234473
337 Ga0068858_100022986
338 Ga0068858_100213440
339 Ga0068860_100099339
340 Ga0068860_100280760
341 Ga0068860_101134180
342 Ga0068862_100512131
343 Ga0068862_100807231
344 Ga0068862_100959367
345 Ga0081538_10002018
346 Ga0081539_10073593
347 Ga0075428_101099770
348 Ga0075428_101524110
349 Ga0075430_100042823
350 Ga0075431_100145719
351 Ga0075431_100358366
352 Ga0075433_10078638
353 Ga0075433_10134296
354 Ga0075433_10317481
355 Ga0075433_10838146
356 Ga0075434_100197872
357 Ga0075434_101068818
358 Ga0075429_100039265
359 Ga0075429_100092461
360 Ga0075429_100164991
361 Ga0075429_100271468
362 Ga0068865_100919546
363 Ga0097620_100027026
364 Ga0097620_100034248
365 Ga0097620_100151995
366 Ga0097620_100310507
367 Ga0075435_100085513
368 Ga0105240_10591789
369 Ga0105240_10804232
370 Ga0111539_10043274
371 Ga0111539_11424779
372 Ga0105247_10005718
373 Ga0105247_10371036
374 Ga0105247_10589400
375 Ga0114129_10098385
376 Ga0114129_10134717
377 Ga0114129_10148933
378 Ga0105243_10241574
379 Ga0105241_10146919
380 Ga0105241_10327625
381 Ga0105241_10515860
382 Ga0105241_10884140
383 Ga0105248_10108884
384 Ga0105248_10529765
385 Ga0105248_10671853
386 Ga0105248_11150493
387 Ga0105238_10308574
388 Ga0105239_10523771
389 Ga0105239_10685652
390 Ga0105239_10817091
391 Ga0105246_10660555
392 Ga0157373_10336806
393 Ga0157373_10402091
394 Ga0157373_10425997
395 Ga0157371_10278327
396 Ga0157378_11908985
397 Ga0163162_10455409
398 Ga0157372_10005595
399 Ga0157372_10659453
400 Ga0157372_11385859
401 Ga0157372_11893955
402 Ga0157375_11155698
403 Ga0163163_10003627
404 Ga0163163_10510872
405 Ga0157380_10079543
406 Ga0157377_10353656
407 Ga0157379_10104236
408 Ga0157379_10575166
409 Ga0207710_10002170
410 Ga0207710_10037256
411 Ga0207710_10134078
412 Ga0207647_10214054
413 Ga0207643_10004492
414 Ga0207684_10000286
415 Ga0207654_10035970
416 Ga0207707_10313534
417 Ga0207707_10654695
418 Ga0207695_10425698
419 Ga0207695_10565751
420 Ga0207671_10252036
421 Ga0207660_10103536
422 Ga0207662_10090266
423 Ga0207646_10060748
424 Ga0207694_10008101
425 Ga0207650_10357481
426 Ga0207650_10662748
427 Ga0207706_10248681
428 Ga0207709_10869236
429 Ga0207670_10001930
430 Ga0207691_10341115
431 Ga0207691_10502275
432 Ga0207711_10060081
433 Ga0207711_10186466
434 Ga0207651_10602111
435 Ga0207703_10102726
436 Ga0207703_10105420
437 Ga0207639_10933902
438 Ga0207708_10020719
439 Ga0207708_10199071
440 Ga0207702_10945047
441 Ga0207641_10010828
442 Ga0207641_10494104
443 Ga0207641_10698902
444 Ga0207648_10085803
445 Ga0207676_10001208
446 Ga0207676_10016675
447 Ga0207676_10738198
448 Ga0207674_10558434
449 Ga0207674_10731846
450 Ga0207675_100754818
451 Ga0207698_10484137
452 Ga0207428_10255723
453 Ga0268265_10599349
454 Ga0268265_10886323
455 Ga0268265_10986810
456 Ga0268264_10054185
457 Ga0268264_10397598
458 Ga0268264_10553673
459 Ga0307408_100086351
460 Ga0307408_100274306
461 Ga0307408_101039999
462 Ga0307405_10356741
463 Ga0307405_10582347
464 Ga0307413_10189723
465 Ga0307410_10826712
466 Ga0307406_10028345
467 Ga0307406_10137231
468 Ga0307406_10184017
469 Ga0307406_10520669
470 Ga0307407_10393764
471 Ga0307407_10506166
472 Ga0307412_10013120
473 Ga0307412_10059071
474 Ga0307409_100113709
475 Ga0307409_100125534
476 Ga0307409_101166232
477 Ga0307416_100228071
478 Ga0307416_100766909
479 Ga0307416_101170460
480 Ga0307414_10064166
481 Ga0307414_10185749
482 Ga0307414_10271851
483 Ga0307414_10942223
484 Ga0307411_10037937
485 Ga0307411_10363829
486 Ga0307411_10404168
487 Ga0307415_100025364
488 Ga0307415_100079369
489 Ga0307415_101142356
490 Ga0395901_0184859
491 Ga0496103_0375374
492 Ga0496103_0460090
493 Ga0496106_0037154
494 Ga0496107_0024898
495 Ga0496108_0272682
496 Ga0496109_0911141
497 Ga0496112_0164419
498 Ga0501292_002575
499 Ga0501294_004039
500 Ga0501295_083909
501 Ga0501298_010930
502 Ga0501298_050731
503 Ga0501299_003550
504 Ga0501199_014267
505 Ga0501202_077281
506 Ga0501209_071585
507 Ga0501214_007176
508 Ga0501216_050999
509 Ga0501216_061843
510 Ga0501217_001919
511 Ga0501217_170908
512 Ga0501223_007642
513 Ga0501223_012151
514 Ga0501224_013813
515 Ga0501227_101340
516 Ga0501233_025209
517 Ga0501235_098239
518 Ga0501235_104259
519 Ga0501236_027035
520 Ga0501242_005392
521 Ga0501243_002911
522 Ga0501246_012413
523 Ga0501249_041938
524 Ga0501251_010298
525 Ga0501255_004851
526 Ga0501261_018745
527 Ga0501221_091256
528 Ga0501225_0018087
529 Ga0501225_0115382
530 Ga0501234_006425
531 Ga0501245_006824
532 Ga0501079_0242996
533 Ga0501268_012858
534 Ga0501268_123128
535 Ga0501270_078398
536 Ga0501273_032240
537 Ga0501281_05559
538 Ga0501282_007085
539 Ga0501212_031538
540 nmdc:mga05p37_548431_c1
541 nmdc:mga05p37_985034_c1
542 nmdc:mga09592_175810_c1
543 nmdc:mga09592_260448_c1
544 nmdc:mga09592_57605_c1
545 nmdc:mga0qj67_27710_c1
546 nmdc:mga06r32_205846_c1
547 nmdc:mga06r32_232125_c1
548 nmdc:mga06r32_312354_c1
549 nmdc:mga08y16_232044_c1
550 nmdc:mga0n895_170138_c1
551 nmdc:mga0rr50_224682_c1
552 nmdc:mga0a205_214169_c1
553 nmdc:mga0a205_88334_c1
554 nmdc:mga0a205_90582_c1
555 Ga0501084_0087348
556 Ga0590075_004866
557 Ga0590077_001660
558 Ga0530510_0539393

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05685

Uma2

Putative restriction endonuclease

40

205

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wdj-assembly1.cif.gz_C crystal structure of tt1808 from thermus thermophilus hb8 0.8838 22 179
1wdj-assembly1.cif.gz_B crystal structure of tt1808 from thermus thermophilus hb8 0.875 33 179
6okh-assembly1.cif.gz_B structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8708 9 179
3ot2-assembly1.cif.gz_B crystal structure of a putative nuclease belonging to duf820 (ava_3926) from anabaena variabilis atcc 29413 at 1.96 a resolution 0.8571 10 180
6okh-assembly1.cif.gz_B structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8432 9 179
ID Description Score Start End Superfamily
1wdjC00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.8838 22 179 3.90.1570.10
1wdjB00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.875 33 179 3.90.1570.10
af_P9WK91_74_280_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8611 107 140 3.20.20.70
3ot2B00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.8437 10 180 3.90.1570.10
1wdjB00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.8429 33 179 3.90.1570.10
ID Description Score Start End GO Terms
AF-A0A1Q7DRH9-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9732 6 179
AF-A0A2M7KRL8-F1-model_v4 Uma2 family endonuclease 0.9729 1 181 GO:0004519
AF-A0A7X4FQY9-F1-model_v4 Uma2 family endonuclease 0.9724 23 181 GO:0004519
AF-A0A6L7TNJ1-F1-model_v4 Uma2 family endonuclease 0.9707 9 117 GO:0004519
AF-A0A7V9D2D6-F1-model_v4 Uma2 family endonuclease 0.9699 10 181 GO:0004519

Map