F388946
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 289 | 135 | 289 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300001990|JGI24737J22298_10142160|JGI24737J22298_101421602 |
| Length | 129 |
| Sequence | LSPGTGRVRLTLAIAARLPYLLIMSWFPSPSSPRAAFRDLVAFMRQRSREQVIGGALAFLVTAVIVIEFLVDAKTGMKPPPQITYVELYSKNRTDADIIADQKKEMAERAEWEKEKRRQFQKLEKRFGM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 39 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 46 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 84 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 85 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 86 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 87 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 88 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 89 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 90 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 91 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 92 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 93 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 94 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 95 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 96 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 97 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 98 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 99 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 100 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 101 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 102 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 103 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 104 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 105 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 106 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 107 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 108 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 109 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 110 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 111 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 112 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 113 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 114 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 115 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 116 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 124 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 125 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 127 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 128 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 131 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 132 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 133 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 134 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.73 |
| Rhizosphere | 98.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10142160 | 3300001990 | Unclassified | 709 |
| 2 | JGI24737J22298_10260008 | 3300001990 | Bacteria | 513 |
| 3 | Ga0070658_10359550 | 3300005327 | Unclassified | 1247 |
| 4 | Ga0070658_10372604 | 3300005327 | Unclassified | 1224 |
| 5 | Ga0070658_10787592 | 3300005327 | Bacteria | 826 |
| 6 | Ga0070676_10470925 | 3300005328 | Bacteria | 887 |
| 7 | Ga0070670_100007332 | 3300005331 | Bacteria | 9360 |
| 8 | Ga0070670_100369773 | 3300005331 | Bacteria | 1262 |
| 9 | Ga0070677_10377647 | 3300005333 | Bacteria | 741 |
| 10 | Ga0070660_100005031 | 3300005339 | Bacteria | 9140 |
| 11 | Ga0070660_100005463 | 3300005339 | Bacteria | 8800 |
| 12 | Ga0070661_100021438 | 3300005344 | Bacteria | 4615 |
| 13 | Ga0070661_100029190 | 3300005344 | Bacteria | 3980 |
| 14 | Ga0070661_100533858 | 3300005344 | Bacteria | 942 |
| 15 | Ga0070692_10054147 | 3300005345 | Bacteria | 2094 |
| 16 | Ga0070668_100291903 | 3300005347 | Bacteria | 1365 |
| 17 | Ga0070675_100310348 | 3300005354 | Unclassified | 1391 |
| 18 | Ga0070675_100411079 | 3300005354 | Bacteria | 1208 |
| 19 | Ga0070675_100788610 | 3300005354 | Unclassified | 868 |
| 20 | Ga0070671_100000254 | 3300005355 | Bacteria | 35845 |
| 21 | Ga0070674_100064148 | 3300005356 | Bacteria | 2573 |
| 22 | Ga0070674_100862944 | 3300005356 | Bacteria | 786 |
| 23 | Ga0070673_100023746 | 3300005364 | Bacteria | 4484 |
| 24 | Ga0070659_100033959 | 3300005366 | Bacteria | 3966 |
| 25 | Ga0070659_100153748 | 3300005366 | Bacteria | 1878 |
| 26 | Ga0070659_100571183 | 3300005366 | Bacteria | 970 |
| 27 | Ga0070667_100786474 | 3300005367 | Bacteria | 883 |
| 28 | Ga0070700_100536850 | 3300005441 | Bacteria | 906 |
| 29 | Ga0070694_100051271 | 3300005444 | Bacteria | 2785 |
| 30 | Ga0070663_100004194 | 3300005455 | Bacteria | 8428 |
| 31 | Ga0070678_100004863 | 3300005456 | Bacteria | 7675 |
| 32 | Ga0070678_100220042 | 3300005456 | Bacteria | 1578 |
| 33 | Ga0070662_100006147 | 3300005457 | Bacteria | 7722 |
| 34 | Ga0070662_100057320 | 3300005457 | Bacteria | 2831 |
| 35 | Ga0070662_100112841 | 3300005457 | Bacteria | 2073 |
| 36 | Ga0070662_100221315 | 3300005457 | Bacteria | 1510 |
| 37 | Ga0070662_101036187 | 3300005457 | Bacteria | 703 |
| 38 | Ga0070681_10474832 | 3300005458 | Bacteria | 1163 |
| 39 | Ga0070681_11371056 | 3300005458 | Bacteria | 630 |
| 40 | Ga0068867_100809754 | 3300005459 | Bacteria | 836 |
| 41 | Ga0070706_101647910 | 3300005467 | Bacteria | 585 |
| 42 | Ga0070679_100117791 | 3300005530 | Bacteria | 2641 |
| 43 | Ga0070679_100576300 | 3300005530 | Bacteria | 1069 |
| 44 | Ga0070679_101000624 | 3300005530 | Unclassified | 780 |
| 45 | Ga0068853_100702252 | 3300005539 | Bacteria | 965 |
| 46 | Ga0070672_100167628 | 3300005543 | Bacteria | 1825 |
| 47 | Ga0070672_100232981 | 3300005543 | Unclassified | 1547 |
| 48 | Ga0070672_100408764 | 3300005543 | Bacteria | 1164 |
| 49 | Ga0070696_100000325 | 3300005546 | Bacteria | 28995 |
| 50 | Ga0070693_100356292 | 3300005547 | Bacteria | 1003 |
| 51 | Ga0068855_100674566 | 3300005563 | Bacteria | 1108 |
| 52 | Ga0070664_100000849 | 3300005564 | Bacteria | 23590 |
| 53 | Ga0070664_100035891 | 3300005564 | Bacteria | 4163 |
| 54 | Ga0070664_100443543 | 3300005564 | Bacteria | 1191 |
| 55 | Ga0070664_100716200 | 3300005564 | Bacteria | 933 |
| 56 | Ga0068857_100410519 | 3300005577 | Unclassified | 1261 |
| 57 | Ga0068854_100192703 | 3300005578 | Bacteria | 1598 |
| 58 | Ga0068854_100199561 | 3300005578 | Bacteria | 1572 |
| 59 | Ga0068852_102793268 | 3300005616 | Unclassified | 507 |
| 60 | Ga0068859_100757047 | 3300005617 | Bacteria | 1060 |
| 61 | Ga0068859_101436627 | 3300005617 | Bacteria | 761 |
| 62 | Ga0068859_102077038 | 3300005617 | Bacteria | 627 |
| 63 | Ga0068864_100044654 | 3300005618 | Bacteria | 3800 |
| 64 | Ga0068864_100416982 | 3300005618 | Bacteria | 1279 |
| 65 | Ga0068870_10286955 | 3300005840 | Unclassified | 1034 |
| 66 | Ga0068863_102226450 | 3300005841 | Unclassified | 558 |
| 67 | Ga0075428_100046860 | 3300006844 | Bacteria | 4748 |
| 68 | Ga0075429_101103530 | 3300006880 | Bacteria | 693 |
| 69 | Ga0097620_100757065 | 3300006931 | Bacteria | 1060 |
| 70 | Ga0097620_101436817 | 3300006931 | Bacteria | 761 |
| 71 | Ga0097620_102077080 | 3300006931 | Bacteria | 627 |
| 72 | Ga0114129_11168752 | 3300009147 | Bacteria | 960 |
| 73 | Ga0105243_11331125 | 3300009148 | Bacteria | 736 |
| 74 | Ga0105248_10069108 | 3300009177 | Bacteria | 3966 |
| 75 | Ga0105239_12179882 | 3300010375 | Bacteria | 644 |
| 76 | Ga0157327_1018005 | 3300012512 | Bacteria | 765 |
| 77 | Ga0157373_10265865 | 3300013100 | Bacteria | 1214 |
| 78 | Ga0157373_10843436 | 3300013100 | Bacteria | 677 |
| 79 | Ga0157373_10945466 | 3300013100 | Bacteria | 641 |
| 80 | Ga0157371_10075602 | 3300013102 | Bacteria | 2385 |
| 81 | Ga0157369_10003984 | 3300013105 | Bacteria | 17513 |
| 82 | Ga0157369_12161252 | 3300013105 | Unclassified | 564 |
| 83 | Ga0157378_12074008 | 3300013297 | Bacteria | 619 |
| 84 | Ga0163162_10152130 | 3300013306 | Bacteria | 2432 |
| 85 | Ga0157380_11028257 | 3300014326 | Bacteria | 859 |
| 86 | Ga0157380_11140872 | 3300014326 | Bacteria | 820 |
| 87 | Ga0207682_10123341 | 3300025893 | Bacteria | 1151 |
| 88 | Ga0207682_10577393 | 3300025893 | Bacteria | 531 |
| 89 | Ga0207688_10013710 | 3300025901 | Bacteria | 4407 |
| 90 | Ga0207688_10086613 | 3300025901 | Bacteria | 1795 |
| 91 | Ga0207688_10098283 | 3300025901 | Bacteria | 1687 |
| 92 | Ga0207680_10101314 | 3300025903 | Bacteria | 1851 |
| 93 | Ga0207645_10206782 | 3300025907 | Bacteria | 1292 |
| 94 | Ga0207645_10494174 | 3300025907 | Bacteria | 828 |
| 95 | Ga0207643_10053141 | 3300025908 | Bacteria | 2301 |
| 96 | Ga0207643_10413323 | 3300025908 | Bacteria | 854 |
| 97 | Ga0207705_10136917 | 3300025909 | Bacteria | 1826 |
| 98 | Ga0207705_10181313 | 3300025909 | Bacteria | 1589 |
| 99 | Ga0207705_10218580 | 3300025909 | Bacteria | 1447 |
| 100 | Ga0207705_10431132 | 3300025909 | Bacteria | 1021 |
| 101 | Ga0207705_10520876 | 3300025909 | Bacteria | 924 |
| 102 | Ga0207707_10331647 | 3300025912 | Bacteria | 1313 |
| 103 | Ga0207707_11170164 | 3300025912 | Bacteria | 624 |
| 104 | Ga0207657_10001054 | 3300025919 | Bacteria | 29233 |
| 105 | Ga0207657_10045642 | 3300025919 | Bacteria | 3843 |
| 106 | Ga0207657_10162062 | 3300025919 | Bacteria | 1816 |
| 107 | Ga0207657_10463915 | 3300025919 | Bacteria | 993 |
| 108 | Ga0207657_11349905 | 3300025919 | Bacteria | 537 |
| 109 | Ga0207649_10028997 | 3300025920 | Bacteria | 3265 |
| 110 | Ga0207649_10447067 | 3300025920 | Unclassified | 975 |
| 111 | Ga0207652_10198836 | 3300025921 | Bacteria | 1804 |
| 112 | Ga0207652_10452562 | 3300025921 | Bacteria | 1157 |
| 113 | Ga0207652_10699328 | 3300025921 | Unclassified | 905 |
| 114 | Ga0207650_10028932 | 3300025925 | Bacteria | 3978 |
| 115 | Ga0207659_10087267 | 3300025926 | Bacteria | 2322 |
| 116 | Ga0207659_10370505 | 3300025926 | Unclassified | 1192 |
| 117 | Ga0207644_10001112 | 3300025931 | Bacteria | 17264 |
| 118 | Ga0207690_10453498 | 3300025932 | Bacteria | 1031 |
| 119 | Ga0207690_11711479 | 3300025932 | Bacteria | 525 |
| 120 | Ga0207706_10004293 | 3300025933 | Bacteria | 13391 |
| 121 | Ga0207706_10013030 | 3300025933 | Bacteria | 7567 |
| 122 | Ga0207706_10049781 | 3300025933 | Bacteria | 3702 |
| 123 | Ga0207706_10166335 | 3300025933 | Bacteria | 1938 |
| 124 | Ga0207706_10492277 | 3300025933 | Bacteria | 1059 |
| 125 | Ga0207669_10047030 | 3300025937 | Bacteria | 2553 |
| 126 | Ga0207691_10016539 | 3300025940 | Bacteria | 7004 |
| 127 | Ga0207691_10136077 | 3300025940 | Bacteria | 2167 |
| 128 | Ga0207691_10403908 | 3300025940 | Bacteria | 1165 |
| 129 | Ga0207679_10057708 | 3300025945 | Bacteria | 2873 |
| 130 | Ga0207679_10284288 | 3300025945 | Bacteria | 1420 |
| 131 | Ga0207679_10419463 | 3300025945 | Unclassified | 1181 |
| 132 | Ga0207679_10723363 | 3300025945 | Bacteria | 904 |
| 133 | Ga0207667_10672242 | 3300025949 | Bacteria | 1040 |
| 134 | Ga0207651_10183536 | 3300025960 | Unclassified | 1662 |
| 135 | Ga0207668_10334561 | 3300025972 | Bacteria | 1261 |
| 136 | Ga0207668_11161145 | 3300025972 | Bacteria | 693 |
| 137 | Ga0207640_10432651 | 3300025981 | Bacteria | 1080 |
| 138 | Ga0207639_10497653 | 3300026041 | Bacteria | 1113 |
| 139 | Ga0207639_11335809 | 3300026041 | Bacteria | 673 |
| 140 | Ga0207678_10002797 | 3300026067 | Bacteria | 15835 |
| 141 | Ga0207678_10328958 | 3300026067 | Bacteria | 1315 |
| 142 | Ga0207708_10429533 | 3300026075 | Unclassified | 1097 |
| 143 | Ga0207648_10674987 | 3300026089 | Bacteria | 956 |
| 144 | Ga0207648_11249428 | 3300026089 | Unclassified | 698 |
| 145 | Ga0207676_10076710 | 3300026095 | Bacteria | 2701 |
| 146 | Ga0207674_10016335 | 3300026116 | Bacteria | 8131 |
| 147 | Ga0207674_10522209 | 3300026116 | Unclassified | 1147 |
| 148 | Ga0207683_10002394 | 3300026121 | Bacteria | 16388 |
| 149 | Ga0209973_1057426 | 3300027252 | Bacteria | 594 |
| 150 | Ga0268265_10945746 | 3300028380 | Bacteria | 849 |
| 151 | Ga0307408_100079962 | 3300031548 | Bacteria | 2441 |
| 152 | Ga0307408_100555989 | 3300031548 | Unclassified | 1013 |
| 153 | Ga0307408_100831131 | 3300031548 | Bacteria | 841 |
| 154 | Ga0307405_10080849 | 3300031731 | Bacteria | 2122 |
| 155 | Ga0307405_10233772 | 3300031731 | Bacteria | 1357 |
| 156 | Ga0307413_10078079 | 3300031824 | Bacteria | 2111 |
| 157 | Ga0307413_10213027 | 3300031824 | Unclassified | 1405 |
| 158 | Ga0307413_10346518 | 3300031824 | Bacteria | 1144 |
| 159 | Ga0307410_10000659 | 3300031852 | Bacteria | 14273 |
| 160 | Ga0307410_10036295 | 3300031852 | Bacteria | 3208 |
| 161 | Ga0307410_10142368 | 3300031852 | Bacteria | 1776 |
| 162 | Ga0307410_10760270 | 3300031852 | Bacteria | 821 |
| 163 | Ga0307406_10011830 | 3300031901 | Bacteria | 4958 |
| 164 | Ga0307406_10148446 | 3300031901 | Bacteria | 1669 |
| 165 | Ga0307406_10219516 | 3300031901 | Bacteria | 1412 |
| 166 | Ga0307406_10221538 | 3300031901 | Bacteria | 1406 |
| 167 | Ga0307406_10408109 | 3300031901 | Unclassified | 1079 |
| 168 | Ga0307406_11263503 | 3300031901 | Bacteria | 643 |
| 169 | Ga0307407_10012647 | 3300031903 | Bacteria | 4064 |
| 170 | Ga0307407_11547954 | 3300031903 | Bacteria | 525 |
| 171 | Ga0307412_10119569 | 3300031911 | Bacteria | 1894 |
| 172 | Ga0307412_10296504 | 3300031911 | Unclassified | 1276 |
| 173 | Ga0307412_10308884 | 3300031911 | Bacteria | 1253 |
| 174 | Ga0307409_100002642 | 3300031995 | Bacteria | 9432 |
| 175 | Ga0307409_100008461 | 3300031995 | Bacteria | 6248 |
| 176 | Ga0307409_100057711 | 3300031995 | Bacteria | 3010 |
| 177 | Ga0307409_100083175 | 3300031995 | Unclassified | 2594 |
| 178 | Ga0307409_100258456 | 3300031995 | Bacteria | 1596 |
| 179 | Ga0307409_100310480 | 3300031995 | Bacteria | 1471 |
| 180 | Ga0307409_100438267 | 3300031995 | Bacteria | 1258 |
| 181 | Ga0307409_100930122 | 3300031995 | Bacteria | 884 |
| 182 | Ga0307409_100947571 | 3300031995 | Bacteria | 877 |
| 183 | Ga0307416_100017701 | 3300032002 | Bacteria | 4995 |
| 184 | Ga0307416_100062436 | 3300032002 | Bacteria | 3046 |
| 185 | Ga0307416_102498456 | 3300032002 | Bacteria | 615 |
| 186 | Ga0307416_103131651 | 3300032002 | Bacteria | 553 |
| 187 | Ga0307416_103840347 | 3300032002 | Bacteria | 503 |
| 188 | Ga0307414_10000834 | 3300032004 | Bacteria | 15720 |
| 189 | Ga0307414_10029219 | 3300032004 | Bacteria | 3585 |
| 190 | Ga0307414_10043594 | 3300032004 | Bacteria | 3058 |
| 191 | Ga0307414_10071010 | 3300032004 | Bacteria | 2510 |
| 192 | Ga0307414_10196637 | 3300032004 | Bacteria | 1636 |
| 193 | Ga0307414_10725841 | 3300032004 | Unclassified | 901 |
| 194 | Ga0307414_10852093 | 3300032004 | Unclassified | 833 |
| 195 | Ga0307414_11106830 | 3300032004 | Bacteria | 731 |
| 196 | Ga0307411_10029068 | 3300032005 | Bacteria | 3370 |
| 197 | Ga0307411_10086706 | 3300032005 | Bacteria | 2172 |
| 198 | Ga0307411_10115659 | 3300032005 | Bacteria | 1929 |
| 199 | Ga0307411_10128129 | 3300032005 | Bacteria | 1850 |
| 200 | Ga0307411_10426246 | 3300032005 | Bacteria | 1103 |
| 201 | Ga0307411_10699810 | 3300032005 | Bacteria | 883 |
| 202 | Ga0307411_10972160 | 3300032005 | Bacteria | 758 |
| 203 | Ga0307411_11342130 | 3300032005 | Bacteria | 653 |
| 204 | Ga0307415_100009174 | 3300032126 | Bacteria | 5526 |
| 205 | Ga0307415_100048103 | 3300032126 | Bacteria | 2876 |
| 206 | Ga0307415_100080544 | 3300032126 | Bacteria | 2323 |
| 207 | Ga0307415_100239327 | 3300032126 | Bacteria | 1467 |
| 208 | Ga0307415_100288729 | 3300032126 | Bacteria | 1353 |
| 209 | Ga0307415_101970204 | 3300032126 | Bacteria | 568 |
| 210 | Ga0307415_102187208 | 3300032126 | Bacteria | 541 |
| 211 | Ga0373936_0093082 | 3300035113 | Bacteria | 1265 |
| 212 | Ga0373943_0002312 | 3300035170 | Bacteria | 8661 |
| 213 | Ga0373946_0021864 | 3300035171 | Bacteria | 2484 |
| 214 | Ga0373935_0043735 | 3300035692 | Bacteria | 2820 |
| 215 | Ga0373927_0215422 | 3300035695 | Bacteria | 1261 |
| 216 | Ga0373947_0292693 | 3300035725 | Bacteria | 1084 |
| 217 | Ga0373925_0032700 | 3300037068 | Bacteria | 3829 |
| 218 | Ga0395899_0000129 | 3300037312 | Bacteria | 118043 |
| 219 | Ga0395899_0108619 | 3300037312 | Bacteria | 1996 |
| 220 | Ga0395899_0108750 | 3300037312 | Bacteria | 1995 |
| 221 | Ga0395899_0110261 | 3300037312 | Bacteria | 1979 |
| 222 | Ga0395899_0187783 | 3300037312 | Bacteria | 1447 |
| 223 | Ga0395900_0002105 | 3300037418 | Bacteria | 22295 |
| 224 | Ga0395900_0016179 | 3300037418 | Bacteria | 7598 |
| 225 | Ga0395900_0041217 | 3300037418 | Bacteria | 4760 |
| 226 | Ga0395900_0227475 | 3300037418 | Bacteria | 1878 |
| 227 | Ga0395900_0249792 | 3300037418 | Bacteria | 1775 |
| 228 | Ga0395900_0250039 | 3300037418 | Bacteria | 1774 |
| 229 | Ga0395900_0269860 | 3300037418 | Bacteria | 1696 |
| 230 | Ga0395900_0382771 | 3300037418 | Bacteria | 1374 |
| 231 | Ga0395898_0002720 | 3300037466 | Bacteria | 20390 |
| 232 | Ga0395898_0020543 | 3300037466 | Bacteria | 6707 |
| 233 | Ga0395898_0031011 | 3300037466 | Bacteria | 5346 |
| 234 | Ga0395898_0160885 | 3300037466 | Bacteria | 2147 |
| 235 | Ga0395898_0181874 | 3300037466 | Bacteria | 2009 |
| 236 | Ga0395905_0001572 | 3300037471 | Bacteria | 27278 |
| 237 | Ga0395905_0003151 | 3300037471 | Bacteria | 17763 |
| 238 | Ga0395905_0009946 | 3300037471 | Bacteria | 9268 |
| 239 | Ga0395905_0058041 | 3300037471 | Bacteria | 3619 |
| 240 | Ga0395905_0090581 | 3300037471 | Bacteria | 2867 |
| 241 | Ga0395905_0380304 | 3300037471 | Unclassified | 1306 |
| 242 | Ga0395905_0419381 | 3300037471 | Bacteria | 1234 |
| 243 | Ga0395905_0958765 | 3300037471 | Bacteria | 758 |
| 244 | Ga0395905_1436539 | 3300037471 | Bacteria | 594 |
| 245 | Ga0395905_1447467 | 3300037471 | Bacteria | 591 |
| 246 | Ga0395901_0001239 | 3300038443 | Bacteria | 27244 |
| 247 | Ga0395901_0004628 | 3300038443 | Bacteria | 13884 |
| 248 | Ga0395901_0030409 | 3300038443 | Bacteria | 5563 |
| 249 | Ga0395901_0126937 | 3300038443 | Bacteria | 2680 |
| 250 | Ga0395901_0137303 | 3300038443 | Bacteria | 2569 |
| 251 | Ga0395901_0397717 | 3300038443 | Bacteria | 1416 |
| 252 | Ga0395901_0404317 | 3300038443 | Bacteria | 1402 |
| 253 | Ga0395901_0614782 | 3300038443 | Bacteria | 1094 |
| 254 | Ga0395901_0692566 | 3300038443 | Bacteria | 1018 |
| 255 | Ga0395901_1589193 | 3300038443 | Unclassified | 607 |
| 256 | Ga0450891_004530 | 3300042129 | Bacteria | 1297 |
| 257 | Ga0466969_0033732 | 3300044656 | Bacteria | 2597 |
| 258 | Ga0466966_0067711 | 3300044684 | Bacteria | 2242 |
| 259 | Ga0466966_0072901 | 3300044684 | Unclassified | 2149 |
| 260 | Ga0466971_0672451 | 3300044719 | Bacteria | 519 |
| 261 | Ga0466957_0393176 | 3300044842 | Unclassified | 947 |
| 262 | Ga0466960_0083778 | 3300044901 | Bacteria | 1612 |
| 263 | Ga0466959_0193346 | 3300045049 | Unclassified | 1419 |
| 264 | Ga0466958_0032362 | 3300045836 | Bacteria | 3111 |
| 265 | Ga0466967_0522677 | 3300045976 | Bacteria | 1166 |
| 266 | Ga0466967_0607955 | 3300045976 | Bacteria | 1079 |
| 267 | Ga0466967_1469134 | 3300045976 | Unclassified | 679 |
| 268 | Ga0495585_0127964 | 3300046492 | Bacteria | 1339 |
| 269 | Ga0495663_0035792 | 3300046525 | Bacteria | 1492 |
| 270 | Ga0495642_0095932 | 3300046528 | Bacteria | 1259 |
| 271 | Ga0495665_0384652 | 3300046531 | Bacteria | 713 |
| 272 | Ga0495633_0142536 | 3300046558 | Bacteria | 1108 |
| 273 | Ga0495669_0392120 | 3300046684 | Bacteria | 672 |
| 274 | Ga0495669_0541566 | 3300046684 | Bacteria | 566 |
| 275 | Ga0495677_0032169 | 3300047445 | Bacteria | 1910 |
| 276 | Ga0495677_0261867 | 3300047445 | Bacteria | 677 |
| 277 | Ga0496101_0781705 | 3300048904 | Bacteria | 753 |
| 278 | Ga0496102_1647622 | 3300048905 | Bacteria | 560 |
| 279 | Ga0496109_0622130 | 3300048912 | Bacteria | 1016 |
| 280 | Ga0496110_0846499 | 3300048913 | Bacteria | 820 |
| 281 | Ga0496111_0258621 | 3300048914 | Bacteria | 1292 |
| 282 | Ga0501067_0061384 | 3300049583 | Bacteria | 2081 |
| 283 | Ga0501068_0073014 | 3300049584 | Bacteria | 2096 |
| 284 | Ga0501069_0298047 | 3300049585 | Bacteria | 945 |
| 285 | Ga0501223_100389 | 3300049663 | Bacteria | 596 |
| 286 | Ga0501235_099734 | 3300049669 | Bacteria | 708 |
| 287 | Ga0501234_049021 | 3300049707 | Bacteria | 701 |
| 288 | nmdc:mga09592_247214_c1 | 3300050508 | Bacteria | 1546 |
| 289 | Ga0590071_074189 | 3300059421 | Bacteria | 841 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300001990 | JGI24737J22298_10260008 | JGI24737J22298_102600082 | 106 |
| 2 | 3300005327 | Ga0070658_10359550 | Ga0070658_103595501 | 106 |
| 3 | 3300005327 | Ga0070658_10787592 | Ga0070658_107875921 | 106 |
| 4 | 3300005328 | Ga0070676_10470925 | Ga0070676_104709252 | 106 |
| 5 | 3300005331 | Ga0070670_100369773 | Ga0070670_1003697732 | 106 |
| 6 | 3300005333 | Ga0070677_10377647 | Ga0070677_103776472 | 106 |
| 7 | 3300005339 | Ga0070660_100005031 | Ga0070660_1000050314 | 106 |
| 8 | 3300005339 | Ga0070660_100005463 | Ga0070660_1000054638 | 106 |
| 9 | 3300005344 | Ga0070661_100029190 | Ga0070661_1000291905 | 106 |
| 10 | 3300005344 | Ga0070661_100533858 | Ga0070661_1005338582 | 106 |
| 11 | 3300005345 | Ga0070692_10054147 | Ga0070692_100541472 | 106 |
| 12 | 3300005347 | Ga0070668_100291903 | Ga0070668_1002919032 | 106 |
| 13 | 3300005354 | Ga0070675_100411079 | Ga0070675_1004110793 | 106 |
| 14 | 3300005355 | Ga0070671_100000254 | Ga0070671_10000025431 | 106 |
| 15 | 3300005356 | Ga0070674_100862944 | Ga0070674_1008629442 | 106 |
| 16 | 3300005364 | Ga0070673_100023746 | Ga0070673_1000237465 | 106 |
| 17 | 3300005366 | Ga0070659_100033959 | Ga0070659_1000339593 | 106 |
| 18 | 3300005366 | Ga0070659_100153748 | Ga0070659_1001537482 | 106 |
| 19 | 3300005366 | Ga0070659_100571183 | Ga0070659_1005711832 | 106 |
| 20 | 3300005367 | Ga0070667_100786474 | Ga0070667_1007864741 | 106 |
| 21 | 3300005444 | Ga0070694_100051271 | Ga0070694_1000512712 | 106 |
| 22 | 3300005455 | Ga0070663_100004194 | Ga0070663_1000041943 | 106 |
| 23 | 3300005456 | Ga0070678_100004863 | Ga0070678_1000048634 | 106 |
| 24 | 3300005457 | Ga0070662_100006147 | Ga0070662_1000061472 | 106 |
| 25 | 3300005457 | Ga0070662_100112841 | Ga0070662_1001128414 | 106 |
| 26 | 3300005457 | Ga0070662_101036187 | Ga0070662_1010361872 | 106 |
| 27 | 3300005458 | Ga0070681_10474832 | Ga0070681_104748322 | 106 |
| 28 | 3300005458 | Ga0070681_11371056 | Ga0070681_113710561 | 106 |
| 29 | 3300005459 | Ga0068867_100809754 | Ga0068867_1008097542 | 106 |
| 30 | 3300005467 | Ga0070706_101647910 | Ga0070706_1016479101 | 106 |
| 31 | 3300005530 | Ga0070679_100117791 | Ga0070679_1001177912 | 106 |
| 32 | 3300005530 | Ga0070679_100576300 | Ga0070679_1005763002 | 106 |
| 33 | 3300005539 | Ga0068853_100702252 | Ga0068853_1007022521 | 106 |
| 34 | 3300005543 | Ga0070672_100167628 | Ga0070672_1001676282 | 106 |
| 35 | 3300005543 | Ga0070672_100232981 | Ga0070672_1002329812 | 106 |
| 36 | 3300005546 | Ga0070696_100000325 | Ga0070696_10000032519 | 106 |
| 37 | 3300005547 | Ga0070693_100356292 | Ga0070693_1003562922 | 106 |
| 38 | 3300005563 | Ga0068855_100674566 | Ga0068855_1006745661 | 106 |
| 39 | 3300005564 | Ga0070664_100035891 | Ga0070664_1000358913 | 106 |
| 40 | 3300005564 | Ga0070664_100443543 | Ga0070664_1004435432 | 106 |
| 41 | 3300005564 | Ga0070664_100716200 | Ga0070664_1007162002 | 106 |
| 42 | 3300005578 | Ga0068854_100192703 | Ga0068854_1001927032 | 106 |
| 43 | 3300005578 | Ga0068854_100199561 | Ga0068854_1001995612 | 106 |
| 44 | 3300005616 | Ga0068852_102793268 | Ga0068852_1027932682 | 106 |
| 45 | 3300005617 | Ga0068859_100757047 | Ga0068859_1007570472 | 106 |
| 46 | 3300005617 | Ga0068859_101436627 | Ga0068859_1014366271 | 106 |
| 47 | 3300005617 | Ga0068859_102077038 | Ga0068859_1020770382 | 106 |
| 48 | 3300005618 | Ga0068864_100416982 | Ga0068864_1004169822 | 106 |
| 49 | 3300005841 | Ga0068863_102226450 | Ga0068863_1022264502 | 106 |
| 50 | 3300006844 | Ga0075428_100046860 | Ga0075428_1000468603 | 106 |
| 51 | 3300006880 | Ga0075429_101103530 | Ga0075429_1011035302 | 106 |
| 52 | 3300006931 | Ga0097620_100757065 | Ga0097620_1007570652 | 106 |
| 53 | 3300006931 | Ga0097620_101436817 | Ga0097620_1014368172 | 106 |
| 54 | 3300006931 | Ga0097620_102077080 | Ga0097620_1020770802 | 106 |
| 55 | 3300009147 | Ga0114129_11168752 | Ga0114129_111687522 | 106 |
| 56 | 3300009148 | Ga0105243_11331125 | Ga0105243_113311252 | 106 |
| 57 | 3300009177 | Ga0105248_10069108 | Ga0105248_100691086 | 106 |
| 58 | 3300010375 | Ga0105239_12179882 | Ga0105239_121798822 | 106 |
| 59 | 3300012512 | Ga0157327_1018005 | Ga0157327_10180051 | 106 |
| 60 | 3300013100 | Ga0157373_10265865 | Ga0157373_102658652 | 106 |
| 61 | 3300013100 | Ga0157373_10843436 | Ga0157373_108434362 | 106 |
| 62 | 3300013100 | Ga0157373_10945466 | Ga0157373_109454662 | 106 |
| 63 | 3300013102 | Ga0157371_10075602 | Ga0157371_100756022 | 106 |
| 64 | 3300013105 | Ga0157369_10003984 | Ga0157369_100039848 | 106 |
| 65 | 3300013105 | Ga0157369_12161252 | Ga0157369_121612522 | 106 |
| 66 | 3300013297 | Ga0157378_12074008 | Ga0157378_120740082 | 106 |
| 67 | 3300025893 | Ga0207682_10123341 | Ga0207682_101233412 | 106 |
| 68 | 3300025893 | Ga0207682_10577393 | Ga0207682_105773931 | 106 |
| 69 | 3300025901 | Ga0207688_10098283 | Ga0207688_100982833 | 106 |
| 70 | 3300025903 | Ga0207680_10101314 | Ga0207680_101013143 | 106 |
| 71 | 3300025907 | Ga0207645_10206782 | Ga0207645_102067822 | 106 |
| 72 | 3300025907 | Ga0207645_10494174 | Ga0207645_104941742 | 106 |
| 73 | 3300025908 | Ga0207643_10053141 | Ga0207643_100531412 | 106 |
| 74 | 3300025908 | Ga0207643_10413323 | Ga0207643_104133232 | 106 |
| 75 | 3300025909 | Ga0207705_10136917 | Ga0207705_101369172 | 106 |
| 76 | 3300025909 | Ga0207705_10181313 | Ga0207705_101813132 | 106 |
| 77 | 3300025909 | Ga0207705_10218580 | Ga0207705_102185802 | 106 |
| 78 | 3300025909 | Ga0207705_10431132 | Ga0207705_104311321 | 106 |
| 79 | 3300025909 | Ga0207705_10520876 | Ga0207705_105208762 | 106 |
| 80 | 3300025912 | Ga0207707_10331647 | Ga0207707_103316472 | 106 |
| 81 | 3300025919 | Ga0207657_10001054 | Ga0207657_1000105423 | 106 |
| 82 | 3300025919 | Ga0207657_10045642 | Ga0207657_100456424 | 106 |
| 83 | 3300025919 | Ga0207657_10162062 | Ga0207657_101620622 | 106 |
| 84 | 3300025919 | Ga0207657_10463915 | Ga0207657_104639152 | 106 |
| 85 | 3300025919 | Ga0207657_11349905 | Ga0207657_113499051 | 106 |
| 86 | 3300025920 | Ga0207649_10447067 | Ga0207649_104470672 | 106 |
| 87 | 3300025921 | Ga0207652_10198836 | Ga0207652_101988362 | 106 |
| 88 | 3300025921 | Ga0207652_10452562 | Ga0207652_104525622 | 106 |
| 89 | 3300025931 | Ga0207644_10001112 | Ga0207644_1000111210 | 106 |
| 90 | 3300025932 | Ga0207690_10453498 | Ga0207690_104534982 | 106 |
| 91 | 3300025932 | Ga0207690_11711479 | Ga0207690_117114791 | 106 |
| 92 | 3300025933 | Ga0207706_10013030 | Ga0207706_100130303 | 106 |
| 93 | 3300025933 | Ga0207706_10049781 | Ga0207706_100497813 | 106 |
| 94 | 3300025933 | Ga0207706_10492277 | Ga0207706_104922772 | 106 |
| 95 | 3300025940 | Ga0207691_10016539 | Ga0207691_100165396 | 106 |
| 96 | 3300025940 | Ga0207691_10136077 | Ga0207691_101360774 | 106 |
| 97 | 3300025945 | Ga0207679_10284288 | Ga0207679_102842881 | 106 |
| 98 | 3300025945 | Ga0207679_10419463 | Ga0207679_104194632 | 106 |
| 99 | 3300025945 | Ga0207679_10723363 | Ga0207679_107233632 | 106 |
| 100 | 3300025949 | Ga0207667_10672242 | Ga0207667_106722421 | 106 |
| 101 | 3300025960 | Ga0207651_10183536 | Ga0207651_101835362 | 106 |
| 102 | 3300025972 | Ga0207668_10334561 | Ga0207668_103345612 | 106 |
| 103 | 3300025972 | Ga0207668_11161145 | Ga0207668_111611452 | 106 |
| 104 | 3300025981 | Ga0207640_10432651 | Ga0207640_104326512 | 106 |
| 105 | 3300026041 | Ga0207639_10497653 | Ga0207639_104976532 | 106 |
| 106 | 3300026041 | Ga0207639_11335809 | Ga0207639_113358092 | 106 |
| 107 | 3300026067 | Ga0207678_10002797 | Ga0207678_100027978 | 106 |
| 108 | 3300026067 | Ga0207678_10328958 | Ga0207678_103289582 | 106 |
| 109 | 3300026075 | Ga0207708_10429533 | Ga0207708_104295331 | 106 |
| 110 | 3300026089 | Ga0207648_10674987 | Ga0207648_106749872 | 106 |
| 111 | 3300026089 | Ga0207648_11249428 | Ga0207648_112494282 | 106 |
| 112 | 3300026116 | Ga0207674_10016335 | Ga0207674_100163355 | 106 |
| 113 | 3300026121 | Ga0207683_10002394 | Ga0207683_1000239412 | 106 |
| 114 | 3300027252 | Ga0209973_1057426 | Ga0209973_10574262 | 106 |
| 115 | 3300028380 | Ga0268265_10945746 | Ga0268265_109457462 | 106 |
| 116 | 3300031548 | Ga0307408_100079962 | Ga0307408_1000799622 | 106 |
| 117 | 3300031548 | Ga0307408_100831131 | Ga0307408_1008311312 | 106 |
| 118 | 3300031731 | Ga0307405_10233772 | Ga0307405_102337721 | 106 |
| 119 | 3300031824 | Ga0307413_10078079 | Ga0307413_100780793 | 106 |
| 120 | 3300031852 | Ga0307410_10142368 | Ga0307410_101423682 | 106 |
| 121 | 3300031901 | Ga0307406_10148446 | Ga0307406_101484462 | 106 |
| 122 | 3300031901 | Ga0307406_10219516 | Ga0307406_102195163 | 106 |
| 123 | 3300031901 | Ga0307406_10221538 | Ga0307406_102215382 | 106 |
| 124 | 3300031901 | Ga0307406_10408109 | Ga0307406_104081092 | 106 |
| 125 | 3300031901 | Ga0307406_11263503 | Ga0307406_112635031 | 106 |
| 126 | 3300031911 | Ga0307412_10296504 | Ga0307412_102965042 | 106 |
| 127 | 3300031911 | Ga0307412_10308884 | Ga0307412_103088842 | 106 |
| 128 | 3300031995 | Ga0307409_100008461 | Ga0307409_1000084618 | 106 |
| 129 | 3300031995 | Ga0307409_100083175 | Ga0307409_1000831754 | 106 |
| 130 | 3300031995 | Ga0307409_100438267 | Ga0307409_1004382672 | 106 |
| 131 | 3300031995 | Ga0307409_100947571 | Ga0307409_1009475712 | 106 |
| 132 | 3300032002 | Ga0307416_100017701 | Ga0307416_1000177014 | 106 |
| 133 | 3300032002 | Ga0307416_102498456 | Ga0307416_1024984562 | 106 |
| 134 | 3300032002 | Ga0307416_103131651 | Ga0307416_1031316511 | 106 |
| 135 | 3300032002 | Ga0307416_103840347 | Ga0307416_1038403471 | 106 |
| 136 | 3300032004 | Ga0307414_10071010 | Ga0307414_100710102 | 106 |
| 137 | 3300032004 | Ga0307414_10196637 | Ga0307414_101966372 | 106 |
| 138 | 3300032005 | Ga0307411_10426246 | Ga0307411_104262462 | 106 |
| 139 | 3300032005 | Ga0307411_10699810 | Ga0307411_106998102 | 106 |
| 140 | 3300032005 | Ga0307411_11342130 | Ga0307411_113421302 | 106 |
| 141 | 3300032126 | Ga0307415_100009174 | Ga0307415_1000091744 | 106 |
| 142 | 3300032126 | Ga0307415_100239327 | Ga0307415_1002393272 | 106 |
| 143 | 3300032126 | Ga0307415_100288729 | Ga0307415_1002887292 | 106 |
| 144 | 3300032126 | Ga0307415_101970204 | Ga0307415_1019702042 | 106 |
| 145 | 3300032126 | Ga0307415_102187208 | Ga0307415_1021872081 | 106 |
| 146 | 3300035113 | Ga0373936_0093082 | Ga0373936_0093082_289_609 | 106 |
| 147 | 3300035170 | Ga0373943_0002312 | Ga0373943_0002312_4305_4625 | 106 |
| 148 | 3300035171 | Ga0373946_0021864 | Ga0373946_0021864_939_1259 | 106 |
| 149 | 3300035692 | Ga0373935_0043735 | Ga0373935_0043735_1768_2088 | 106 |
| 150 | 3300035695 | Ga0373927_0215422 | Ga0373927_0215422_410_730 | 106 |
| 151 | 3300035725 | Ga0373947_0292693 | Ga0373947_0292693_621_941 | 106 |
| 152 | 3300037068 | Ga0373925_0032700 | Ga0373925_0032700_2800_3120 | 106 |
| 153 | 3300037312 | Ga0395899_0000129 | Ga0395899_0000129_56525_56848 | 106 |
| 154 | 3300037312 | Ga0395899_0108619 | Ga0395899_0108619_514_834 | 106 |
| 155 | 3300037312 | Ga0395899_0108750 | Ga0395899_0108750_633_953 | 106 |
| 156 | 3300037312 | Ga0395899_0110261 | Ga0395899_0110261_35_358 | 106 |
| 157 | 3300037312 | Ga0395899_0187783 | Ga0395899_0187783_571_894 | 106 |
| 158 | 3300037418 | Ga0395900_0002105 | Ga0395900_0002105_4299_4622 | 106 |
| 159 | 3300037418 | Ga0395900_0016179 | Ga0395900_0016179_3679_4002 | 106 |
| 160 | 3300037418 | Ga0395900_0041217 | Ga0395900_0041217_732_1052 | 106 |
| 161 | 3300037418 | Ga0395900_0227475 | Ga0395900_0227475_1059_1379 | 106 |
| 162 | 3300037418 | Ga0395900_0249792 | Ga0395900_0249792_951_1271 | 106 |
| 163 | 3300037418 | Ga0395900_0250039 | Ga0395900_0250039_1024_1344 | 106 |
| 164 | 3300037418 | Ga0395900_0269860 | Ga0395900_0269860_302_625 | 106 |
| 165 | 3300037418 | Ga0395900_0382771 | Ga0395900_0382771_630_953 | 106 |
| 166 | 3300037466 | Ga0395898_0002720 | Ga0395898_0002720_7062_7382 | 106 |
| 167 | 3300037466 | Ga0395898_0020543 | Ga0395898_0020543_3370_3693 | 106 |
| 168 | 3300037466 | Ga0395898_0031011 | Ga0395898_0031011_3414_3737 | 106 |
| 169 | 3300037466 | Ga0395898_0160885 | Ga0395898_0160885_800_1120 | 106 |
| 170 | 3300037466 | Ga0395898_0181874 | Ga0395898_0181874_93_416 | 106 |
| 171 | 3300037471 | Ga0395905_0001572 | Ga0395905_0001572_22346_22666 | 106 |
| 172 | 3300037471 | Ga0395905_0003151 | Ga0395905_0003151_5647_5967 | 106 |
| 173 | 3300037471 | Ga0395905_0009946 | Ga0395905_0009946_7311_7631 | 106 |
| 174 | 3300037471 | Ga0395905_0058041 | Ga0395905_0058041_2723_3043 | 106 |
| 175 | 3300037471 | Ga0395905_0090581 | Ga0395905_0090581_1570_1893 | 106 |
| 176 | 3300037471 | Ga0395905_0380304 | Ga0395905_0380304_357_677 | 106 |
| 177 | 3300037471 | Ga0395905_0419381 | Ga0395905_0419381_618_941 | 106 |
| 178 | 3300037471 | Ga0395905_0958765 | Ga0395905_0958765_15_335 | 106 |
| 179 | 3300037471 | Ga0395905_1436539 | Ga0395905_1436539_219_539 | 106 |
| 180 | 3300037471 | Ga0395905_1447467 | Ga0395905_1447467_159_482 | 106 |
| 181 | 3300038443 | Ga0395901_0001239 | Ga0395901_0001239_18173_18496 | 106 |
| 182 | 3300038443 | Ga0395901_0004628 | Ga0395901_0004628_8570_8890 | 106 |
| 183 | 3300038443 | Ga0395901_0030409 | Ga0395901_0030409_1989_2309 | 106 |
| 184 | 3300038443 | Ga0395901_0126937 | Ga0395901_0126937_260_583 | 106 |
| 185 | 3300038443 | Ga0395901_0137303 | Ga0395901_0137303_1947_2267 | 106 |
| 186 | 3300038443 | Ga0395901_0397717 | Ga0395901_0397717_1044_1364 | 106 |
| 187 | 3300038443 | Ga0395901_0404317 | Ga0395901_0404317_658_981 | 106 |
| 188 | 3300038443 | Ga0395901_0614782 | Ga0395901_0614782_740_1060 | 106 |
| 189 | 3300038443 | Ga0395901_0692566 | Ga0395901_0692566_625_948 | 106 |
| 190 | 3300038443 | Ga0395901_1589193 | Ga0395901_1589193_265_588 | 106 |
| 191 | 3300042129 | Ga0450891_004530 | Ga0450891_004530_872_1192 | 106 |
| 192 | 3300044656 | Ga0466969_0033732 | Ga0466969_0033732_2031_2351 | 106 |
| 193 | 3300044684 | Ga0466966_0067711 | Ga0466966_0067711_1311_1631 | 106 |
| 194 | 3300044684 | Ga0466966_0072901 | Ga0466966_0072901_1152_1472 | 106 |
| 195 | 3300044719 | Ga0466971_0672451 | Ga0466971_0672451_110_433 | 106 |
| 196 | 3300044842 | Ga0466957_0393176 | Ga0466957_0393176_176_499 | 106 |
| 197 | 3300044901 | Ga0466960_0083778 | Ga0466960_0083778_427_747 | 106 |
| 198 | 3300045049 | Ga0466959_0193346 | Ga0466959_0193346_617_937 | 106 |
| 199 | 3300045836 | Ga0466958_0032362 | Ga0466958_0032362_2580_2903 | 106 |
| 200 | 3300045976 | Ga0466967_0522677 | Ga0466967_0522677_126_449 | 106 |
| 201 | 3300045976 | Ga0466967_0607955 | Ga0466967_0607955_686_1006 | 106 |
| 202 | 3300045976 | Ga0466967_1469134 | Ga0466967_1469134_78_401 | 106 |
| 203 | 3300046492 | Ga0495585_0127964 | Ga0495585_0127964_660_980 | 106 |
| 204 | 3300046525 | Ga0495663_0035792 | Ga0495663_0035792_399_719 | 106 |
| 205 | 3300046528 | Ga0495642_0095932 | Ga0495642_0095932_918_1238 | 106 |
| 206 | 3300046531 | Ga0495665_0384652 | Ga0495665_0384652_383_703 | 106 |
| 207 | 3300046558 | Ga0495633_0142536 | Ga0495633_0142536_25_345 | 106 |
| 208 | 3300046684 | Ga0495669_0392120 | Ga0495669_0392120_159_479 | 106 |
| 209 | 3300046684 | Ga0495669_0541566 | Ga0495669_0541566_136_456 | 106 |
| 210 | 3300047445 | Ga0495677_0032169 | Ga0495677_0032169_160_480 | 106 |
| 211 | 3300047445 | Ga0495677_0261867 | Ga0495677_0261867_238_558 | 106 |
| 212 | 3300048904 | Ga0496101_0781705 | Ga0496101_0781705_50_370 | 106 |
| 213 | 3300048905 | Ga0496102_1647622 | Ga0496102_1647622_46_366 | 106 |
| 214 | 3300048912 | Ga0496109_0622130 | Ga0496109_0622130_527_847 | 106 |
| 215 | 3300048913 | Ga0496110_0846499 | Ga0496110_0846499_56_376 | 106 |
| 216 | 3300048914 | Ga0496111_0258621 | Ga0496111_0258621_634_954 | 106 |
| 217 | 3300049583 | Ga0501067_0061384 | Ga0501067_0061384_354_674 | 106 |
| 218 | 3300049584 | Ga0501068_0073014 | Ga0501068_0073014_1701_2021 | 106 |
| 219 | 3300049585 | Ga0501069_0298047 | Ga0501069_0298047_428_748 | 106 |
| 220 | 3300049663 | Ga0501223_100389 | Ga0501223_100389_217_537 | 106 |
| 221 | 3300050508 | nmdc:mga09592_247214_c1 | nmdc:mga09592_247214_c1_782_1102 | 106 |
| 222 | 3300059421 | Ga0590071_074189 | Ga0590071_074189_119_439 | 106 |
| 223 | 3300005354 | Ga0070675_100310348 | Ga0070675_1003103482 | 107 |
| 224 | 3300005441 | Ga0070700_100536850 | Ga0070700_1005368502 | 107 |
| 225 | 3300005457 | Ga0070662_100057320 | Ga0070662_1000573204 | 107 |
| 226 | 3300005543 | Ga0070672_100408764 | Ga0070672_1004087642 | 107 |
| 227 | 3300014326 | Ga0157380_11140872 | Ga0157380_111408722 | 107 |
| 228 | 3300025901 | Ga0207688_10086613 | Ga0207688_100866132 | 107 |
| 229 | 3300025926 | Ga0207659_10370505 | Ga0207659_103705051 | 107 |
| 230 | 3300025933 | Ga0207706_10166335 | Ga0207706_101663353 | 107 |
| 231 | 3300025940 | Ga0207691_10403908 | Ga0207691_104039082 | 107 |
| 232 | 3300031852 | Ga0307410_10000659 | Ga0307410_100006597 | 107 |
| 233 | 3300031995 | Ga0307409_100002642 | Ga0307409_1000026426 | 107 |
| 234 | 3300031995 | Ga0307409_100057711 | Ga0307409_1000577113 | 107 |
| 235 | 3300032004 | Ga0307414_10000834 | Ga0307414_1000083417 | 107 |
| 236 | 3300032004 | Ga0307414_10043594 | Ga0307414_100435944 | 107 |
| 237 | 3300032005 | Ga0307411_10029068 | Ga0307411_100290683 | 107 |
| 238 | 3300032126 | Ga0307415_100048103 | Ga0307415_1000481034 | 107 |
| 239 | 3300049669 | Ga0501235_099734 | Ga0501235_099734_190_513 | 107 |
| 240 | 3300049707 | Ga0501234_049021 | Ga0501234_049021_229_552 | 107 |
| 241 | 3300025912 | Ga0207707_11170164 | Ga0207707_111701642 | 109 |
| 242 | 3300031548 | Ga0307408_100555989 | Ga0307408_1005559892 | 109 |
| 243 | 3300031731 | Ga0307405_10080849 | Ga0307405_100808493 | 109 |
| 244 | 3300031824 | Ga0307413_10213027 | Ga0307413_102130272 | 109 |
| 245 | 3300031824 | Ga0307413_10346518 | Ga0307413_103465182 | 109 |
| 246 | 3300031852 | Ga0307410_10036295 | Ga0307410_100362954 | 109 |
| 247 | 3300031852 | Ga0307410_10760270 | Ga0307410_107602702 | 109 |
| 248 | 3300031901 | Ga0307406_10011830 | Ga0307406_100118306 | 109 |
| 249 | 3300031903 | Ga0307407_10012647 | Ga0307407_100126473 | 109 |
| 250 | 3300031903 | Ga0307407_11547954 | Ga0307407_115479541 | 109 |
| 251 | 3300031911 | Ga0307412_10119569 | Ga0307412_101195693 | 109 |
| 252 | 3300031995 | Ga0307409_100258456 | Ga0307409_1002584563 | 109 |
| 253 | 3300031995 | Ga0307409_100310480 | Ga0307409_1003104802 | 109 |
| 254 | 3300031995 | Ga0307409_100930122 | Ga0307409_1009301222 | 109 |
| 255 | 3300032002 | Ga0307416_100062436 | Ga0307416_1000624363 | 109 |
| 256 | 3300032004 | Ga0307414_10029219 | Ga0307414_100292193 | 109 |
| 257 | 3300032004 | Ga0307414_10725841 | Ga0307414_107258412 | 109 |
| 258 | 3300032004 | Ga0307414_10852093 | Ga0307414_108520931 | 109 |
| 259 | 3300032004 | Ga0307414_11106830 | Ga0307414_111068301 | 109 |
| 260 | 3300032005 | Ga0307411_10086706 | Ga0307411_100867062 | 109 |
| 261 | 3300032005 | Ga0307411_10115659 | Ga0307411_101156592 | 109 |
| 262 | 3300032005 | Ga0307411_10128129 | Ga0307411_101281293 | 109 |
| 263 | 3300032005 | Ga0307411_10972160 | Ga0307411_109721602 | 109 |
| 264 | 3300032126 | Ga0307415_100080544 | Ga0307415_1000805442 | 109 |
| 265 | 3300005530 | Ga0070679_101000624 | Ga0070679_1010006241 | 118 |
| 266 | 3300025921 | Ga0207652_10699328 | Ga0207652_106993281 | 118 |
| 267 | 3300013306 | Ga0163162_10152130 | Ga0163162_101521302 | 120 |
| 268 | 3300014326 | Ga0157380_11028257 | Ga0157380_110282572 | 120 |
| 269 | 3300001990 | JGI24737J22298_10142160 | JGI24737J22298_101421602 | 129 |
| 270 | 3300005327 | Ga0070658_10372604 | Ga0070658_103726042 | 129 |
| 271 | 3300005331 | Ga0070670_100007332 | Ga0070670_1000073327 | 129 |
| 272 | 3300005344 | Ga0070661_100021438 | Ga0070661_1000214384 | 129 |
| 273 | 3300005354 | Ga0070675_100788610 | Ga0070675_1007886102 | 129 |
| 274 | 3300005356 | Ga0070674_100064148 | Ga0070674_1000641482 | 129 |
| 275 | 3300005456 | Ga0070678_100220042 | Ga0070678_1002200422 | 129 |
| 276 | 3300005457 | Ga0070662_100221315 | Ga0070662_1002213152 | 129 |
| 277 | 3300005564 | Ga0070664_100000849 | Ga0070664_1000008496 | 129 |
| 278 | 3300005577 | Ga0068857_100410519 | Ga0068857_1004105192 | 129 |
| 279 | 3300005618 | Ga0068864_100044654 | Ga0068864_1000446543 | 129 |
| 280 | 3300005840 | Ga0068870_10286955 | Ga0068870_102869552 | 129 |
| 281 | 3300025901 | Ga0207688_10013710 | Ga0207688_100137106 | 129 |
| 282 | 3300025920 | Ga0207649_10028997 | Ga0207649_100289973 | 129 |
| 283 | 3300025925 | Ga0207650_10028932 | Ga0207650_100289322 | 129 |
| 284 | 3300025926 | Ga0207659_10087267 | Ga0207659_100872672 | 129 |
| 285 | 3300025933 | Ga0207706_10004293 | Ga0207706_100042932 | 129 |
| 286 | 3300025937 | Ga0207669_10047030 | Ga0207669_100470302 | 129 |
| 287 | 3300025945 | Ga0207679_10057708 | Ga0207679_100577082 | 129 |
| 288 | 3300026095 | Ga0207676_10076710 | Ga0207676_100767103 | 129 |
| 289 | 3300026116 | Ga0207674_10522209 | Ga0207674_105222092 | 129 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar