F388946

General Info

Members Datasets Scaffolds Average Seq Length
289 135 289 108

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10142160|JGI24737J22298_101421602
Length 129
Sequence LSPGTGRVRLTLAIAARLPYLLIMSWFPSPSSPRAAFRDLVAFMRQRSREQVIGGALAFLVTAVIVIEFLVDAKTGMKPPPQITYVELYSKNRTDADIIADQKKEMAERAEWEKEKRRQFQKLEKRFGM

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
108 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
118 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
132 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
133 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.73
Rhizosphere 98.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10142160 3300001990 Unclassified 709
2 JGI24737J22298_10260008 3300001990 Bacteria 513
3 Ga0070658_10359550 3300005327 Unclassified 1247
4 Ga0070658_10372604 3300005327 Unclassified 1224
5 Ga0070658_10787592 3300005327 Bacteria 826
6 Ga0070676_10470925 3300005328 Bacteria 887
7 Ga0070670_100007332 3300005331 Bacteria 9360
8 Ga0070670_100369773 3300005331 Bacteria 1262
9 Ga0070677_10377647 3300005333 Bacteria 741
10 Ga0070660_100005031 3300005339 Bacteria 9140
11 Ga0070660_100005463 3300005339 Bacteria 8800
12 Ga0070661_100021438 3300005344 Bacteria 4615
13 Ga0070661_100029190 3300005344 Bacteria 3980
14 Ga0070661_100533858 3300005344 Bacteria 942
15 Ga0070692_10054147 3300005345 Bacteria 2094
16 Ga0070668_100291903 3300005347 Bacteria 1365
17 Ga0070675_100310348 3300005354 Unclassified 1391
18 Ga0070675_100411079 3300005354 Bacteria 1208
19 Ga0070675_100788610 3300005354 Unclassified 868
20 Ga0070671_100000254 3300005355 Bacteria 35845
21 Ga0070674_100064148 3300005356 Bacteria 2573
22 Ga0070674_100862944 3300005356 Bacteria 786
23 Ga0070673_100023746 3300005364 Bacteria 4484
24 Ga0070659_100033959 3300005366 Bacteria 3966
25 Ga0070659_100153748 3300005366 Bacteria 1878
26 Ga0070659_100571183 3300005366 Bacteria 970
27 Ga0070667_100786474 3300005367 Bacteria 883
28 Ga0070700_100536850 3300005441 Bacteria 906
29 Ga0070694_100051271 3300005444 Bacteria 2785
30 Ga0070663_100004194 3300005455 Bacteria 8428
31 Ga0070678_100004863 3300005456 Bacteria 7675
32 Ga0070678_100220042 3300005456 Bacteria 1578
33 Ga0070662_100006147 3300005457 Bacteria 7722
34 Ga0070662_100057320 3300005457 Bacteria 2831
35 Ga0070662_100112841 3300005457 Bacteria 2073
36 Ga0070662_100221315 3300005457 Bacteria 1510
37 Ga0070662_101036187 3300005457 Bacteria 703
38 Ga0070681_10474832 3300005458 Bacteria 1163
39 Ga0070681_11371056 3300005458 Bacteria 630
40 Ga0068867_100809754 3300005459 Bacteria 836
41 Ga0070706_101647910 3300005467 Bacteria 585
42 Ga0070679_100117791 3300005530 Bacteria 2641
43 Ga0070679_100576300 3300005530 Bacteria 1069
44 Ga0070679_101000624 3300005530 Unclassified 780
45 Ga0068853_100702252 3300005539 Bacteria 965
46 Ga0070672_100167628 3300005543 Bacteria 1825
47 Ga0070672_100232981 3300005543 Unclassified 1547
48 Ga0070672_100408764 3300005543 Bacteria 1164
49 Ga0070696_100000325 3300005546 Bacteria 28995
50 Ga0070693_100356292 3300005547 Bacteria 1003
51 Ga0068855_100674566 3300005563 Bacteria 1108
52 Ga0070664_100000849 3300005564 Bacteria 23590
53 Ga0070664_100035891 3300005564 Bacteria 4163
54 Ga0070664_100443543 3300005564 Bacteria 1191
55 Ga0070664_100716200 3300005564 Bacteria 933
56 Ga0068857_100410519 3300005577 Unclassified 1261
57 Ga0068854_100192703 3300005578 Bacteria 1598
58 Ga0068854_100199561 3300005578 Bacteria 1572
59 Ga0068852_102793268 3300005616 Unclassified 507
60 Ga0068859_100757047 3300005617 Bacteria 1060
61 Ga0068859_101436627 3300005617 Bacteria 761
62 Ga0068859_102077038 3300005617 Bacteria 627
63 Ga0068864_100044654 3300005618 Bacteria 3800
64 Ga0068864_100416982 3300005618 Bacteria 1279
65 Ga0068870_10286955 3300005840 Unclassified 1034
66 Ga0068863_102226450 3300005841 Unclassified 558
67 Ga0075428_100046860 3300006844 Bacteria 4748
68 Ga0075429_101103530 3300006880 Bacteria 693
69 Ga0097620_100757065 3300006931 Bacteria 1060
70 Ga0097620_101436817 3300006931 Bacteria 761
71 Ga0097620_102077080 3300006931 Bacteria 627
72 Ga0114129_11168752 3300009147 Bacteria 960
73 Ga0105243_11331125 3300009148 Bacteria 736
74 Ga0105248_10069108 3300009177 Bacteria 3966
75 Ga0105239_12179882 3300010375 Bacteria 644
76 Ga0157327_1018005 3300012512 Bacteria 765
77 Ga0157373_10265865 3300013100 Bacteria 1214
78 Ga0157373_10843436 3300013100 Bacteria 677
79 Ga0157373_10945466 3300013100 Bacteria 641
80 Ga0157371_10075602 3300013102 Bacteria 2385
81 Ga0157369_10003984 3300013105 Bacteria 17513
82 Ga0157369_12161252 3300013105 Unclassified 564
83 Ga0157378_12074008 3300013297 Bacteria 619
84 Ga0163162_10152130 3300013306 Bacteria 2432
85 Ga0157380_11028257 3300014326 Bacteria 859
86 Ga0157380_11140872 3300014326 Bacteria 820
87 Ga0207682_10123341 3300025893 Bacteria 1151
88 Ga0207682_10577393 3300025893 Bacteria 531
89 Ga0207688_10013710 3300025901 Bacteria 4407
90 Ga0207688_10086613 3300025901 Bacteria 1795
91 Ga0207688_10098283 3300025901 Bacteria 1687
92 Ga0207680_10101314 3300025903 Bacteria 1851
93 Ga0207645_10206782 3300025907 Bacteria 1292
94 Ga0207645_10494174 3300025907 Bacteria 828
95 Ga0207643_10053141 3300025908 Bacteria 2301
96 Ga0207643_10413323 3300025908 Bacteria 854
97 Ga0207705_10136917 3300025909 Bacteria 1826
98 Ga0207705_10181313 3300025909 Bacteria 1589
99 Ga0207705_10218580 3300025909 Bacteria 1447
100 Ga0207705_10431132 3300025909 Bacteria 1021
101 Ga0207705_10520876 3300025909 Bacteria 924
102 Ga0207707_10331647 3300025912 Bacteria 1313
103 Ga0207707_11170164 3300025912 Bacteria 624
104 Ga0207657_10001054 3300025919 Bacteria 29233
105 Ga0207657_10045642 3300025919 Bacteria 3843
106 Ga0207657_10162062 3300025919 Bacteria 1816
107 Ga0207657_10463915 3300025919 Bacteria 993
108 Ga0207657_11349905 3300025919 Bacteria 537
109 Ga0207649_10028997 3300025920 Bacteria 3265
110 Ga0207649_10447067 3300025920 Unclassified 975
111 Ga0207652_10198836 3300025921 Bacteria 1804
112 Ga0207652_10452562 3300025921 Bacteria 1157
113 Ga0207652_10699328 3300025921 Unclassified 905
114 Ga0207650_10028932 3300025925 Bacteria 3978
115 Ga0207659_10087267 3300025926 Bacteria 2322
116 Ga0207659_10370505 3300025926 Unclassified 1192
117 Ga0207644_10001112 3300025931 Bacteria 17264
118 Ga0207690_10453498 3300025932 Bacteria 1031
119 Ga0207690_11711479 3300025932 Bacteria 525
120 Ga0207706_10004293 3300025933 Bacteria 13391
121 Ga0207706_10013030 3300025933 Bacteria 7567
122 Ga0207706_10049781 3300025933 Bacteria 3702
123 Ga0207706_10166335 3300025933 Bacteria 1938
124 Ga0207706_10492277 3300025933 Bacteria 1059
125 Ga0207669_10047030 3300025937 Bacteria 2553
126 Ga0207691_10016539 3300025940 Bacteria 7004
127 Ga0207691_10136077 3300025940 Bacteria 2167
128 Ga0207691_10403908 3300025940 Bacteria 1165
129 Ga0207679_10057708 3300025945 Bacteria 2873
130 Ga0207679_10284288 3300025945 Bacteria 1420
131 Ga0207679_10419463 3300025945 Unclassified 1181
132 Ga0207679_10723363 3300025945 Bacteria 904
133 Ga0207667_10672242 3300025949 Bacteria 1040
134 Ga0207651_10183536 3300025960 Unclassified 1662
135 Ga0207668_10334561 3300025972 Bacteria 1261
136 Ga0207668_11161145 3300025972 Bacteria 693
137 Ga0207640_10432651 3300025981 Bacteria 1080
138 Ga0207639_10497653 3300026041 Bacteria 1113
139 Ga0207639_11335809 3300026041 Bacteria 673
140 Ga0207678_10002797 3300026067 Bacteria 15835
141 Ga0207678_10328958 3300026067 Bacteria 1315
142 Ga0207708_10429533 3300026075 Unclassified 1097
143 Ga0207648_10674987 3300026089 Bacteria 956
144 Ga0207648_11249428 3300026089 Unclassified 698
145 Ga0207676_10076710 3300026095 Bacteria 2701
146 Ga0207674_10016335 3300026116 Bacteria 8131
147 Ga0207674_10522209 3300026116 Unclassified 1147
148 Ga0207683_10002394 3300026121 Bacteria 16388
149 Ga0209973_1057426 3300027252 Bacteria 594
150 Ga0268265_10945746 3300028380 Bacteria 849
151 Ga0307408_100079962 3300031548 Bacteria 2441
152 Ga0307408_100555989 3300031548 Unclassified 1013
153 Ga0307408_100831131 3300031548 Bacteria 841
154 Ga0307405_10080849 3300031731 Bacteria 2122
155 Ga0307405_10233772 3300031731 Bacteria 1357
156 Ga0307413_10078079 3300031824 Bacteria 2111
157 Ga0307413_10213027 3300031824 Unclassified 1405
158 Ga0307413_10346518 3300031824 Bacteria 1144
159 Ga0307410_10000659 3300031852 Bacteria 14273
160 Ga0307410_10036295 3300031852 Bacteria 3208
161 Ga0307410_10142368 3300031852 Bacteria 1776
162 Ga0307410_10760270 3300031852 Bacteria 821
163 Ga0307406_10011830 3300031901 Bacteria 4958
164 Ga0307406_10148446 3300031901 Bacteria 1669
165 Ga0307406_10219516 3300031901 Bacteria 1412
166 Ga0307406_10221538 3300031901 Bacteria 1406
167 Ga0307406_10408109 3300031901 Unclassified 1079
168 Ga0307406_11263503 3300031901 Bacteria 643
169 Ga0307407_10012647 3300031903 Bacteria 4064
170 Ga0307407_11547954 3300031903 Bacteria 525
171 Ga0307412_10119569 3300031911 Bacteria 1894
172 Ga0307412_10296504 3300031911 Unclassified 1276
173 Ga0307412_10308884 3300031911 Bacteria 1253
174 Ga0307409_100002642 3300031995 Bacteria 9432
175 Ga0307409_100008461 3300031995 Bacteria 6248
176 Ga0307409_100057711 3300031995 Bacteria 3010
177 Ga0307409_100083175 3300031995 Unclassified 2594
178 Ga0307409_100258456 3300031995 Bacteria 1596
179 Ga0307409_100310480 3300031995 Bacteria 1471
180 Ga0307409_100438267 3300031995 Bacteria 1258
181 Ga0307409_100930122 3300031995 Bacteria 884
182 Ga0307409_100947571 3300031995 Bacteria 877
183 Ga0307416_100017701 3300032002 Bacteria 4995
184 Ga0307416_100062436 3300032002 Bacteria 3046
185 Ga0307416_102498456 3300032002 Bacteria 615
186 Ga0307416_103131651 3300032002 Bacteria 553
187 Ga0307416_103840347 3300032002 Bacteria 503
188 Ga0307414_10000834 3300032004 Bacteria 15720
189 Ga0307414_10029219 3300032004 Bacteria 3585
190 Ga0307414_10043594 3300032004 Bacteria 3058
191 Ga0307414_10071010 3300032004 Bacteria 2510
192 Ga0307414_10196637 3300032004 Bacteria 1636
193 Ga0307414_10725841 3300032004 Unclassified 901
194 Ga0307414_10852093 3300032004 Unclassified 833
195 Ga0307414_11106830 3300032004 Bacteria 731
196 Ga0307411_10029068 3300032005 Bacteria 3370
197 Ga0307411_10086706 3300032005 Bacteria 2172
198 Ga0307411_10115659 3300032005 Bacteria 1929
199 Ga0307411_10128129 3300032005 Bacteria 1850
200 Ga0307411_10426246 3300032005 Bacteria 1103
201 Ga0307411_10699810 3300032005 Bacteria 883
202 Ga0307411_10972160 3300032005 Bacteria 758
203 Ga0307411_11342130 3300032005 Bacteria 653
204 Ga0307415_100009174 3300032126 Bacteria 5526
205 Ga0307415_100048103 3300032126 Bacteria 2876
206 Ga0307415_100080544 3300032126 Bacteria 2323
207 Ga0307415_100239327 3300032126 Bacteria 1467
208 Ga0307415_100288729 3300032126 Bacteria 1353
209 Ga0307415_101970204 3300032126 Bacteria 568
210 Ga0307415_102187208 3300032126 Bacteria 541
211 Ga0373936_0093082 3300035113 Bacteria 1265
212 Ga0373943_0002312 3300035170 Bacteria 8661
213 Ga0373946_0021864 3300035171 Bacteria 2484
214 Ga0373935_0043735 3300035692 Bacteria 2820
215 Ga0373927_0215422 3300035695 Bacteria 1261
216 Ga0373947_0292693 3300035725 Bacteria 1084
217 Ga0373925_0032700 3300037068 Bacteria 3829
218 Ga0395899_0000129 3300037312 Bacteria 118043
219 Ga0395899_0108619 3300037312 Bacteria 1996
220 Ga0395899_0108750 3300037312 Bacteria 1995
221 Ga0395899_0110261 3300037312 Bacteria 1979
222 Ga0395899_0187783 3300037312 Bacteria 1447
223 Ga0395900_0002105 3300037418 Bacteria 22295
224 Ga0395900_0016179 3300037418 Bacteria 7598
225 Ga0395900_0041217 3300037418 Bacteria 4760
226 Ga0395900_0227475 3300037418 Bacteria 1878
227 Ga0395900_0249792 3300037418 Bacteria 1775
228 Ga0395900_0250039 3300037418 Bacteria 1774
229 Ga0395900_0269860 3300037418 Bacteria 1696
230 Ga0395900_0382771 3300037418 Bacteria 1374
231 Ga0395898_0002720 3300037466 Bacteria 20390
232 Ga0395898_0020543 3300037466 Bacteria 6707
233 Ga0395898_0031011 3300037466 Bacteria 5346
234 Ga0395898_0160885 3300037466 Bacteria 2147
235 Ga0395898_0181874 3300037466 Bacteria 2009
236 Ga0395905_0001572 3300037471 Bacteria 27278
237 Ga0395905_0003151 3300037471 Bacteria 17763
238 Ga0395905_0009946 3300037471 Bacteria 9268
239 Ga0395905_0058041 3300037471 Bacteria 3619
240 Ga0395905_0090581 3300037471 Bacteria 2867
241 Ga0395905_0380304 3300037471 Unclassified 1306
242 Ga0395905_0419381 3300037471 Bacteria 1234
243 Ga0395905_0958765 3300037471 Bacteria 758
244 Ga0395905_1436539 3300037471 Bacteria 594
245 Ga0395905_1447467 3300037471 Bacteria 591
246 Ga0395901_0001239 3300038443 Bacteria 27244
247 Ga0395901_0004628 3300038443 Bacteria 13884
248 Ga0395901_0030409 3300038443 Bacteria 5563
249 Ga0395901_0126937 3300038443 Bacteria 2680
250 Ga0395901_0137303 3300038443 Bacteria 2569
251 Ga0395901_0397717 3300038443 Bacteria 1416
252 Ga0395901_0404317 3300038443 Bacteria 1402
253 Ga0395901_0614782 3300038443 Bacteria 1094
254 Ga0395901_0692566 3300038443 Bacteria 1018
255 Ga0395901_1589193 3300038443 Unclassified 607
256 Ga0450891_004530 3300042129 Bacteria 1297
257 Ga0466969_0033732 3300044656 Bacteria 2597
258 Ga0466966_0067711 3300044684 Bacteria 2242
259 Ga0466966_0072901 3300044684 Unclassified 2149
260 Ga0466971_0672451 3300044719 Bacteria 519
261 Ga0466957_0393176 3300044842 Unclassified 947
262 Ga0466960_0083778 3300044901 Bacteria 1612
263 Ga0466959_0193346 3300045049 Unclassified 1419
264 Ga0466958_0032362 3300045836 Bacteria 3111
265 Ga0466967_0522677 3300045976 Bacteria 1166
266 Ga0466967_0607955 3300045976 Bacteria 1079
267 Ga0466967_1469134 3300045976 Unclassified 679
268 Ga0495585_0127964 3300046492 Bacteria 1339
269 Ga0495663_0035792 3300046525 Bacteria 1492
270 Ga0495642_0095932 3300046528 Bacteria 1259
271 Ga0495665_0384652 3300046531 Bacteria 713
272 Ga0495633_0142536 3300046558 Bacteria 1108
273 Ga0495669_0392120 3300046684 Bacteria 672
274 Ga0495669_0541566 3300046684 Bacteria 566
275 Ga0495677_0032169 3300047445 Bacteria 1910
276 Ga0495677_0261867 3300047445 Bacteria 677
277 Ga0496101_0781705 3300048904 Bacteria 753
278 Ga0496102_1647622 3300048905 Bacteria 560
279 Ga0496109_0622130 3300048912 Bacteria 1016
280 Ga0496110_0846499 3300048913 Bacteria 820
281 Ga0496111_0258621 3300048914 Bacteria 1292
282 Ga0501067_0061384 3300049583 Bacteria 2081
283 Ga0501068_0073014 3300049584 Bacteria 2096
284 Ga0501069_0298047 3300049585 Bacteria 945
285 Ga0501223_100389 3300049663 Bacteria 596
286 Ga0501235_099734 3300049669 Bacteria 708
287 Ga0501234_049021 3300049707 Bacteria 701
288 nmdc:mga09592_247214_c1 3300050508 Bacteria 1546
289 Ga0590071_074189 3300059421 Bacteria 841

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001990 JGI24737J22298_10260008 JGI24737J22298_102600082 106
2 3300005327 Ga0070658_10359550 Ga0070658_103595501 106
3 3300005327 Ga0070658_10787592 Ga0070658_107875921 106
4 3300005328 Ga0070676_10470925 Ga0070676_104709252 106
5 3300005331 Ga0070670_100369773 Ga0070670_1003697732 106
6 3300005333 Ga0070677_10377647 Ga0070677_103776472 106
7 3300005339 Ga0070660_100005031 Ga0070660_1000050314 106
8 3300005339 Ga0070660_100005463 Ga0070660_1000054638 106
9 3300005344 Ga0070661_100029190 Ga0070661_1000291905 106
10 3300005344 Ga0070661_100533858 Ga0070661_1005338582 106
11 3300005345 Ga0070692_10054147 Ga0070692_100541472 106
12 3300005347 Ga0070668_100291903 Ga0070668_1002919032 106
13 3300005354 Ga0070675_100411079 Ga0070675_1004110793 106
14 3300005355 Ga0070671_100000254 Ga0070671_10000025431 106
15 3300005356 Ga0070674_100862944 Ga0070674_1008629442 106
16 3300005364 Ga0070673_100023746 Ga0070673_1000237465 106
17 3300005366 Ga0070659_100033959 Ga0070659_1000339593 106
18 3300005366 Ga0070659_100153748 Ga0070659_1001537482 106
19 3300005366 Ga0070659_100571183 Ga0070659_1005711832 106
20 3300005367 Ga0070667_100786474 Ga0070667_1007864741 106
21 3300005444 Ga0070694_100051271 Ga0070694_1000512712 106
22 3300005455 Ga0070663_100004194 Ga0070663_1000041943 106
23 3300005456 Ga0070678_100004863 Ga0070678_1000048634 106
24 3300005457 Ga0070662_100006147 Ga0070662_1000061472 106
25 3300005457 Ga0070662_100112841 Ga0070662_1001128414 106
26 3300005457 Ga0070662_101036187 Ga0070662_1010361872 106
27 3300005458 Ga0070681_10474832 Ga0070681_104748322 106
28 3300005458 Ga0070681_11371056 Ga0070681_113710561 106
29 3300005459 Ga0068867_100809754 Ga0068867_1008097542 106
30 3300005467 Ga0070706_101647910 Ga0070706_1016479101 106
31 3300005530 Ga0070679_100117791 Ga0070679_1001177912 106
32 3300005530 Ga0070679_100576300 Ga0070679_1005763002 106
33 3300005539 Ga0068853_100702252 Ga0068853_1007022521 106
34 3300005543 Ga0070672_100167628 Ga0070672_1001676282 106
35 3300005543 Ga0070672_100232981 Ga0070672_1002329812 106
36 3300005546 Ga0070696_100000325 Ga0070696_10000032519 106
37 3300005547 Ga0070693_100356292 Ga0070693_1003562922 106
38 3300005563 Ga0068855_100674566 Ga0068855_1006745661 106
39 3300005564 Ga0070664_100035891 Ga0070664_1000358913 106
40 3300005564 Ga0070664_100443543 Ga0070664_1004435432 106
41 3300005564 Ga0070664_100716200 Ga0070664_1007162002 106
42 3300005578 Ga0068854_100192703 Ga0068854_1001927032 106
43 3300005578 Ga0068854_100199561 Ga0068854_1001995612 106
44 3300005616 Ga0068852_102793268 Ga0068852_1027932682 106
45 3300005617 Ga0068859_100757047 Ga0068859_1007570472 106
46 3300005617 Ga0068859_101436627 Ga0068859_1014366271 106
47 3300005617 Ga0068859_102077038 Ga0068859_1020770382 106
48 3300005618 Ga0068864_100416982 Ga0068864_1004169822 106
49 3300005841 Ga0068863_102226450 Ga0068863_1022264502 106
50 3300006844 Ga0075428_100046860 Ga0075428_1000468603 106
51 3300006880 Ga0075429_101103530 Ga0075429_1011035302 106
52 3300006931 Ga0097620_100757065 Ga0097620_1007570652 106
53 3300006931 Ga0097620_101436817 Ga0097620_1014368172 106
54 3300006931 Ga0097620_102077080 Ga0097620_1020770802 106
55 3300009147 Ga0114129_11168752 Ga0114129_111687522 106
56 3300009148 Ga0105243_11331125 Ga0105243_113311252 106
57 3300009177 Ga0105248_10069108 Ga0105248_100691086 106
58 3300010375 Ga0105239_12179882 Ga0105239_121798822 106
59 3300012512 Ga0157327_1018005 Ga0157327_10180051 106
60 3300013100 Ga0157373_10265865 Ga0157373_102658652 106
61 3300013100 Ga0157373_10843436 Ga0157373_108434362 106
62 3300013100 Ga0157373_10945466 Ga0157373_109454662 106
63 3300013102 Ga0157371_10075602 Ga0157371_100756022 106
64 3300013105 Ga0157369_10003984 Ga0157369_100039848 106
65 3300013105 Ga0157369_12161252 Ga0157369_121612522 106
66 3300013297 Ga0157378_12074008 Ga0157378_120740082 106
67 3300025893 Ga0207682_10123341 Ga0207682_101233412 106
68 3300025893 Ga0207682_10577393 Ga0207682_105773931 106
69 3300025901 Ga0207688_10098283 Ga0207688_100982833 106
70 3300025903 Ga0207680_10101314 Ga0207680_101013143 106
71 3300025907 Ga0207645_10206782 Ga0207645_102067822 106
72 3300025907 Ga0207645_10494174 Ga0207645_104941742 106
73 3300025908 Ga0207643_10053141 Ga0207643_100531412 106
74 3300025908 Ga0207643_10413323 Ga0207643_104133232 106
75 3300025909 Ga0207705_10136917 Ga0207705_101369172 106
76 3300025909 Ga0207705_10181313 Ga0207705_101813132 106
77 3300025909 Ga0207705_10218580 Ga0207705_102185802 106
78 3300025909 Ga0207705_10431132 Ga0207705_104311321 106
79 3300025909 Ga0207705_10520876 Ga0207705_105208762 106
80 3300025912 Ga0207707_10331647 Ga0207707_103316472 106
81 3300025919 Ga0207657_10001054 Ga0207657_1000105423 106
82 3300025919 Ga0207657_10045642 Ga0207657_100456424 106
83 3300025919 Ga0207657_10162062 Ga0207657_101620622 106
84 3300025919 Ga0207657_10463915 Ga0207657_104639152 106
85 3300025919 Ga0207657_11349905 Ga0207657_113499051 106
86 3300025920 Ga0207649_10447067 Ga0207649_104470672 106
87 3300025921 Ga0207652_10198836 Ga0207652_101988362 106
88 3300025921 Ga0207652_10452562 Ga0207652_104525622 106
89 3300025931 Ga0207644_10001112 Ga0207644_1000111210 106
90 3300025932 Ga0207690_10453498 Ga0207690_104534982 106
91 3300025932 Ga0207690_11711479 Ga0207690_117114791 106
92 3300025933 Ga0207706_10013030 Ga0207706_100130303 106
93 3300025933 Ga0207706_10049781 Ga0207706_100497813 106
94 3300025933 Ga0207706_10492277 Ga0207706_104922772 106
95 3300025940 Ga0207691_10016539 Ga0207691_100165396 106
96 3300025940 Ga0207691_10136077 Ga0207691_101360774 106
97 3300025945 Ga0207679_10284288 Ga0207679_102842881 106
98 3300025945 Ga0207679_10419463 Ga0207679_104194632 106
99 3300025945 Ga0207679_10723363 Ga0207679_107233632 106
100 3300025949 Ga0207667_10672242 Ga0207667_106722421 106
101 3300025960 Ga0207651_10183536 Ga0207651_101835362 106
102 3300025972 Ga0207668_10334561 Ga0207668_103345612 106
103 3300025972 Ga0207668_11161145 Ga0207668_111611452 106
104 3300025981 Ga0207640_10432651 Ga0207640_104326512 106
105 3300026041 Ga0207639_10497653 Ga0207639_104976532 106
106 3300026041 Ga0207639_11335809 Ga0207639_113358092 106
107 3300026067 Ga0207678_10002797 Ga0207678_100027978 106
108 3300026067 Ga0207678_10328958 Ga0207678_103289582 106
109 3300026075 Ga0207708_10429533 Ga0207708_104295331 106
110 3300026089 Ga0207648_10674987 Ga0207648_106749872 106
111 3300026089 Ga0207648_11249428 Ga0207648_112494282 106
112 3300026116 Ga0207674_10016335 Ga0207674_100163355 106
113 3300026121 Ga0207683_10002394 Ga0207683_1000239412 106
114 3300027252 Ga0209973_1057426 Ga0209973_10574262 106
115 3300028380 Ga0268265_10945746 Ga0268265_109457462 106
116 3300031548 Ga0307408_100079962 Ga0307408_1000799622 106
117 3300031548 Ga0307408_100831131 Ga0307408_1008311312 106
118 3300031731 Ga0307405_10233772 Ga0307405_102337721 106
119 3300031824 Ga0307413_10078079 Ga0307413_100780793 106
120 3300031852 Ga0307410_10142368 Ga0307410_101423682 106
121 3300031901 Ga0307406_10148446 Ga0307406_101484462 106
122 3300031901 Ga0307406_10219516 Ga0307406_102195163 106
123 3300031901 Ga0307406_10221538 Ga0307406_102215382 106
124 3300031901 Ga0307406_10408109 Ga0307406_104081092 106
125 3300031901 Ga0307406_11263503 Ga0307406_112635031 106
126 3300031911 Ga0307412_10296504 Ga0307412_102965042 106
127 3300031911 Ga0307412_10308884 Ga0307412_103088842 106
128 3300031995 Ga0307409_100008461 Ga0307409_1000084618 106
129 3300031995 Ga0307409_100083175 Ga0307409_1000831754 106
130 3300031995 Ga0307409_100438267 Ga0307409_1004382672 106
131 3300031995 Ga0307409_100947571 Ga0307409_1009475712 106
132 3300032002 Ga0307416_100017701 Ga0307416_1000177014 106
133 3300032002 Ga0307416_102498456 Ga0307416_1024984562 106
134 3300032002 Ga0307416_103131651 Ga0307416_1031316511 106
135 3300032002 Ga0307416_103840347 Ga0307416_1038403471 106
136 3300032004 Ga0307414_10071010 Ga0307414_100710102 106
137 3300032004 Ga0307414_10196637 Ga0307414_101966372 106
138 3300032005 Ga0307411_10426246 Ga0307411_104262462 106
139 3300032005 Ga0307411_10699810 Ga0307411_106998102 106
140 3300032005 Ga0307411_11342130 Ga0307411_113421302 106
141 3300032126 Ga0307415_100009174 Ga0307415_1000091744 106
142 3300032126 Ga0307415_100239327 Ga0307415_1002393272 106
143 3300032126 Ga0307415_100288729 Ga0307415_1002887292 106
144 3300032126 Ga0307415_101970204 Ga0307415_1019702042 106
145 3300032126 Ga0307415_102187208 Ga0307415_1021872081 106
146 3300035113 Ga0373936_0093082 Ga0373936_0093082_289_609 106
147 3300035170 Ga0373943_0002312 Ga0373943_0002312_4305_4625 106
148 3300035171 Ga0373946_0021864 Ga0373946_0021864_939_1259 106
149 3300035692 Ga0373935_0043735 Ga0373935_0043735_1768_2088 106
150 3300035695 Ga0373927_0215422 Ga0373927_0215422_410_730 106
151 3300035725 Ga0373947_0292693 Ga0373947_0292693_621_941 106
152 3300037068 Ga0373925_0032700 Ga0373925_0032700_2800_3120 106
153 3300037312 Ga0395899_0000129 Ga0395899_0000129_56525_56848 106
154 3300037312 Ga0395899_0108619 Ga0395899_0108619_514_834 106
155 3300037312 Ga0395899_0108750 Ga0395899_0108750_633_953 106
156 3300037312 Ga0395899_0110261 Ga0395899_0110261_35_358 106
157 3300037312 Ga0395899_0187783 Ga0395899_0187783_571_894 106
158 3300037418 Ga0395900_0002105 Ga0395900_0002105_4299_4622 106
159 3300037418 Ga0395900_0016179 Ga0395900_0016179_3679_4002 106
160 3300037418 Ga0395900_0041217 Ga0395900_0041217_732_1052 106
161 3300037418 Ga0395900_0227475 Ga0395900_0227475_1059_1379 106
162 3300037418 Ga0395900_0249792 Ga0395900_0249792_951_1271 106
163 3300037418 Ga0395900_0250039 Ga0395900_0250039_1024_1344 106
164 3300037418 Ga0395900_0269860 Ga0395900_0269860_302_625 106
165 3300037418 Ga0395900_0382771 Ga0395900_0382771_630_953 106
166 3300037466 Ga0395898_0002720 Ga0395898_0002720_7062_7382 106
167 3300037466 Ga0395898_0020543 Ga0395898_0020543_3370_3693 106
168 3300037466 Ga0395898_0031011 Ga0395898_0031011_3414_3737 106
169 3300037466 Ga0395898_0160885 Ga0395898_0160885_800_1120 106
170 3300037466 Ga0395898_0181874 Ga0395898_0181874_93_416 106
171 3300037471 Ga0395905_0001572 Ga0395905_0001572_22346_22666 106
172 3300037471 Ga0395905_0003151 Ga0395905_0003151_5647_5967 106
173 3300037471 Ga0395905_0009946 Ga0395905_0009946_7311_7631 106
174 3300037471 Ga0395905_0058041 Ga0395905_0058041_2723_3043 106
175 3300037471 Ga0395905_0090581 Ga0395905_0090581_1570_1893 106
176 3300037471 Ga0395905_0380304 Ga0395905_0380304_357_677 106
177 3300037471 Ga0395905_0419381 Ga0395905_0419381_618_941 106
178 3300037471 Ga0395905_0958765 Ga0395905_0958765_15_335 106
179 3300037471 Ga0395905_1436539 Ga0395905_1436539_219_539 106
180 3300037471 Ga0395905_1447467 Ga0395905_1447467_159_482 106
181 3300038443 Ga0395901_0001239 Ga0395901_0001239_18173_18496 106
182 3300038443 Ga0395901_0004628 Ga0395901_0004628_8570_8890 106
183 3300038443 Ga0395901_0030409 Ga0395901_0030409_1989_2309 106
184 3300038443 Ga0395901_0126937 Ga0395901_0126937_260_583 106
185 3300038443 Ga0395901_0137303 Ga0395901_0137303_1947_2267 106
186 3300038443 Ga0395901_0397717 Ga0395901_0397717_1044_1364 106
187 3300038443 Ga0395901_0404317 Ga0395901_0404317_658_981 106
188 3300038443 Ga0395901_0614782 Ga0395901_0614782_740_1060 106
189 3300038443 Ga0395901_0692566 Ga0395901_0692566_625_948 106
190 3300038443 Ga0395901_1589193 Ga0395901_1589193_265_588 106
191 3300042129 Ga0450891_004530 Ga0450891_004530_872_1192 106
192 3300044656 Ga0466969_0033732 Ga0466969_0033732_2031_2351 106
193 3300044684 Ga0466966_0067711 Ga0466966_0067711_1311_1631 106
194 3300044684 Ga0466966_0072901 Ga0466966_0072901_1152_1472 106
195 3300044719 Ga0466971_0672451 Ga0466971_0672451_110_433 106
196 3300044842 Ga0466957_0393176 Ga0466957_0393176_176_499 106
197 3300044901 Ga0466960_0083778 Ga0466960_0083778_427_747 106
198 3300045049 Ga0466959_0193346 Ga0466959_0193346_617_937 106
199 3300045836 Ga0466958_0032362 Ga0466958_0032362_2580_2903 106
200 3300045976 Ga0466967_0522677 Ga0466967_0522677_126_449 106
201 3300045976 Ga0466967_0607955 Ga0466967_0607955_686_1006 106
202 3300045976 Ga0466967_1469134 Ga0466967_1469134_78_401 106
203 3300046492 Ga0495585_0127964 Ga0495585_0127964_660_980 106
204 3300046525 Ga0495663_0035792 Ga0495663_0035792_399_719 106
205 3300046528 Ga0495642_0095932 Ga0495642_0095932_918_1238 106
206 3300046531 Ga0495665_0384652 Ga0495665_0384652_383_703 106
207 3300046558 Ga0495633_0142536 Ga0495633_0142536_25_345 106
208 3300046684 Ga0495669_0392120 Ga0495669_0392120_159_479 106
209 3300046684 Ga0495669_0541566 Ga0495669_0541566_136_456 106
210 3300047445 Ga0495677_0032169 Ga0495677_0032169_160_480 106
211 3300047445 Ga0495677_0261867 Ga0495677_0261867_238_558 106
212 3300048904 Ga0496101_0781705 Ga0496101_0781705_50_370 106
213 3300048905 Ga0496102_1647622 Ga0496102_1647622_46_366 106
214 3300048912 Ga0496109_0622130 Ga0496109_0622130_527_847 106
215 3300048913 Ga0496110_0846499 Ga0496110_0846499_56_376 106
216 3300048914 Ga0496111_0258621 Ga0496111_0258621_634_954 106
217 3300049583 Ga0501067_0061384 Ga0501067_0061384_354_674 106
218 3300049584 Ga0501068_0073014 Ga0501068_0073014_1701_2021 106
219 3300049585 Ga0501069_0298047 Ga0501069_0298047_428_748 106
220 3300049663 Ga0501223_100389 Ga0501223_100389_217_537 106
221 3300050508 nmdc:mga09592_247214_c1 nmdc:mga09592_247214_c1_782_1102 106
222 3300059421 Ga0590071_074189 Ga0590071_074189_119_439 106
223 3300005354 Ga0070675_100310348 Ga0070675_1003103482 107
224 3300005441 Ga0070700_100536850 Ga0070700_1005368502 107
225 3300005457 Ga0070662_100057320 Ga0070662_1000573204 107
226 3300005543 Ga0070672_100408764 Ga0070672_1004087642 107
227 3300014326 Ga0157380_11140872 Ga0157380_111408722 107
228 3300025901 Ga0207688_10086613 Ga0207688_100866132 107
229 3300025926 Ga0207659_10370505 Ga0207659_103705051 107
230 3300025933 Ga0207706_10166335 Ga0207706_101663353 107
231 3300025940 Ga0207691_10403908 Ga0207691_104039082 107
232 3300031852 Ga0307410_10000659 Ga0307410_100006597 107
233 3300031995 Ga0307409_100002642 Ga0307409_1000026426 107
234 3300031995 Ga0307409_100057711 Ga0307409_1000577113 107
235 3300032004 Ga0307414_10000834 Ga0307414_1000083417 107
236 3300032004 Ga0307414_10043594 Ga0307414_100435944 107
237 3300032005 Ga0307411_10029068 Ga0307411_100290683 107
238 3300032126 Ga0307415_100048103 Ga0307415_1000481034 107
239 3300049669 Ga0501235_099734 Ga0501235_099734_190_513 107
240 3300049707 Ga0501234_049021 Ga0501234_049021_229_552 107
241 3300025912 Ga0207707_11170164 Ga0207707_111701642 109
242 3300031548 Ga0307408_100555989 Ga0307408_1005559892 109
243 3300031731 Ga0307405_10080849 Ga0307405_100808493 109
244 3300031824 Ga0307413_10213027 Ga0307413_102130272 109
245 3300031824 Ga0307413_10346518 Ga0307413_103465182 109
246 3300031852 Ga0307410_10036295 Ga0307410_100362954 109
247 3300031852 Ga0307410_10760270 Ga0307410_107602702 109
248 3300031901 Ga0307406_10011830 Ga0307406_100118306 109
249 3300031903 Ga0307407_10012647 Ga0307407_100126473 109
250 3300031903 Ga0307407_11547954 Ga0307407_115479541 109
251 3300031911 Ga0307412_10119569 Ga0307412_101195693 109
252 3300031995 Ga0307409_100258456 Ga0307409_1002584563 109
253 3300031995 Ga0307409_100310480 Ga0307409_1003104802 109
254 3300031995 Ga0307409_100930122 Ga0307409_1009301222 109
255 3300032002 Ga0307416_100062436 Ga0307416_1000624363 109
256 3300032004 Ga0307414_10029219 Ga0307414_100292193 109
257 3300032004 Ga0307414_10725841 Ga0307414_107258412 109
258 3300032004 Ga0307414_10852093 Ga0307414_108520931 109
259 3300032004 Ga0307414_11106830 Ga0307414_111068301 109
260 3300032005 Ga0307411_10086706 Ga0307411_100867062 109
261 3300032005 Ga0307411_10115659 Ga0307411_101156592 109
262 3300032005 Ga0307411_10128129 Ga0307411_101281293 109
263 3300032005 Ga0307411_10972160 Ga0307411_109721602 109
264 3300032126 Ga0307415_100080544 Ga0307415_1000805442 109
265 3300005530 Ga0070679_101000624 Ga0070679_1010006241 118
266 3300025921 Ga0207652_10699328 Ga0207652_106993281 118
267 3300013306 Ga0163162_10152130 Ga0163162_101521302 120
268 3300014326 Ga0157380_11028257 Ga0157380_110282572 120
269 3300001990 JGI24737J22298_10142160 JGI24737J22298_101421602 129
270 3300005327 Ga0070658_10372604 Ga0070658_103726042 129
271 3300005331 Ga0070670_100007332 Ga0070670_1000073327 129
272 3300005344 Ga0070661_100021438 Ga0070661_1000214384 129
273 3300005354 Ga0070675_100788610 Ga0070675_1007886102 129
274 3300005356 Ga0070674_100064148 Ga0070674_1000641482 129
275 3300005456 Ga0070678_100220042 Ga0070678_1002200422 129
276 3300005457 Ga0070662_100221315 Ga0070662_1002213152 129
277 3300005564 Ga0070664_100000849 Ga0070664_1000008496 129
278 3300005577 Ga0068857_100410519 Ga0068857_1004105192 129
279 3300005618 Ga0068864_100044654 Ga0068864_1000446543 129
280 3300005840 Ga0068870_10286955 Ga0068870_102869552 129
281 3300025901 Ga0207688_10013710 Ga0207688_100137106 129
282 3300025920 Ga0207649_10028997 Ga0207649_100289973 129
283 3300025925 Ga0207650_10028932 Ga0207650_100289322 129
284 3300025926 Ga0207659_10087267 Ga0207659_100872672 129
285 3300025933 Ga0207706_10004293 Ga0207706_100042932 129
286 3300025937 Ga0207669_10047030 Ga0207669_100470302 129
287 3300025945 Ga0207679_10057708 Ga0207679_100577082 129
288 3300026095 Ga0207676_10076710 Ga0207676_100767103 129
289 3300026116 Ga0207674_10522209 Ga0207674_105222092 129

Feature Viewer

pLDDT pTM Quality
62.5 0.24 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map