F388885

General Info

Members Datasets Scaffolds Average Seq Length
288 228 268 244

Family's Representative Sequence

Representative Sequence 3300053094|Ga0500566_0000456|Ga0500566_0000456_10155_11048
Length 297
Sequence MELFFILEFRRSDWNSTLILQFRFRLTVAVKLQQFALTLIQRRHGLGAVMTNWIREIMKKLLLITASLVAISAAAPASAADLAARPYTKAPPMMAAIYDWSGFYIGINGGGATSRNSWDLVGGGPEGKHDSTGGTVGGQIGYRWQTGPVVFGVEAQGNWADFSGSNRSLIFNESNRTKIDAFGLFTGQIGYAWNNVLLYAKGGAAVTDNKYEINALGGGLLASTSDTRWGAVVGAGLEYGFAPNWSLGFEYDHMFMDRQNVNFVATTFTQTDSIKQDVDLFTARLNYKFGGPVIGKY

Samples

Sample ID Description Type Environment
1 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
2 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
3 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
4 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
5 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
6 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
7 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
8 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
9 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
10 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
11 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
12 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
13 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
14 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
15 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
16 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
17 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
18 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
19 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
59 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
79 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
80 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
81 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
113 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
114 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
119 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
122 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
123 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
124 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
209 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
210 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
211 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
212 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
213 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
216 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
217 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
218 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
219 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
220 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
221 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
222 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
223 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.28
Metatranscriptomes 2.78
Isolates 6.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.54
Nodule 7.99
Rhizoplane 1.39
Rhizosphere 66.32
Stem 0
Stem Tuber 0
Unclassified 10.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1008189 3300003214 Bacteria 1661
2 JGI25153J46596_10001335 3300003215 Bacteria 14754
3 rootH1_10024964 3300003323 Bacteria 1808
4 JGI25160J50197_1002176 3300003354 Bacteria 9255
5 Ga0070683_100052863 3300005329 Bacteria 3764
6 Ga0070683_100054242 3300005329 Bacteria 3717
7 Ga0070666_10131642 3300005335 Bacteria 1738
8 Ga0070682_100284360 3300005337 Bacteria 1207
9 Ga0070668_100054352 3300005347 Bacteria 3089
10 Ga0070709_10077064 3300005434 Bacteria 2166
11 Ga0070709_10101171 3300005434 Bacteria 1920
12 Ga0070714_100402900 3300005435 Bacteria 1293
13 Ga0070713_100117165 3300005436 Bacteria 2330
14 Ga0070713_100443623 3300005436 Bacteria 1218
15 Ga0070701_10197398 3300005438 Bacteria 1187
16 Ga0070711_100323741 3300005439 Bacteria 1232
17 Ga0070663_100208020 3300005455 Bacteria 1531
18 Ga0070678_100152661 3300005456 Bacteria 1862
19 Ga0070662_100805991 3300005457 Bacteria 798
20 Ga0070681_10019424 3300005458 Bacteria 6801
21 Ga0070685_10077389 3300005466 Bacteria 1986
22 Ga0070706_100079088 3300005467 Bacteria 3043
23 Ga0070684_100003271 3300005535 Bacteria 12133
24 Ga0070684_100005821 3300005535 Bacteria 9484
25 Ga0068853_100169165 3300005539 Bacteria 1976
26 Ga0070665_100005586 3300005548 Bacteria 12931
27 Ga0070665_100028856 3300005548 Bacteria 5585
28 Ga0070665_100033577 3300005548 Bacteria 5163
29 Ga0070665_100056874 3300005548 Bacteria 3922
30 Ga0070665_100156159 3300005548 Bacteria 2283
31 Ga0068857_100028837 3300005577 Bacteria 4897
32 Ga0068854_100031536 3300005578 Bacteria 3684
33 Ga0068856_100060886 3300005614 Bacteria 3729
34 Ga0070702_100287072 3300005615 Bacteria 1132
35 Ga0068859_100042873 3300005617 Bacteria 4546
36 Ga0068859_100087304 3300005617 Bacteria 3167
37 Ga0068861_100061877 3300005719 Bacteria 2874
38 Ga0068863_100064614 3300005841 Bacteria 3461
39 Ga0068858_100183225 3300005842 Bacteria 1978
40 Ga0068858_100637912 3300005842 Bacteria 1035
41 Ga0068860_100189688 3300005843 Bacteria 1989
42 Ga0068860_100212104 3300005843 Bacteria 1878
43 Ga0068862_100071725 3300005844 Bacteria 2991
44 Ga0070717_10248162 3300006028 Bacteria 1572
45 Ga0075369_10039682 3300006186 Bacteria 2011
46 Ga0075366_10105486 3300006195 Bacteria 1694
47 Ga0075370_10008308 3300006353 Bacteria 5335
48 Ga0068871_100276858 3300006358 Bacteria 1467
49 Ga0097620_100042872 3300006931 Bacteria 4546
50 Ga0097620_100087304 3300006931 Bacteria 3167
51 Ga0099825_1045944 3300006941 Bacteria 1079
52 Ga0099824_1024827 3300006942 Bacteria 3413
53 Ga0105240_10013140 3300009093 Bacteria 11392
54 Ga0105240_10233669 3300009093 Bacteria 2135
55 Ga0105243_10105596 3300009148 Bacteria 2346
56 Ga0105248_10095656 3300009177 Bacteria 3344
57 Ga0105237_10072575 3300009545 Bacteria 3435
58 Ga0105237_10264962 3300009545 Bacteria 1721
59 Ga0105238_10084761 3300009551 Bacteria 3158
60 Ga0105238_10128560 3300009551 Bacteria 2512
61 Ga0105238_10155341 3300009551 Bacteria 2263
62 Ga0105249_10233243 3300009553 Bacteria 1816
63 Ga0105239_10010122 3300010375 Bacteria 10567
64 Ga0105239_10155045 3300010375 Bacteria 2557
65 Ga0157370_10088148 3300013104 Bacteria 2914
66 Ga0157369_10004161 3300013105 Bacteria 17142
67 Ga0157369_10026698 3300013105 Bacteria 6404
68 Ga0157378_10013574 3300013297 Bacteria 7126
69 Ga0163162_10034134 3300013306 Bacteria 5061
70 Ga0163162_10075189 3300013306 Bacteria 3438
71 Ga0157372_10171665 3300013307 Bacteria 2509
72 Ga0157375_10068978 3300013308 Bacteria 3540
73 Ga0157375_10751195 3300013308 Bacteria 1127
74 Ga0163163_10176527 3300014325 Bacteria 2183
75 Ga0163163_10698386 3300014325 Bacteria 1078
76 Ga0157379_10036302 3300014968 Bacteria 4395
77 Ga0157379_10040175 3300014968 Bacteria 4174
78 Ga0157376_10175479 3300014969 Bacteria 1955
79 Ga0206355_1153543 3300020076 Bacteria 789
80 Ga0206354_11278971 3300020081 Bacteria 782
81 Ga0214544_1000009 3300021320 Bacteria 285865
82 Ga0214542_1000002 3300021321 Bacteria 720798
83 Ga0214545_1000002 3300021324 Bacteria 727485
84 Ga0214543_1000013 3300021327 Bacteria 329117
85 Ga0209677_100593 3300025253 Bacteria 19667
86 Ga0209677_100634 3300025253 Bacteria 18715
87 Ga0209148_1007117 3300025254 Bacteria 2352
88 Ga0209233_1000996 3300025261 Bacteria 12109
89 Ga0209455_1002034 3300025272 Bacteria 8225
90 Ga0209758_1000318 3300025297 Bacteria 92807
91 Ga0209758_1017098 3300025297 Bacteria 3637
92 Ga0209758_1033796 3300025297 Bacteria 2047
93 Ga0209257_1031848 3300025304 Bacteria 1680
94 Ga0207688_10090977 3300025901 Bacteria 1752
95 Ga0207699_10010904 3300025906 Bacteria 4576
96 Ga0207699_10079309 3300025906 Bacteria 2031
97 Ga0207684_10143372 3300025910 Bacteria 2054
98 Ga0207707_10048063 3300025912 Bacteria 3717
99 Ga0207695_10071195 3300025913 Bacteria 3552
100 Ga0207671_10172516 3300025914 Bacteria 1680
101 Ga0207671_10235848 3300025914 Bacteria 1436
102 Ga0207693_10038144 3300025915 Bacteria 3784
103 Ga0207652_10020627 3300025921 Bacteria 5430
104 Ga0207664_10166174 3300025929 Bacteria 1885
105 Ga0207704_10172233 3300025938 Bacteria 1554
106 Ga0207661_10002367 3300025944 Bacteria 12971
107 Ga0207661_10051426 3300025944 Bacteria 3287
108 Ga0207679_10086801 3300025945 Bacteria 2408
109 Ga0207667_10218220 3300025949 Bacteria 1954
110 Ga0207651_10234222 3300025960 Bacteria 1493
111 Ga0207712_10206434 3300025961 Bacteria 1562
112 Ga0207668_10030713 3300025972 Bacteria 3533
113 Ga0207668_10047421 3300025972 Bacteria 2941
114 Ga0207640_10031782 3300025981 Bacteria 3266
115 Ga0207640_10549016 3300025981 Bacteria 970
116 Ga0207703_10150889 3300026035 Bacteria 2026
117 Ga0207703_10526023 3300026035 Bacteria 1113
118 Ga0207639_10294056 3300026041 Bacteria 1433
119 Ga0207678_10073573 3300026067 Bacteria 2928
120 Ga0207702_10035849 3300026078 Bacteria 4148
121 Ga0207702_10573458 3300026078 Bacteria 1106
122 Ga0207674_10040897 3300026116 Bacteria 4798
123 Ga0207674_10063524 3300026116 Bacteria 3727
124 Ga0207675_100058649 3300026118 Bacteria 3592
125 Ga0207683_10081636 3300026121 Bacteria 2870
126 Ga0207683_10400085 3300026121 Bacteria 1263
127 Ga0209589_1000004 3300027357 Bacteria 578529
128 Ga0209489_100004 3300027361 Bacteria 578529
129 Ga0209700_100004 3300027363 Bacteria 578529
130 Ga0268266_10022575 3300028379 Bacteria 5359
131 Ga0268266_10043731 3300028379 Bacteria 3828
132 Ga0268266_10181531 3300028379 Bacteria 1916
133 Ga0268265_10405524 3300028380 Bacteria 1261
134 Ga0268264_10166953 3300028381 Bacteria 1988
135 Ga0268264_10399456 3300028381 Bacteria 1320
136 Ga0265326_10017019 3300028558 Bacteria 2100
137 Ga0265334_10005855 3300028573 Bacteria 5350
138 Ga0265318_10008133 3300028577 Bacteria 4689
139 Ga0265323_10000755 3300028653 Bacteria 17304
140 Ga0265322_10052039 3300028654 Bacteria 1162
141 Ga0265336_10000722 3300028666 Bacteria 17480
142 Ga0307517_10000111 3300028786 Bacteria 120304
143 Ga0307515_10095493 3300028794 Bacteria 3658
144 Ga0265338_10000337 3300028800 Bacteria 85427
145 Ga0307513_10049319 3300031456 Bacteria 4562
146 Ga0307408_100043598 3300031548 Bacteria 3193
147 Ga0307508_10318633 3300031616 Bacteria 1147
148 Ga0307405_10143447 3300031731 Bacteria 1669
149 Ga0307409_100078413 3300031995 Bacteria 2657
150 Ga0307409_100404760 3300031995 Bacteria 1304
151 Ga0307416_100265872 3300032002 Bacteria 1680
152 Ga0307411_10104924 3300032005 Bacteria 2008
153 Ga0373926_0007969 3300035083 Bacteria 3529
154 Ga0373944_0083596 3300035089 Bacteria 1058
155 Ga0373923_0091162 3300035111 Bacteria 1333
156 Ga0373936_0109767 3300035113 Bacteria 1170
157 Ga0373945_0127932 3300035116 Bacteria 1015
158 Ga0373943_0073445 3300035170 Bacteria 1737
159 Ga0373946_0035977 3300035171 Bacteria 2005
160 Ga0373955_0106971 3300035172 Bacteria 1613
161 Ga0373924_0027062 3300035410 Bacteria 2279
162 Ga0373947_0015629 3300035725 Bacteria 4361
163 Ga0310104_07495 3300036242 Bacteria 917
164 Ga0373925_0278207 3300037068 Bacteria 1347
165 Ga0395900_0343426 3300037418 Bacteria 1468
166 Ga0395898_0038835 3300037466 Bacteria 4715
167 Ga0395898_0270855 3300037466 Bacteria 1619
168 Ga0436365_0124825 3300039437 Bacteria 969
169 Ga0436365_0998076 3300039437 Bacteria 1226
170 Ga0436365_1920728 3300039437 Bacteria 2803
171 Ga0436360_1195050 3300039438 Bacteria 982
172 Ga0436361_0807769 3300039447 Bacteria 1451
173 Ga0451791_0026368 3300041451 Bacteria 1335
174 Ga0466965_0430848 3300044683 Bacteria 732
175 Ga0466963_0355111 3300044694 Bacteria 1032
176 Ga0466971_0104401 3300044719 Bacteria 1304
177 Ga0466957_0009099 3300044842 Bacteria 5662
178 Ga0466959_0063310 3300045049 Bacteria 2686
179 Ga0466967_0133686 3300045976 Bacteria 2305
180 Ga0466967_0470283 3300045976 Bacteria 1230
181 Ga0495592_0325950 3300046454 Bacteria 991
182 Ga0495603_0157273 3300046455 Bacteria 1319
183 Ga0495653_0319962 3300046463 Bacteria 1006
184 Ga0495650_0181742 3300046471 Bacteria 739
185 Ga0495580_0448737 3300046472 Bacteria 865
186 Ga0495582_0476592 3300046473 Bacteria 721
187 Ga0495639_0011990 3300046475 Bacteria 3737
188 Ga0495662_0132562 3300046476 Bacteria 1225
189 Ga0495664_0031019 3300046477 Bacteria 3132
190 Ga0495618_0229238 3300046514 Bacteria 1170
191 Ga0495632_0120904 3300046519 Unclassified 1224
192 Ga0495666_0042226 3300046526 Bacteria 2206
193 Ga0495654_0167065 3300046530 Bacteria 962
194 Ga0495665_0026588 3300046531 Bacteria 3108
195 Ga0495640_0016982 3300046533 Bacteria 5433
196 Ga0495645_0002249 3300046543 Bacteria 13134
197 Ga0495656_0169885 3300046615 Bacteria 1065
198 Ga0495634_0099678 3300046642 Bacteria 1878
199 Ga0495635_0096824 3300046663 Bacteria 2017
200 Ga0495657_0337129 3300046675 Bacteria 894
201 Ga0495599_0070904 3300046678 Bacteria 2175
202 Ga0495623_0191321 3300046679 Bacteria 1182
203 Ga0495647_0007818 3300046681 Bacteria 3590
204 Ga0495658_0014172 3300046683 Bacteria 4067
205 Ga0495624_0042897 3300046690 Bacteria 2889
206 Ga0495600_0199652 3300046809 Bacteria 1285
207 Ga0495581_0151270 3300047315 Bacteria 1355
208 Ga0495604_0118415 3300047317 Bacteria 1920
209 Ga0495674_0049667 3300047319 Bacteria 3705
210 Ga0495672_0072069 3300047320 Bacteria 1952
211 Ga0495673_0105565 3300047469 Bacteria 1133
212 Ga0495684_0028259 3300047471 Bacteria 4306
213 Ga0495593_0007158 3300047673 Bacteria 6543
214 Ga0496108_0630993 3300048911 Bacteria 932
215 Ga0496109_0169758 3300048912 Bacteria 2046
216 Ga0496109_0372751 3300048912 Bacteria 1348
217 Ga0496118_0037658 3300048921 Bacteria 3889
218 Ga0496118_0252244 3300048921 Bacteria 1002
219 Ga0496121_0026971 3300048924 Bacteria 5391
220 Ga0496121_0051020 3300048924 Bacteria 3488
221 Ga0496121_0101116 3300048924 Bacteria 2224
222 Ga0496121_0201635 3300048924 Bacteria 1417
223 Ga0496124_0165953 3300048927 Bacteria 1716
224 Ga0496125_0123224 3300048928 Bacteria 1843
225 Ga0496125_0343079 3300048928 Bacteria 895
226 Ga0496126_0011720 3300048929 Bacteria 9035
227 Ga0496126_0038248 3300048929 Bacteria 4467
228 Ga0496126_0107114 3300048929 Bacteria 2438
229 Ga0496126_0149202 3300048929 Bacteria 2005
230 Ga0496126_0157971 3300048929 Bacteria 1939
231 Ga0496126_0174429 3300048929 Bacteria 1830
232 Ga0496126_0334405 3300048929 Bacteria 1242
233 Ga0501041_0321341 3300049577 Bacteria 976
234 Ga0501070_0033591 3300049586 Bacteria 4293
235 Ga0501080_0021784 3300049742 Bacteria 5936
236 Ga0501044_0030224 3300049823 Bacteria 5710
237 nmdc:mga0k408_86907_c1 3300050493 Bacteria 1836
238 nmdc:mga07m45_53500_c1 3300050496 Bacteria 2281
239 Ga0495601_0068000 3300053077 Bacteria 2270
240 Ga0495612_0119882 3300053078 Bacteria 1131
241 Ga0495655_0147824 3300053083 Bacteria 737
242 Ga0500566_0000456 3300053094 Bacteria 22733
243 Ga0500640_000591 3300053095 Bacteria 9368
244 Ga0500641_0003660 3300053096 Bacteria 5428
245 Ga0500641_0038287 3300053096 Bacteria 1926
246 Ga0500641_0039950 3300053096 Bacteria 1892
247 Ga0500554_008956 3300053102 Bacteria 2376
248 Ga0500572_001448 3300053111 Bacteria 6496
249 Ga0500595_001033 3300053119 Bacteria 15530
250 Ga0500614_003896 3300053123 Bacteria 3184
251 Ga0500559_0017315 3300053136 Bacteria 3042
252 Ga0500559_0153247 3300053136 Bacteria 1082
253 Ga0500590_102968 3300053148 Bacteria 1368
254 Ga0500603_003143 3300053150 Bacteria 3561
255 Ga0500603_110399 3300053150 Bacteria 825
256 Ga0500630_001186 3300053159 Bacteria 12219
257 Ga0500638_003217 3300053162 Bacteria 5986
258 Ga0500638_004451 3300053162 Bacteria 5399
259 Ga0500639_000164 3300053163 Bacteria 32226
260 Ga0500639_225749 3300053163 Bacteria 776
261 Ga0500636_0016092 3300053177 Bacteria 4407
262 Ga0500637_0000171 3300053178 Bacteria 24172
263 Ga0500661_000439 3300055283 Bacteria 7714
264 Ga0587073_0093211 3300059492 Bacteria 770
265 Ga0587082_050000 3300059504 Bacteria 794
266 Ga0587088_057601 3300059508 Bacteria 778
267 Ga0587067_063832 3300059640 Bacteria 779
268 Ga0587069_042589 3300059642 Bacteria 780

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10095656 Ga0105248_100956563 202
2 3300014325 Ga0163163_10176527 Ga0163163_101765273 202
3 3300005434 Ga0070709_10101171 Ga0070709_101011711 204
4 3300039437 Ga0436365_0124825 Ga0436365_0124825_60_677 204
5 3300009553 Ga0105249_10233243 Ga0105249_102332431 206
6 3300044683 Ga0466965_0430848 Ga0466965_0430848_42_677 206
7 3300046471 Ga0495650_0181742 Ga0495650_0181742_57_695 207
8 3300046473 Ga0495582_0476592 Ga0495582_0476592_43_681 207
9 3300046530 Ga0495654_0167065 Ga0495654_0167065_32_670 207
10 3300047469 Ga0495673_0105565 Ga0495673_0105565_34_672 207
11 3300053083 Ga0495655_0147824 Ga0495655_0147824_40_678 207
12 3300039438 Ga0436360_1195050 Ga0436360_1195050_66_809 217
13 3300005438 Ga0070701_10197398 Ga0070701_101973981 221
14 3300005548 Ga0070665_100056874 Ga0070665_1000568741 221
15 3300005615 Ga0070702_100287072 Ga0070702_1002870721 221
16 3300005617 Ga0068859_100042873 Ga0068859_1000428732 221
17 3300005719 Ga0068861_100061877 Ga0068861_1000618774 221
18 3300005843 Ga0068860_100212104 Ga0068860_1002121042 221
19 3300005844 Ga0068862_100071725 Ga0068862_1000717252 221
20 3300006931 Ga0097620_100042872 Ga0097620_1000428722 221
21 3300009148 Ga0105243_10105596 Ga0105243_101055962 221
22 3300013306 Ga0163162_10075189 Ga0163162_100751892 221
23 3300013308 Ga0157375_10751195 Ga0157375_107511952 221
24 3300014325 Ga0163163_10698386 Ga0163163_106983862 221
25 3300014968 Ga0157379_10040175 Ga0157379_100401754 221
26 3300014969 Ga0157376_10175479 Ga0157376_101754791 221
27 3300025901 Ga0207688_10090977 Ga0207688_100909772 221
28 3300025972 Ga0207668_10047421 Ga0207668_100474212 221
29 3300026067 Ga0207678_10073573 Ga0207678_100735733 221
30 3300026118 Ga0207675_100058649 Ga0207675_1000586493 221
31 3300026121 Ga0207683_10081636 Ga0207683_100816362 221
32 3300028379 Ga0268266_10043731 Ga0268266_100437312 221
33 3300028380 Ga0268265_10405524 Ga0268265_104055241 221
34 3300028381 Ga0268264_10399456 Ga0268264_103994562 221
35 3300048912 Ga0496109_0372751 Ga0496109_0372751_340_1098 221
36 3300041451 Ga0451791_0026368 Ga0451791_0026368_262_1023 222
37 3300005434 Ga0070709_10077064 Ga0070709_100770642 224
38 3300031995 Ga0307409_100078413 Ga0307409_1000784132 224
39 3300053177 Ga0500636_0016092 Ga0500636_0016092_2253_2981 224
40 3300028558 Ga0265326_10017019 Ga0265326_100170193 225
41 3300028573 Ga0265334_10005855 Ga0265334_100058552 225
42 3300028577 Ga0265318_10008133 Ga0265318_100081333 225
43 3300028653 Ga0265323_10000755 Ga0265323_1000075513 225
44 3300028654 Ga0265322_10052039 Ga0265322_100520391 225
45 3300028666 Ga0265336_10000722 Ga0265336_1000072212 225
46 3300028800 Ga0265338_10000337 Ga0265338_100003375 225
47 3300048924 Ga0496121_0026971 Ga0496121_0026971_1785_2513 227
48 3300048929 Ga0496126_0157971 Ga0496126_0157971_702_1430 227
49 iso_pu_bacteria 3005718088 3005720659 231
50 iso_pu_bacteria 8056967851 8056973434 231
51 3300037466 Ga0395898_0270855 Ga0395898_0270855_458_1207 232
52 iso_pu_bacteria 2513237161 2514010849 232
53 iso_pu_bacteria 2617270735 2617352896 232
54 iso_pu_bacteria 2617270741 2617376426 232
55 iso_pu_bacteria 2824671348 2824675671 232
56 iso_pu_bacteria 2824687955 2824691878 232
57 iso_pu_bacteria 2824732956 2824738401 232
58 iso_pu_bacteria 2824746037 2824750885 232
59 iso_pu_bacteria 2824773399 2824779093 232
60 iso_pu_bacteria 2838122688 2838126492 232
61 iso_pu_bacteria 2841941048 2841947149 232
62 iso_pu_bacteria 2841949485 2841950593 232
63 iso_pu_bacteria 2841966195 2841966907 232
64 iso_pu_bacteria 2841974524 2841975656 232
65 iso_pu_bacteria 2841983080 2841990019 232
66 iso_pu_bacteria 2908775508 2908779470 232
67 3300005347 Ga0070668_100054352 Ga0070668_1000543523 234
68 3300005435 Ga0070714_100402900 Ga0070714_1004029001 234
69 3300005436 Ga0070713_100117165 Ga0070713_1001171652 234
70 3300005439 Ga0070711_100323741 Ga0070711_1003237412 234
71 3300005456 Ga0070678_100152661 Ga0070678_1001526612 234
72 3300005457 Ga0070662_100805991 Ga0070662_1008059911 234
73 3300005466 Ga0070685_10077389 Ga0070685_100773891 234
74 3300005548 Ga0070665_100033577 Ga0070665_1000335777 234
75 3300005617 Ga0068859_100087304 Ga0068859_1000873045 234
76 3300005841 Ga0068863_100064614 Ga0068863_1000646142 234
77 3300005843 Ga0068860_100189688 Ga0068860_1001896882 234
78 3300006028 Ga0070717_10248162 Ga0070717_102481622 234
79 3300006931 Ga0097620_100087304 Ga0097620_1000873042 234
80 3300010375 Ga0105239_10010122 Ga0105239_100101223 234
81 3300013306 Ga0163162_10034134 Ga0163162_100341341 234
82 3300013308 Ga0157375_10068978 Ga0157375_100689783 234
83 3300014968 Ga0157379_10036302 Ga0157379_100363023 234
84 3300025906 Ga0207699_10079309 Ga0207699_100793094 234
85 3300025915 Ga0207693_10038144 Ga0207693_100381445 234
86 3300025929 Ga0207664_10166174 Ga0207664_101661741 234
87 3300025960 Ga0207651_10234222 Ga0207651_102342221 234
88 3300025972 Ga0207668_10030713 Ga0207668_100307136 234
89 3300028379 Ga0268266_10022575 Ga0268266_100225758 234
90 3300028381 Ga0268264_10166953 Ga0268264_101669532 234
91 3300048912 Ga0496109_0169758 Ga0496109_0169758_18_761 234
92 3300005548 Ga0070665_100005586 Ga0070665_10000558626 235
93 3300006195 Ga0075366_10105486 Ga0075366_101054863 235
94 3300021320 Ga0214544_1000009 Ga0214544_1000009252 235
95 3300021321 Ga0214542_1000002 Ga0214542_1000002694 235
96 3300021324 Ga0214545_1000002 Ga0214545_100000226 235
97 3300021327 Ga0214543_1000013 Ga0214543_1000013296 235
98 3300025254 Ga0209148_1007117 Ga0209148_10071173 235
99 3300025297 Ga0209758_1017098 Ga0209758_10170981 235
100 3300028379 Ga0268266_10181531 Ga0268266_101815312 235
101 3300048929 Ga0496126_0011720 Ga0496126_0011720_7731_8480 235
102 iso_pu_bacteria 2791355196 2793061917 235
103 iso_pu_bacteria 2842038055 2842042585 235
104 iso_pu_bacteria 2842045827 2842050628 235
105 3300005436 Ga0070713_100443623 Ga0070713_1004436232 236
106 3300025253 Ga0209677_100593 Ga0209677_1005936 236
107 3300048921 Ga0496118_0037658 Ga0496118_0037658_2788_3498 236
108 3300048924 Ga0496121_0201635 Ga0496121_0201635_173_883 236
109 3300048928 Ga0496125_0123224 Ga0496125_0123224_666_1376 236
110 3300049586 Ga0501070_0033591 Ga0501070_0033591_273_992 236
111 3300049742 Ga0501080_0021784 Ga0501080_0021784_4676_5395 236
112 3300049823 Ga0501044_0030224 Ga0501044_0030224_3579_4298 236
113 3300053096 Ga0500641_0039950 Ga0500641_0039950_453_1211 236
114 3300005614 Ga0068856_100060886 Ga0068856_1000608863 237
115 3300009093 Ga0105240_10013140 Ga0105240_100131404 237
116 3300013104 Ga0157370_10088148 Ga0157370_100881484 237
117 3300013105 Ga0157369_10004161 Ga0157369_1000416115 237
118 3300020076 Ga0206355_1153543 Ga0206355_11535431 237
119 3300020081 Ga0206354_11278971 Ga0206354_112789711 237
120 3300025906 Ga0207699_10010904 Ga0207699_100109042 237
121 3300025913 Ga0207695_10071195 Ga0207695_100711954 237
122 3300026078 Ga0207702_10035849 Ga0207702_100358494 237
123 3300031731 Ga0307405_10143447 Ga0307405_101434473 237
124 3300032002 Ga0307416_100265872 Ga0307416_1002658722 237
125 3300032005 Ga0307411_10104924 Ga0307411_101049241 237
126 3300037418 Ga0395900_0343426 Ga0395900_0343426_272_994 237
127 3300037466 Ga0395898_0038835 Ga0395898_0038835_3173_3895 237
128 3300046519 Ga0495632_0120904 Ga0495632_0120904_75_836 237
129 3300048924 Ga0496121_0051020 Ga0496121_0051020_1845_2573 237
130 3300048927 Ga0496124_0165953 Ga0496124_0165953_837_1565 237
131 3300048929 Ga0496126_0038248 Ga0496126_0038248_2258_3148 237
132 3300048929 Ga0496126_0149202 Ga0496126_0149202_771_1499 237
133 3300049577 Ga0501041_0321341 Ga0501041_0321341_66_935 237
134 3300053094 Ga0500566_0000456 Ga0500566_0000456_10155_11048 237
135 3300053095 Ga0500640_000591 Ga0500640_000591_2686_3579 237
136 3300053096 Ga0500641_0003660 Ga0500641_0003660_1963_2724 237
137 3300053111 Ga0500572_001448 Ga0500572_001448_1330_2223 237
138 3300053123 Ga0500614_003896 Ga0500614_003896_354_1247 237
139 3300053136 Ga0500559_0017315 Ga0500559_0017315_194_1087 237
140 3300053148 Ga0500590_102968 Ga0500590_102968_168_1061 237
141 3300053150 Ga0500603_003143 Ga0500603_003143_2780_3526 237
142 3300053159 Ga0500630_001186 Ga0500630_001186_1188_2081 237
143 3300053162 Ga0500638_004451 Ga0500638_004451_2346_3239 237
144 3300053163 Ga0500639_000164 Ga0500639_000164_10236_11129 237
145 3300053163 Ga0500639_225749 Ga0500639_225749_10_732 237
146 3300059492 Ga0587073_0093211 Ga0587073_0093211_33_755 237
147 3300059508 Ga0587088_057601 Ga0587088_057601_29_751 237
148 3300059640 Ga0587067_063832 Ga0587067_063832_28_750 237
149 3300059642 Ga0587069_042589 Ga0587069_042589_28_750 237
150 3300005329 Ga0070683_100052863 Ga0070683_1000528637 238
151 3300005337 Ga0070682_100284360 Ga0070682_1002843601 238
152 3300005458 Ga0070681_10019424 Ga0070681_100194243 238
153 3300005548 Ga0070665_100028856 Ga0070665_1000288564 238
154 3300005548 Ga0070665_100156159 Ga0070665_1001561593 238
155 3300005577 Ga0068857_100028837 Ga0068857_1000288373 238
156 3300005578 Ga0068854_100031536 Ga0068854_1000315363 238
157 3300006358 Ga0068871_100276858 Ga0068871_1002768583 238
158 3300009093 Ga0105240_10233669 Ga0105240_102336693 238
159 3300009551 Ga0105238_10128560 Ga0105238_101285603 238
160 3300013105 Ga0157369_10026698 Ga0157369_100266983 238
161 3300013307 Ga0157372_10171665 Ga0157372_101716653 238
162 3300025921 Ga0207652_10020627 Ga0207652_100206276 238
163 3300025944 Ga0207661_10051426 Ga0207661_100514262 238
164 3300025949 Ga0207667_10218220 Ga0207667_102182203 238
165 3300025981 Ga0207640_10031782 Ga0207640_100317822 238
166 3300025981 Ga0207640_10549016 Ga0207640_105490161 238
167 3300026116 Ga0207674_10040897 Ga0207674_100408977 238
168 3300031995 Ga0307409_100404760 Ga0307409_1004047602 238
169 3300035083 Ga0373926_0007969 Ga0373926_0007969_1819_2544 238
170 3300035089 Ga0373944_0083596 Ga0373944_0083596_79_804 238
171 3300035111 Ga0373923_0091162 Ga0373923_0091162_31_756 238
172 3300035113 Ga0373936_0109767 Ga0373936_0109767_164_889 238
173 3300035116 Ga0373945_0127932 Ga0373945_0127932_199_924 238
174 3300035170 Ga0373943_0073445 Ga0373943_0073445_441_1166 238
175 3300035171 Ga0373946_0035977 Ga0373946_0035977_779_1504 238
176 3300035172 Ga0373955_0106971 Ga0373955_0106971_659_1384 238
177 3300035410 Ga0373924_0027062 Ga0373924_0027062_31_756 238
178 3300035725 Ga0373947_0015629 Ga0373947_0015629_2735_3460 238
179 3300036242 Ga0310104_07495 Ga0310104_07495_20_793 238
180 3300037068 Ga0373925_0278207 Ga0373925_0278207_88_816 238
181 3300046454 Ga0495592_0325950 Ga0495592_0325950_241_966 238
182 3300046455 Ga0495603_0157273 Ga0495603_0157273_211_936 238
183 3300046463 Ga0495653_0319962 Ga0495653_0319962_218_943 238
184 3300046472 Ga0495580_0448737 Ga0495580_0448737_34_759 238
185 3300046475 Ga0495639_0011990 Ga0495639_0011990_277_1002 238
186 3300046476 Ga0495662_0132562 Ga0495662_0132562_446_1171 238
187 3300046477 Ga0495664_0031019 Ga0495664_0031019_2366_3091 238
188 3300046514 Ga0495618_0229238 Ga0495618_0229238_222_947 238
189 3300046526 Ga0495666_0042226 Ga0495666_0042226_1317_2042 238
190 3300046531 Ga0495665_0026588 Ga0495665_0026588_16_741 238
191 3300046533 Ga0495640_0016982 Ga0495640_0016982_2706_3431 238
192 3300046642 Ga0495634_0099678 Ga0495634_0099678_717_1442 238
193 3300046663 Ga0495635_0096824 Ga0495635_0096824_961_1686 238
194 3300046675 Ga0495657_0337129 Ga0495657_0337129_118_843 238
195 3300046679 Ga0495623_0191321 Ga0495623_0191321_148_873 238
196 3300046681 Ga0495647_0007818 Ga0495647_0007818_1508_2233 238
197 3300046683 Ga0495658_0014172 Ga0495658_0014172_2658_3383 238
198 3300046690 Ga0495624_0042897 Ga0495624_0042897_345_1070 238
199 3300046809 Ga0495600_0199652 Ga0495600_0199652_269_994 238
200 3300047315 Ga0495581_0151270 Ga0495581_0151270_89_814 238
201 3300047317 Ga0495604_0118415 Ga0495604_0118415_1108_1833 238
202 3300047319 Ga0495674_0049667 Ga0495674_0049667_2816_3541 238
203 3300047471 Ga0495684_0028259 Ga0495684_0028259_736_1461 238
204 3300047673 Ga0495593_0007158 Ga0495593_0007158_5513_6238 238
205 3300053078 Ga0495612_0119882 Ga0495612_0119882_19_744 238
206 3300053096 Ga0500641_0038287 Ga0500641_0038287_979_1710 238
207 3300003215 JGI25153J46596_10001335 JGI25153J46596_100013357 239
208 3300003323 rootH1_10024964 rootH1_100249642 239
209 3300003354 JGI25160J50197_1002176 JGI25160J50197_10021765 239
210 3300005335 Ga0070666_10131642 Ga0070666_101316422 239
211 3300005467 Ga0070706_100079088 Ga0070706_1000790883 239
212 3300005535 Ga0070684_100003271 Ga0070684_10000327114 239
213 3300005539 Ga0068853_100169165 Ga0068853_1001691652 239
214 3300005842 Ga0068858_100183225 Ga0068858_1001832253 239
215 3300005842 Ga0068858_100637912 Ga0068858_1006379121 239
216 3300006186 Ga0075369_10039682 Ga0075369_100396823 239
217 3300006353 Ga0075370_10008308 Ga0075370_100083084 239
218 3300006941 Ga0099825_1045944 Ga0099825_10459441 239
219 3300009545 Ga0105237_10072575 Ga0105237_100725756 239
220 3300009545 Ga0105237_10264962 Ga0105237_102649622 239
221 3300009551 Ga0105238_10084761 Ga0105238_100847613 239
222 3300009551 Ga0105238_10155341 Ga0105238_101553413 239
223 3300010375 Ga0105239_10155045 Ga0105239_101550452 239
224 3300025297 Ga0209758_1000318 Ga0209758_100031810 239
225 3300025304 Ga0209257_1031848 Ga0209257_10318482 239
226 3300025910 Ga0207684_10143372 Ga0207684_101433721 239
227 3300025914 Ga0207671_10172516 Ga0207671_101725162 239
228 3300025914 Ga0207671_10235848 Ga0207671_102358481 239
229 3300025938 Ga0207704_10172233 Ga0207704_101722332 239
230 3300025945 Ga0207679_10086801 Ga0207679_100868013 239
231 3300025961 Ga0207712_10206434 Ga0207712_102064341 239
232 3300026035 Ga0207703_10150889 Ga0207703_101508891 239
233 3300026035 Ga0207703_10526023 Ga0207703_105260231 239
234 3300026041 Ga0207639_10294056 Ga0207639_102940561 239
235 3300026078 Ga0207702_10573458 Ga0207702_105734581 239
236 3300026116 Ga0207674_10063524 Ga0207674_100635246 239
237 3300026121 Ga0207683_10400085 Ga0207683_104000851 239
238 3300027357 Ga0209589_1000004 Ga0209589_1000004438 239
239 3300027361 Ga0209489_100004 Ga0209489_100004438 239
240 3300031616 Ga0307508_10318633 Ga0307508_103186331 239
241 3300044694 Ga0466963_0355111 Ga0466963_0355111_152_880 239
242 3300045976 Ga0466967_0133686 Ga0466967_0133686_517_1245 239
243 3300048911 Ga0496108_0630993 Ga0496108_0630993_154_882 239
244 3300048928 Ga0496125_0343079 Ga0496125_0343079_116_844 239
245 3300050493 nmdc:mga0k408_86907_c1 nmdc:mga0k408_86907_c1_466_1236 239
246 3300050496 nmdc:mga07m45_53500_c1 nmdc:mga07m45_53500_c1_587_1357 239
247 3300006942 Ga0099824_1024827 Ga0099824_10248274 240
248 3300025253 Ga0209677_100634 Ga0209677_1006345 240
249 3300025297 Ga0209758_1033796 Ga0209758_10337963 240
250 3300027363 Ga0209700_100004 Ga0209700_100004438 240
251 3300028786 Ga0307517_10000111 Ga0307517_1000011144 240
252 3300028794 Ga0307515_10095493 Ga0307515_100954936 240
253 3300031456 Ga0307513_10049319 Ga0307513_100493194 240
254 3300031548 Ga0307408_100043598 Ga0307408_1000435985 240
255 3300039437 Ga0436365_0998076 Ga0436365_0998076_288_1034 240
256 3300039437 Ga0436365_1920728 Ga0436365_1920728_488_1219 240
257 3300046543 Ga0495645_0002249 Ga0495645_0002249_11557_12321 240
258 3300046615 Ga0495656_0169885 Ga0495656_0169885_124_933 240
259 3300046678 Ga0495599_0070904 Ga0495599_0070904_404_1168 240
260 3300047320 Ga0495672_0072069 Ga0495672_0072069_784_1530 240
261 3300048929 Ga0496126_0174429 Ga0496126_0174429_239_985 240
262 3300048929 Ga0496126_0334405 Ga0496126_0334405_390_1136 240
263 3300053077 Ga0495601_0068000 Ga0495601_0068000_733_1497 240
264 3300053102 Ga0500554_008956 Ga0500554_008956_1127_1870 240
265 3300053119 Ga0500595_001033 Ga0500595_001033_4022_4765 240
266 3300053136 Ga0500559_0153247 Ga0500559_0153247_193_936 240
267 3300053150 Ga0500603_110399 Ga0500603_110399_37_780 240
268 3300053162 Ga0500638_003217 Ga0500638_003217_3197_3940 240
269 3300053178 Ga0500637_0000171 Ga0500637_0000171_16825_17568 240
270 3300055283 Ga0500661_000439 Ga0500661_000439_3790_4533 240
271 3300005329 Ga0070683_100054242 Ga0070683_1000542427 241
272 3300005455 Ga0070663_100208020 Ga0070663_1002080202 241
273 3300005535 Ga0070684_100005821 Ga0070684_1000058214 241
274 3300013297 Ga0157378_10013574 Ga0157378_100135745 241
275 3300025912 Ga0207707_10048063 Ga0207707_100480631 241
276 3300025944 Ga0207661_10002367 Ga0207661_100023674 241
277 3300039447 Ga0436361_0807769 Ga0436361_0807769_654_1391 241
278 3300044719 Ga0466971_0104401 Ga0466971_0104401_254_988 241
279 3300044842 Ga0466957_0009099 Ga0466957_0009099_330_1064 241
280 3300045049 Ga0466959_0063310 Ga0466959_0063310_1782_2516 241
281 3300045976 Ga0466967_0470283 Ga0466967_0470283_481_1218 241
282 3300048921 Ga0496118_0252244 Ga0496118_0252244_71_799 241
283 3300048924 Ga0496121_0101116 Ga0496121_0101116_1410_2138 241
284 3300048929 Ga0496126_0107114 Ga0496126_0107114_1599_2327 241
285 3300059504 Ga0587082_050000 Ga0587082_050000_28_762 241
286 3300003214 JGI25165J46597_1008189 JGI25165J46597_10081893 242
287 3300025261 Ga0209233_1000996 Ga0209233_10009966 242
288 3300025272 Ga0209455_1002034 Ga0209455_10020343 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13505

OMP_b-brl

Outer membrane protein beta-barrel domain

63

289

0.77

PF01389

OmpA_membrane

OmpA-like transmembrane domain

100

292

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nb3-assembly1.cif.gz_A the host outer membrane proteins ompa and ompc are packed at specific sites in the shigella phage sf6 virion as structural components 0.6454 43 235
3nb3-assembly1.cif.gz_A the host outer membrane proteins ompa and ompc are packed at specific sites in the shigella phage sf6 virion as structural components 0.6244 43 235
1p4t-assembly1.cif.gz_A crystal structure of neisserial surface protein a (nspa) 0.624 43 234
6x9z-assembly1.cif.gz_A de novo design of transmembrane beta-barrels 0.6125 43 234
1p4t-assembly1.cif.gz_A crystal structure of neisserial surface protein a (nspa) 0.6115 43 234
ID Description Score Start End Superfamily
1qjpA00 Mainly Beta;Beta Barrel;Porin; 0.6454 43 235 2.40.160.20
1qjpA00 Mainly Beta;Beta Barrel;Porin; 0.6244 43 235 2.40.160.20
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.624 43 234 2.40.160.20
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.6115 43 234 2.40.160.20
4hrvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ABC-type transport auxiliary lipoprotein component 0.5994 137 172 3.40.50.10610
ID Description Score Start End GO Terms
AF-A0A7W2BSZ2-F1-model_v4 deleted 0.8502 22 239
AF-A0A537TI51-F1-model_v4 Porin family protein 0.8239 18 236 GO:0016020
AF-A0A099RU32-F1-model_v4 deleted 0.8228 41 234
AF-A6U6J6-F1-model_v4 Porin 0.817 16 234 GO:0009279
AF-A0A522GSX5-F1-model_v4 Porin family protein 0.8164 19 242 GO:0009279

Feature Viewer

pLDDT pTM Quality
84.31 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map