F388857

General Info

Members Datasets Scaffolds Average Seq Length
288 115 288 138

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0025325|Ga0501076_0025325_2094_2597
Length 167
Sequence MTSITCCHFHVTLKSLLETDIVCFSRRKVFMQITRQADYAVRAVLHLAQMRNGERAATSSVAKEQRIPPSFLAKIISQLSIAGLLHTSRGARGGVTLARDPKDITLLEVVEAIDGPIQLNECVNEGGVCSFDESCPIRSVWCEAQDELVARLRKTDFAQLLAKAEPQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
46 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
47 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
48 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
52 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
57 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
58 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
59 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
60 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
68 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
73 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
74 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
75 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
76 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
82 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
83 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
84 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
85 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
94 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
95 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
96 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
97 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
98 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
99 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
100 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
101 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
102 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
105 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
106 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.83
Metatranscriptomes 4.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.35
Rhizosphere 99.31
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_18141 2162886007 Bacteria 7242
2 SwRhRL2b_contig_766268 2162886007 Bacteria 5784
3 Ga0065704_10071051 3300005289 Bacteria 13492
4 Ga0065704_10150631 3300005289 Unclassified 1432
5 Ga0065704_10590579 3300005289 Unclassified 612
6 Ga0065715_10256661 3300005293 Bacteria 1150
7 Ga0065707_10002281 3300005295 Bacteria 5286
8 Ga0065707_10013136 3300005295 Unclassified 1986
9 Ga0065707_10081753 3300005295 Bacteria 50128
10 Ga0065707_10085697 3300005295 Bacteria 5959
11 Ga0068868_101843857 3300005338 Unclassified 572
12 Ga0070689_100158120 3300005340 Unclassified 1830
13 Ga0070689_100174563 3300005340 Bacteria 1742
14 Ga0070669_100753414 3300005353 Unclassified 825
15 Ga0070703_10099188 3300005406 Unclassified 1024
16 Ga0070694_100142894 3300005444 Unclassified 1740
17 Ga0070708_100460240 3300005445 Bacteria 1200
18 Ga0070706_100190615 3300005467 Bacteria 1916
19 Ga0070706_100259289 3300005467 Unclassified 1623
20 Ga0070706_100984352 3300005467 Bacteria 778
21 Ga0070699_100026069 3300005518 Bacteria 5042
22 Ga0070699_100105506 3300005518 Bacteria 2472
23 Ga0070704_100248462 3300005549 Unclassified 1459
24 Ga0068859_100079195 3300005617 Bacteria 3325
25 Ga0068859_100758352 3300005617 Bacteria 1059
26 Ga0068864_100016329 3300005618 Bacteria 6180
27 Ga0068870_10653202 3300005840 Unclassified 721
28 Ga0068863_100330811 3300005841 Unclassified 1481
29 Ga0068862_100035718 3300005844 Bacteria 4211
30 Ga0068862_100141041 3300005844 Bacteria 2139
31 Ga0075428_100106123 3300006844 Bacteria 3062
32 Ga0075428_100486327 3300006844 Bacteria 1321
33 Ga0075428_100506356 3300006844 Bacteria 1292
34 Ga0075428_102534690 3300006844 Bacteria 525
35 Ga0075430_100290096 3300006846 Unclassified 1353
36 Ga0075430_100378261 3300006846 Bacteria 1169
37 Ga0075431_100221516 3300006847 Bacteria 1930
38 Ga0075431_100379337 3300006847 Bacteria 1418
39 Ga0075431_100633824 3300006847 Bacteria 1050
40 Ga0075433_10763617 3300006852 Bacteria 845
41 Ga0075434_100350848 3300006871 Unclassified 1496
42 Ga0075434_100584799 3300006871 Bacteria 1136
43 Ga0075434_100981012 3300006871 Bacteria 859
44 Ga0075429_100119424 3300006880 Bacteria 2304
45 Ga0075429_100302683 3300006880 Bacteria 1400
46 Ga0075429_100320465 3300006880 Bacteria 1357
47 Ga0075429_100364324 3300006880 Unclassified 1266
48 Ga0075429_100518545 3300006880 Bacteria 1044
49 Ga0075429_100543902 3300006880 Bacteria 1018
50 Ga0097620_100079193 3300006931 Bacteria 3325
51 Ga0097620_100083162 3300006931 Bacteria 3244
52 Ga0097620_100758372 3300006931 Bacteria 1059
53 Ga0105240_12433608 3300009093 Unclassified 542
54 Ga0111539_10040241 3300009094 Bacteria 5628
55 Ga0114129_10019247 3300009147 Bacteria 9725
56 Ga0114129_10029015 3300009147 Bacteria 7837
57 Ga0114129_10048346 3300009147 Bacteria 5977
58 Ga0114129_10098588 3300009147 Bacteria 4045
59 Ga0114129_10163477 3300009147 Bacteria 3039
60 Ga0114129_10275341 3300009147 Bacteria 2250
61 Ga0114129_10356933 3300009147 Bacteria 1935
62 Ga0114129_10924133 3300009147 Bacteria 1104
63 Ga0105243_10178200 3300009148 Bacteria 1846
64 Ga0105241_10489527 3300009174 Unclassified 1095
65 Ga0105249_13164685 3300009553 Unclassified 529
66 Ga0105246_10086256 3300011119 Bacteria 2250
67 Ga0157378_10846498 3300013297 Bacteria 943
68 Ga0207653_10142782 3300025885 Unclassified 876
69 Ga0207684_10372824 3300025910 Bacteria 1228
70 Ga0207684_10396745 3300025910 Unclassified 1186
71 Ga0207681_10471596 3300025923 Bacteria 1024
72 Ga0207709_10342065 3300025935 Bacteria 1126
73 Ga0207709_10400632 3300025935 Unclassified 1049
74 Ga0207670_10228662 3300025936 Unclassified 1427
75 Ga0207670_10261002 3300025936 Bacteria 1343
76 Ga0207670_10904977 3300025936 Bacteria 739
77 Ga0207712_11179090 3300025961 Unclassified 683
78 Ga0207708_10765523 3300026075 Unclassified 829
79 Ga0207676_10104318 3300026095 Unclassified 2358
80 Ga0207676_10490486 3300026095 Unclassified 1165
81 Ga0207674_10643124 3300026116 Bacteria 1024
82 Ga0207675_100629105 3300026118 Unclassified 1078
83 Ga0268265_10082353 3300028380 Bacteria 2544
84 Ga0265334_10063141 3300028573 Bacteria 1392
85 Ga0265318_10010263 3300028577 Bacteria 4088
86 Ga0265323_10042669 3300028653 Unclassified 1641
87 Ga0265323_10099618 3300028653 Unclassified 963
88 Ga0265322_10165464 3300028654 Unclassified 633
89 Ga0265338_10032599 3300028800 Bacteria 5075
90 Ga0265325_10267678 3300031241 Bacteria 769
91 Ga0265340_10005035 3300031247 Bacteria 7349
92 Ga0265331_10124110 3300031250 Bacteria 1180
93 Ga0265316_10032430 3300031344 Bacteria 4263
94 Ga0265316_10889029 3300031344 Bacteria 622
95 Ga0307408_100595273 3300031548 Unclassified 982
96 Ga0265313_10184338 3300031595 Bacteria 875
97 Ga0316575_10014702 3300031665 Bacteria 2942
98 Ga0316575_10153645 3300031665 Bacteria 950
99 Ga0316579_10000970 3300031691 Bacteria 10038
100 Ga0316579_10027958 3300031691 Bacteria 2565
101 Ga0316579_10050858 3300031691 Bacteria 1938
102 Ga0316579_10075234 3300031691 Unclassified 1604
103 Ga0316579_10570593 3300031691 Unclassified 548
104 Ga0316576_10054773 3300031727 Bacteria 2909
105 Ga0316576_10075759 3300031727 Bacteria 2489
106 Ga0316576_10114084 3300031727 Bacteria 2027
107 Ga0316578_10024892 3300031728 Bacteria 3360
108 Ga0316578_10070165 3300031728 Bacteria 2074
109 Ga0316577_10001291 3300031733 Bacteria 11692
110 Ga0316577_10003414 3300031733 Bacteria 8019
111 Ga0316577_10006693 3300031733 Bacteria 6109
112 Ga0316577_10347631 3300031733 Unclassified 842
113 Ga0307410_10625811 3300031852 Unclassified 900
114 Ga0307406_10990071 3300031901 Unclassified 721
115 Ga0307409_101830022 3300031995 Unclassified 636
116 Ga0307416_100063698 3300032002 Bacteria 3021
117 Ga0307416_100522892 3300032002 Unclassified 1255
118 Ga0307411_11581922 3300032005 Unclassified 604
119 Ga0307415_101846400 3300032126 Unclassified 586
120 Ga0316585_10005985 3300032137 Bacteria 3458
121 Ga0316585_10046217 3300032137 Unclassified 1393
122 Ga0316593_10154607 3300032168 Bacteria 836
123 Ga0316593_10157208 3300032168 Unclassified 829
124 Ga0316593_10346862 3300032168 Bacteria 568
125 Ga0316593_10426603 3300032168 Unclassified 515
126 Ga0316592_1176607 3300033524 Unclassified 510
127 Ga0316586_1084610 3300033527 Bacteria 595
128 Ga0316586_1115068 3300033527 Unclassified 521
129 Ga0316586_1124452 3300033527 Bacteria 504
130 Ga0316596_1058221 3300033541 Bacteria 1029
131 Ga0316596_1093904 3300033541 Bacteria 809
132 Ga0316596_1172663 3300033541 Unclassified 597
133 Ga0316596_1190010 3300033541 Unclassified 570
134 Ga0373949_0229966 3300035090 Unclassified 567
135 Ga0316574_0000443 3300035398 Bacteria 16514
136 Ga0316574_0284563 3300035398 Bacteria 1053
137 Ga0316574_0298645 3300035398 Bacteria 1024
138 Ga0316574_0554495 3300035398 Unclassified 713
139 Ga0316582_0000340 3300036647 Bacteria 16513
140 Ga0316582_0022345 3300036647 Bacteria 3754
141 Ga0316582_0058863 3300036647 Bacteria 2458
142 Ga0316582_0064728 3300036647 Bacteria 2352
143 Ga0316582_0078770 3300036647 Bacteria 2147
144 Ga0316582_0112203 3300036647 Bacteria 1816
145 Ga0316582_0293209 3300036647 Bacteria 1117
146 Ga0316582_0589873 3300036647 Unclassified 765
147 Ga0316584_0001744 3300036712 Bacteria 13358
148 Ga0316584_0001891 3300036712 Bacteria 13009
149 Ga0316584_0062423 3300036712 Bacteria 2791
150 Ga0316584_0074624 3300036712 Bacteria 2542
151 Ga0316584_0100793 3300036712 Bacteria 2162
152 Ga0316584_0322550 3300036712 Unclassified 1114
153 Ga0316584_0607061 3300036712 Unclassified 758
154 Ga0400487_16904 3300039110 Unclassified 1778
155 Ga0451577_0001318 3300042876 Bacteria 33871
156 Ga0451577_0003825 3300042876 Bacteria 16385
157 Ga0451577_0012125 3300042876 Bacteria 8108
158 Ga0451577_0121407 3300042876 Unclassified 2341
159 Ga0451577_0158361 3300042876 Bacteria 2038
160 Ga0451577_0220984 3300042876 Bacteria 1712
161 Ga0451577_0286170 3300042876 Bacteria 1494
162 Ga0451577_0401182 3300042876 Bacteria 1245
163 Ga0451577_0427108 3300042876 Bacteria 1203
164 Ga0451577_0608231 3300042876 Bacteria 992
165 Ga0451577_0726616 3300042876 Bacteria 899
166 Ga0451577_0778963 3300042876 Unclassified 864
167 Ga0451577_0858538 3300042876 Unclassified 818
168 Ga0451577_0911158 3300042876 Unclassified 791
169 Ga0453683_0000981 3300044673 Bacteria 26941
170 Ga0453683_0019444 3300044673 Bacteria 4349
171 Ga0453683_0045147 3300044673 Bacteria 2764
172 Ga0453683_0089513 3300044673 Bacteria 1929
173 Ga0453683_0097212 3300044673 Bacteria 1848
174 Ga0453683_0193954 3300044673 Bacteria 1289
175 Ga0453683_0229169 3300044673 Bacteria 1182
176 Ga0453683_0797601 3300044673 Unclassified 622
177 Ga0453683_0898959 3300044673 Unclassified 585
178 Ga0453684_0000012 3300044712 Bacteria 1062512
179 Ga0453684_0000520 3300044712 Bacteria 147265
180 Ga0453684_0001036 3300044712 Bacteria 88911
181 Ga0453684_0004883 3300044712 Bacteria 27465
182 Ga0453684_0006031 3300044712 Bacteria 23448
183 Ga0453684_0008147 3300044712 Bacteria 18913
184 Ga0453684_0026930 3300044712 Bacteria 8280
185 Ga0453684_0027289 3300044712 Bacteria 8195
186 Ga0453684_0030456 3300044712 Bacteria 7624
187 Ga0453684_0045864 3300044712 Bacteria 5824
188 Ga0453684_0057333 3300044712 Bacteria 5042
189 Ga0453684_0061404 3300044712 Unclassified 4824
190 Ga0453684_0085892 3300044712 Bacteria 3908
191 Ga0453684_0126062 3300044712 Bacteria 3081
192 Ga0453684_0172366 3300044712 Bacteria 2549
193 Ga0453684_0182487 3300044712 Bacteria 2462
194 Ga0453684_0209586 3300044712 Bacteria 2266
195 Ga0453684_0250717 3300044712 Bacteria 2033
196 Ga0453684_0393085 3300044712 Bacteria 1554
197 Ga0453684_0402511 3300044712 Bacteria 1533
198 Ga0453684_0429321 3300044712 Unclassified 1474
199 Ga0453684_0517026 3300044712 Bacteria 1319
200 Ga0453684_0520747 3300044712 Bacteria 1314
201 Ga0453684_0564566 3300044712 Bacteria 1252
202 Ga0453684_0577830 3300044712 Bacteria 1234
203 Ga0453684_0621619 3300044712 Bacteria 1182
204 Ga0453684_0641564 3300044712 Unclassified 1160
205 Ga0453684_0739674 3300044712 Bacteria 1065
206 Ga0453684_0818744 3300044712 Bacteria 1003
207 Ga0453684_0824719 3300044712 Unclassified 999
208 Ga0453684_0916064 3300044712 Bacteria 938
209 Ga0453684_0954088 3300044712 Bacteria 915
210 Ga0453684_1009263 3300044712 Bacteria 884
211 Ga0453684_1134545 3300044712 Unclassified 824
212 Ga0453684_1311813 3300044712 Bacteria 754
213 Ga0453684_1519215 3300044712 Unclassified 690
214 Ga0453684_1659436 3300044712 Bacteria 654
215 Ga0453684_1918064 3300044712 Bacteria 599
216 Ga0451576_0000192 3300045051 Bacteria 154140
217 Ga0451576_0002271 3300045051 Bacteria 29333
218 Ga0451576_0015601 3300045051 Bacteria 8411
219 Ga0451576_0053753 3300045051 Bacteria 4217
220 Ga0451576_0246956 3300045051 Bacteria 1865
221 Ga0451576_0283052 3300045051 Bacteria 1734
222 Ga0451576_0301342 3300045051 Unclassified 1676
223 Ga0451576_0657743 3300045051 Bacteria 1101
224 Ga0451576_0947923 3300045051 Bacteria 902
225 Ga0451576_1477005 3300045051 Unclassified 706
226 Ga0451576_2205135 3300045051 Unclassified 565
227 Ga0451576_2277077 3300045051 Unclassified 555
228 Ga0495670_0238836 3300046691 Bacteria 967
229 Ga0495636_0492558 3300047318 Bacteria 592
230 Ga0496106_0033317 3300048909 Bacteria 3844
231 Ga0501298_085279 3300049521 Unclassified 700
232 Ga0501299_136339 3300049522 Unclassified 606
233 Ga0501036_0458991 3300049572 Bacteria 1061
234 Ga0501037_0913040 3300049573 Bacteria 575
235 Ga0501039_1202201 3300049575 Unclassified 586
236 Ga0501040_0230350 3300049576 Unclassified 1319
237 Ga0501041_0848357 3300049577 Unclassified 586
238 Ga0501042_0310661 3300049578 Bacteria 1139
239 Ga0501048_0685915 3300049582 Unclassified 735
240 Ga0501071_0351609 3300049587 Unclassified 1122
241 Ga0501072_0163538 3300049588 Bacteria 1776
242 Ga0501072_1336390 3300049588 Unclassified 555
243 Ga0501072_1346455 3300049588 Bacteria 553
244 Ga0501074_0108937 3300049590 Bacteria 1982
245 Ga0501074_0415592 3300049590 Unclassified 954
246 Ga0501075_0013517 3300049591 Bacteria 5827
247 Ga0501075_0132919 3300049591 Bacteria 1896
248 Ga0501076_0025325 3300049592 Bacteria 4591
249 Ga0501076_0029958 3300049592 Bacteria 4237
250 Ga0501076_0167822 3300049592 Bacteria 1789
251 Ga0501076_0191546 3300049592 Bacteria 1669
252 Ga0501209_304316 3300049656 Bacteria 502
253 Ga0501223_128959 3300049663 Unclassified 538
254 Ga0501233_176021 3300049668 Unclassified 610
255 Ga0501236_063783 3300049670 Unclassified 659
256 Ga0501079_0072755 3300049741 Bacteria 2657
257 Ga0501079_0206687 3300049741 Bacteria 1534
258 Ga0501079_0726060 3300049741 Unclassified 782
259 Ga0501080_0087859 3300049742 Bacteria 2888
260 Ga0501081_0051947 3300049743 Bacteria 2827
261 Ga0501081_0429521 3300049743 Bacteria 980
262 Ga0501081_0695961 3300049743 Unclassified 763
263 Ga0501282_046629 3300049778 Unclassified 528
264 Ga0501283_091335 3300049779 Unclassified 583
265 nmdc:mga05p37_104886_c1 3300050507 Bacteria 3478
266 nmdc:mga05p37_1439929_c1 3300050507 Unclassified 691
267 nmdc:mga05p37_37854_c1 3300050507 Bacteria 5916
268 nmdc:mga05p37_434667_c1 3300050507 Bacteria 1524
269 nmdc:mga05p37_44641_c1 3300050507 Bacteria 5453
270 nmdc:mga05p37_99462_c1 3300050507 Bacteria 3582
271 nmdc:mga09592_1609800_c1 3300050508 Bacteria 526
272 nmdc:mga09592_199181_c1 3300050508 Bacteria 1734
273 nmdc:mga09592_279194_c1 3300050508 Unclassified 1449
274 nmdc:mga09592_435268_c1 3300050508 Unclassified 1132
275 nmdc:mga09592_8637_c1 3300050508 Bacteria 8287
276 nmdc:mga0qj67_380555_c1 3300050509 Bacteria 1140
277 nmdc:mga0qj67_541182_c1 3300050509 Bacteria 934
278 nmdc:mga06r32_182162_c1 3300050510 Bacteria 2086
279 nmdc:mga06r32_35133_c1 3300050510 Bacteria 4729
280 nmdc:mga06r32_383512_c1 3300050510 Unclassified 1388
281 nmdc:mga08y16_552095_c1 3300050511 Bacteria 1166
282 nmdc:mga0n895_583723_c1 3300050512 Unclassified 1121
283 nmdc:mga0a205_124792_c2 3300050515 Bacteria 833
284 nmdc:mga0a205_225150_c1 3300050515 Bacteria 1760
285 Ga0501084_0007058 3300054114 Bacteria 9258
286 Ga0501082_0076823 3300060353 Bacteria 2879
287 Ga0501082_0095842 3300060353 Bacteria 2565
288 Ga0501082_0185208 3300060353 Bacteria 1811

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028653 Ga0265323_10099618 Ga0265323_100996181 134
2 3300031727 Ga0316576_10054773 Ga0316576_100547732 134
3 3300031733 Ga0316577_10006693 Ga0316577_100066932 134
4 3300032168 Ga0316593_10346862 Ga0316593_103468621 134
5 3300033527 Ga0316586_1115068 Ga0316586_11150681 134
6 3300033527 Ga0316586_1124452 Ga0316586_11244521 134
7 3300035398 Ga0316574_0284563 Ga0316574_0284563_615_1028 134
8 3300036712 Ga0316584_0001891 Ga0316584_0001891_6292_6705 134
9 3300036712 Ga0316584_0322550 Ga0316584_0322550_287_700 134
10 3300042876 Ga0451577_0001318 Ga0451577_0001318_19882_20286 134
11 3300042876 Ga0451577_0003825 Ga0451577_0003825_7099_7506 134
12 3300042876 Ga0451577_0012125 Ga0451577_0012125_1838_2251 134
13 3300042876 Ga0451577_0220984 Ga0451577_0220984_822_1226 134
14 3300042876 Ga0451577_0427108 Ga0451577_0427108_31_435 134
15 3300042876 Ga0451577_0778963 Ga0451577_0778963_179_592 134
16 3300044673 Ga0453683_0000981 Ga0453683_0000981_5512_5985 134
17 3300044673 Ga0453683_0019444 Ga0453683_0019444_2930_3403 134
18 3300044673 Ga0453683_0045147 Ga0453683_0045147_1926_2330 134
19 3300044673 Ga0453683_0089513 Ga0453683_0089513_1385_1837 134
20 3300044673 Ga0453683_0097212 Ga0453683_0097212_31_435 134
21 3300044673 Ga0453683_0797601 Ga0453683_0797601_23_472 134
22 3300044673 Ga0453683_0898959 Ga0453683_0898959_76_480 134
23 3300044712 Ga0453684_0000012 Ga0453684_0000012_957666_958070 134
24 3300044712 Ga0453684_0001036 Ga0453684_0001036_51546_51959 134
25 3300044712 Ga0453684_0006031 Ga0453684_0006031_4267_4674 134
26 3300044712 Ga0453684_0008147 Ga0453684_0008147_2502_2915 134
27 3300044712 Ga0453684_0026930 Ga0453684_0026930_48_500 134
28 3300044712 Ga0453684_0027289 Ga0453684_0027289_1438_1842 134
29 3300044712 Ga0453684_0045864 Ga0453684_0045864_3677_4081 134
30 3300044712 Ga0453684_0061404 Ga0453684_0061404_1786_2268 134
31 3300044712 Ga0453684_0085892 Ga0453684_0085892_352_765 134
32 3300044712 Ga0453684_0182487 Ga0453684_0182487_1221_1634 134
33 3300044712 Ga0453684_0250717 Ga0453684_0250717_473_886 134
34 3300044712 Ga0453684_0393085 Ga0453684_0393085_515_919 134
35 3300044712 Ga0453684_0402511 Ga0453684_0402511_533_937 134
36 3300044712 Ga0453684_0520747 Ga0453684_0520747_439_843 134
37 3300044712 Ga0453684_0739674 Ga0453684_0739674_89_502 134
38 3300044712 Ga0453684_0954088 Ga0453684_0954088_334_807 134
39 3300044712 Ga0453684_1134545 Ga0453684_1134545_126_530 134
40 3300044712 Ga0453684_1311813 Ga0453684_1311813_76_489 134
41 3300044712 Ga0453684_1659436 Ga0453684_1659436_233_637 134
42 3300044712 Ga0453684_1918064 Ga0453684_1918064_154_558 134
43 3300045051 Ga0451576_0000192 Ga0451576_0000192_102615_103019 134
44 3300045051 Ga0451576_0002271 Ga0451576_0002271_10955_11428 134
45 3300045051 Ga0451576_0015601 Ga0451576_0015601_1488_1892 134
46 3300045051 Ga0451576_0301342 Ga0451576_0301342_1083_1496 134
47 3300045051 Ga0451576_0657743 Ga0451576_0657743_596_1045 134
48 2162886007 SwRhRL2b_contig_18141 SwRhRL2b_0364.00000530 135
49 2162886007 SwRhRL2b_contig_766268 SwRhRL2b_0296.00006790 135
50 3300005289 Ga0065704_10071051 Ga0065704_100710516 135
51 3300005289 Ga0065704_10150631 Ga0065704_101506312 135
52 3300005289 Ga0065704_10590579 Ga0065704_105905791 135
53 3300005293 Ga0065715_10256661 Ga0065715_102566612 135
54 3300005295 Ga0065707_10002281 Ga0065707_100022813 135
55 3300005295 Ga0065707_10013136 Ga0065707_100131362 135
56 3300005295 Ga0065707_10081753 Ga0065707_1008175314 135
57 3300005295 Ga0065707_10085697 Ga0065707_100856971 135
58 3300005338 Ga0068868_101843857 Ga0068868_1018438571 135
59 3300005340 Ga0070689_100158120 Ga0070689_1001581203 135
60 3300005340 Ga0070689_100174563 Ga0070689_1001745631 135
61 3300005353 Ga0070669_100753414 Ga0070669_1007534141 135
62 3300005406 Ga0070703_10099188 Ga0070703_100991881 135
63 3300005444 Ga0070694_100142894 Ga0070694_1001428942 135
64 3300005445 Ga0070708_100460240 Ga0070708_1004602401 135
65 3300005467 Ga0070706_100190615 Ga0070706_1001906151 135
66 3300005467 Ga0070706_100259289 Ga0070706_1002592892 135
67 3300005467 Ga0070706_100984352 Ga0070706_1009843521 135
68 3300005518 Ga0070699_100026069 Ga0070699_1000260695 135
69 3300005518 Ga0070699_100105506 Ga0070699_1001055061 135
70 3300005549 Ga0070704_100248462 Ga0070704_1002484622 135
71 3300005617 Ga0068859_100079195 Ga0068859_1000791953 135
72 3300005617 Ga0068859_100758352 Ga0068859_1007583522 135
73 3300005618 Ga0068864_100016329 Ga0068864_1000163294 135
74 3300005840 Ga0068870_10653202 Ga0068870_106532021 135
75 3300005841 Ga0068863_100330811 Ga0068863_1003308111 135
76 3300005844 Ga0068862_100035718 Ga0068862_1000357184 135
77 3300005844 Ga0068862_100141041 Ga0068862_1001410413 135
78 3300006844 Ga0075428_100106123 Ga0075428_1001061232 135
79 3300006844 Ga0075428_100486327 Ga0075428_1004863272 135
80 3300006844 Ga0075428_100506356 Ga0075428_1005063562 135
81 3300006844 Ga0075428_102534690 Ga0075428_1025346901 135
82 3300006846 Ga0075430_100290096 Ga0075430_1002900962 135
83 3300006846 Ga0075430_100378261 Ga0075430_1003782612 135
84 3300006847 Ga0075431_100221516 Ga0075431_1002215163 135
85 3300006847 Ga0075431_100379337 Ga0075431_1003793372 135
86 3300006847 Ga0075431_100633824 Ga0075431_1006338241 135
87 3300006852 Ga0075433_10763617 Ga0075433_107636171 135
88 3300006871 Ga0075434_100350848 Ga0075434_1003508482 135
89 3300006871 Ga0075434_100584799 Ga0075434_1005847991 135
90 3300006871 Ga0075434_100981012 Ga0075434_1009810121 135
91 3300006880 Ga0075429_100119424 Ga0075429_1001194243 135
92 3300006880 Ga0075429_100302683 Ga0075429_1003026831 135
93 3300006880 Ga0075429_100320465 Ga0075429_1003204652 135
94 3300006880 Ga0075429_100364324 Ga0075429_1003643242 135
95 3300006880 Ga0075429_100518545 Ga0075429_1005185452 135
96 3300006880 Ga0075429_100543902 Ga0075429_1005439021 135
97 3300006931 Ga0097620_100079193 Ga0097620_1000791933 135
98 3300006931 Ga0097620_100083162 Ga0097620_1000831623 135
99 3300006931 Ga0097620_100758372 Ga0097620_1007583722 135
100 3300009093 Ga0105240_12433608 Ga0105240_124336081 135
101 3300009094 Ga0111539_10040241 Ga0111539_100402414 135
102 3300009147 Ga0114129_10019247 Ga0114129_100192474 135
103 3300009147 Ga0114129_10029015 Ga0114129_1002901510 135
104 3300009147 Ga0114129_10048346 Ga0114129_100483464 135
105 3300009147 Ga0114129_10098588 Ga0114129_100985882 135
106 3300009147 Ga0114129_10163477 Ga0114129_101634774 135
107 3300009147 Ga0114129_10275341 Ga0114129_102753411 135
108 3300009147 Ga0114129_10356933 Ga0114129_103569333 135
109 3300009147 Ga0114129_10924133 Ga0114129_109241332 135
110 3300009148 Ga0105243_10178200 Ga0105243_101782002 135
111 3300009174 Ga0105241_10489527 Ga0105241_104895272 135
112 3300009553 Ga0105249_13164685 Ga0105249_131646851 135
113 3300011119 Ga0105246_10086256 Ga0105246_100862562 135
114 3300013297 Ga0157378_10846498 Ga0157378_108464981 135
115 3300025885 Ga0207653_10142782 Ga0207653_101427822 135
116 3300025910 Ga0207684_10372824 Ga0207684_103728242 135
117 3300025910 Ga0207684_10396745 Ga0207684_103967451 135
118 3300025923 Ga0207681_10471596 Ga0207681_104715962 135
119 3300025935 Ga0207709_10342065 Ga0207709_103420652 135
120 3300025935 Ga0207709_10400632 Ga0207709_104006321 135
121 3300025936 Ga0207670_10228662 Ga0207670_102286622 135
122 3300025936 Ga0207670_10261002 Ga0207670_102610022 135
123 3300025936 Ga0207670_10904977 Ga0207670_109049771 135
124 3300025961 Ga0207712_11179090 Ga0207712_111790901 135
125 3300026075 Ga0207708_10765523 Ga0207708_107655231 135
126 3300026095 Ga0207676_10104318 Ga0207676_101043183 135
127 3300026095 Ga0207676_10490486 Ga0207676_104904862 135
128 3300026116 Ga0207674_10643124 Ga0207674_106431242 135
129 3300026118 Ga0207675_100629105 Ga0207675_1006291052 135
130 3300028380 Ga0268265_10082353 Ga0268265_100823533 135
131 3300028573 Ga0265334_10063141 Ga0265334_100631411 135
132 3300028577 Ga0265318_10010263 Ga0265318_100102632 135
133 3300028653 Ga0265323_10042669 Ga0265323_100426693 135
134 3300028654 Ga0265322_10165464 Ga0265322_101654641 135
135 3300028800 Ga0265338_10032599 Ga0265338_100325992 135
136 3300031241 Ga0265325_10267678 Ga0265325_102676781 135
137 3300031247 Ga0265340_10005035 Ga0265340_100050357 135
138 3300031250 Ga0265331_10124110 Ga0265331_101241102 135
139 3300031344 Ga0265316_10032430 Ga0265316_100324304 135
140 3300031344 Ga0265316_10889029 Ga0265316_108890291 135
141 3300031548 Ga0307408_100595273 Ga0307408_1005952732 135
142 3300031595 Ga0265313_10184338 Ga0265313_101843381 135
143 3300031665 Ga0316575_10014702 Ga0316575_100147023 135
144 3300031665 Ga0316575_10153645 Ga0316575_101536451 135
145 3300031691 Ga0316579_10000970 Ga0316579_100009705 135
146 3300031691 Ga0316579_10027958 Ga0316579_100279582 135
147 3300031691 Ga0316579_10050858 Ga0316579_100508581 135
148 3300031691 Ga0316579_10075234 Ga0316579_100752341 135
149 3300031691 Ga0316579_10570593 Ga0316579_105705931 135
150 3300031727 Ga0316576_10075759 Ga0316576_100757592 135
151 3300031727 Ga0316576_10114084 Ga0316576_101140842 135
152 3300031728 Ga0316578_10024892 Ga0316578_100248922 135
153 3300031728 Ga0316578_10070165 Ga0316578_100701652 135
154 3300031733 Ga0316577_10001291 Ga0316577_100012914 135
155 3300031733 Ga0316577_10003414 Ga0316577_100034147 135
156 3300031733 Ga0316577_10347631 Ga0316577_103476312 135
157 3300031852 Ga0307410_10625811 Ga0307410_106258112 135
158 3300031901 Ga0307406_10990071 Ga0307406_109900711 135
159 3300031995 Ga0307409_101830022 Ga0307409_1018300221 135
160 3300032002 Ga0307416_100063698 Ga0307416_1000636982 135
161 3300032002 Ga0307416_100522892 Ga0307416_1005228922 135
162 3300032005 Ga0307411_11581922 Ga0307411_115819221 135
163 3300032126 Ga0307415_101846400 Ga0307415_1018464001 135
164 3300032137 Ga0316585_10005985 Ga0316585_100059853 135
165 3300032137 Ga0316585_10046217 Ga0316585_100462171 135
166 3300032168 Ga0316593_10154607 Ga0316593_101546071 135
167 3300032168 Ga0316593_10157208 Ga0316593_101572082 135
168 3300032168 Ga0316593_10426603 Ga0316593_104266031 135
169 3300033524 Ga0316592_1176607 Ga0316592_11766071 135
170 3300033527 Ga0316586_1084610 Ga0316586_10846101 135
171 3300033541 Ga0316596_1058221 Ga0316596_10582212 135
172 3300033541 Ga0316596_1093904 Ga0316596_10939041 135
173 3300033541 Ga0316596_1172663 Ga0316596_11726631 135
174 3300033541 Ga0316596_1190010 Ga0316596_11900101 135
175 3300035090 Ga0373949_0229966 Ga0373949_0229966_127_534 135
176 3300035398 Ga0316574_0000443 Ga0316574_0000443_143_559 135
177 3300035398 Ga0316574_0298645 Ga0316574_0298645_194_616 135
178 3300035398 Ga0316574_0554495 Ga0316574_0554495_147_563 135
179 3300036647 Ga0316582_0000340 Ga0316582_0000340_12199_12621 135
180 3300036647 Ga0316582_0022345 Ga0316582_0022345_1024_1440 135
181 3300036647 Ga0316582_0058863 Ga0316582_0058863_707_1123 135
182 3300036647 Ga0316582_0064728 Ga0316582_0064728_1242_1664 135
183 3300036647 Ga0316582_0078770 Ga0316582_0078770_1229_1663 135
184 3300036647 Ga0316582_0112203 Ga0316582_0112203_470_892 135
185 3300036647 Ga0316582_0293209 Ga0316582_0293209_258_674 135
186 3300036647 Ga0316582_0589873 Ga0316582_0589873_18_440 135
187 3300036712 Ga0316584_0001744 Ga0316584_0001744_1379_1801 135
188 3300036712 Ga0316584_0062423 Ga0316584_0062423_1470_1886 135
189 3300036712 Ga0316584_0074624 Ga0316584_0074624_689_1111 135
190 3300036712 Ga0316584_0100793 Ga0316584_0100793_1563_1979 135
191 3300036712 Ga0316584_0607061 Ga0316584_0607061_168_590 135
192 3300039110 Ga0400487_16904 Ga0400487_16904_724_1137 135
193 3300042876 Ga0451577_0121407 Ga0451577_0121407_61_468 135
194 3300042876 Ga0451577_0158361 Ga0451577_0158361_997_1404 135
195 3300042876 Ga0451577_0286170 Ga0451577_0286170_840_1247 135
196 3300042876 Ga0451577_0401182 Ga0451577_0401182_565_1011 135
197 3300042876 Ga0451577_0608231 Ga0451577_0608231_88_495 135
198 3300042876 Ga0451577_0726616 Ga0451577_0726616_111_536 135
199 3300042876 Ga0451577_0858538 Ga0451577_0858538_280_690 135
200 3300042876 Ga0451577_0911158 Ga0451577_0911158_345_770 135
201 3300044673 Ga0453683_0193954 Ga0453683_0193954_491_898 135
202 3300044673 Ga0453683_0229169 Ga0453683_0229169_189_596 135
203 3300044712 Ga0453684_0000520 Ga0453684_0000520_95608_96030 135
204 3300044712 Ga0453684_0004883 Ga0453684_0004883_18218_18664 135
205 3300044712 Ga0453684_0030456 Ga0453684_0030456_4379_4807 135
206 3300044712 Ga0453684_0057333 Ga0453684_0057333_4590_5000 135
207 3300044712 Ga0453684_0126062 Ga0453684_0126062_2064_2492 135
208 3300044712 Ga0453684_0172366 Ga0453684_0172366_323_763 135
209 3300044712 Ga0453684_0209586 Ga0453684_0209586_1061_1468 135
210 3300044712 Ga0453684_0429321 Ga0453684_0429321_85_543 135
211 3300044712 Ga0453684_0517026 Ga0453684_0517026_564_971 135
212 3300044712 Ga0453684_0564566 Ga0453684_0564566_52_486 135
213 3300044712 Ga0453684_0577830 Ga0453684_0577830_93_545 135
214 3300044712 Ga0453684_0621619 Ga0453684_0621619_209_631 135
215 3300044712 Ga0453684_0641564 Ga0453684_0641564_508_933 135
216 3300044712 Ga0453684_0818744 Ga0453684_0818744_341_748 135
217 3300044712 Ga0453684_0824719 Ga0453684_0824719_263_688 135
218 3300044712 Ga0453684_0916064 Ga0453684_0916064_231_641 135
219 3300044712 Ga0453684_1009263 Ga0453684_1009263_347_754 135
220 3300044712 Ga0453684_1519215 Ga0453684_1519215_29_436 135
221 3300045051 Ga0451576_0053753 Ga0451576_0053753_1805_2230 135
222 3300045051 Ga0451576_0246956 Ga0451576_0246956_1228_1635 135
223 3300045051 Ga0451576_0283052 Ga0451576_0283052_300_707 135
224 3300045051 Ga0451576_0947923 Ga0451576_0947923_55_462 135
225 3300045051 Ga0451576_1477005 Ga0451576_1477005_72_479 135
226 3300045051 Ga0451576_2205135 Ga0451576_2205135_46_471 135
227 3300045051 Ga0451576_2277077 Ga0451576_2277077_77_484 135
228 3300046691 Ga0495670_0238836 Ga0495670_0238836_53_460 135
229 3300047318 Ga0495636_0492558 Ga0495636_0492558_135_542 135
230 3300048909 Ga0496106_0033317 Ga0496106_0033317_3330_3737 135
231 3300049521 Ga0501298_085279 Ga0501298_085279_232_639 135
232 3300049522 Ga0501299_136339 Ga0501299_136339_46_453 135
233 3300049572 Ga0501036_0458991 Ga0501036_0458991_549_962 135
234 3300049573 Ga0501037_0913040 Ga0501037_0913040_45_458 135
235 3300049575 Ga0501039_1202201 Ga0501039_1202201_157_564 135
236 3300049576 Ga0501040_0230350 Ga0501040_0230350_647_1060 135
237 3300049577 Ga0501041_0848357 Ga0501041_0848357_73_486 135
238 3300049578 Ga0501042_0310661 Ga0501042_0310661_127_534 135
239 3300049582 Ga0501048_0685915 Ga0501048_0685915_239_646 135
240 3300049587 Ga0501071_0351609 Ga0501071_0351609_656_1069 135
241 3300049588 Ga0501072_0163538 Ga0501072_0163538_89_496 135
242 3300049588 Ga0501072_1336390 Ga0501072_1336390_86_493 135
243 3300049588 Ga0501072_1346455 Ga0501072_1346455_103_510 135
244 3300049590 Ga0501074_0108937 Ga0501074_0108937_540_953 135
245 3300049590 Ga0501074_0415592 Ga0501074_0415592_277_690 135
246 3300049591 Ga0501075_0013517 Ga0501075_0013517_3072_3485 135
247 3300049591 Ga0501075_0132919 Ga0501075_0132919_22_429 135
248 3300049592 Ga0501076_0025325 Ga0501076_0025325_2094_2597 135
249 3300049592 Ga0501076_0029958 Ga0501076_0029958_2100_2513 135
250 3300049592 Ga0501076_0167822 Ga0501076_0167822_1189_1596 135
251 3300049592 Ga0501076_0191546 Ga0501076_0191546_1036_1446 135
252 3300049656 Ga0501209_304316 Ga0501209_304316_49_459 135
253 3300049663 Ga0501223_128959 Ga0501223_128959_84_491 135
254 3300049668 Ga0501233_176021 Ga0501233_176021_52_459 135
255 3300049670 Ga0501236_063783 Ga0501236_063783_205_612 135
256 3300049741 Ga0501079_0072755 Ga0501079_0072755_409_822 135
257 3300049741 Ga0501079_0206687 Ga0501079_0206687_358_765 135
258 3300049741 Ga0501079_0726060 Ga0501079_0726060_319_732 135
259 3300049742 Ga0501080_0087859 Ga0501080_0087859_452_865 135
260 3300049743 Ga0501081_0051947 Ga0501081_0051947_797_1210 135
261 3300049743 Ga0501081_0429521 Ga0501081_0429521_480_887 135
262 3300049743 Ga0501081_0695961 Ga0501081_0695961_245_652 135
263 3300049778 Ga0501282_046629 Ga0501282_046629_83_490 135
264 3300049779 Ga0501283_091335 Ga0501283_091335_166_573 135
265 3300050507 nmdc:mga05p37_104886_c1 nmdc:mga05p37_104886_c1_2602_3015 135
266 3300050507 nmdc:mga05p37_1439929_c1 nmdc:mga05p37_1439929_c1_225_632 135
267 3300050507 nmdc:mga05p37_37854_c1 nmdc:mga05p37_37854_c1_2421_2918 135
268 3300050507 nmdc:mga05p37_434667_c1 nmdc:mga05p37_434667_c1_123_533 135
269 3300050507 nmdc:mga05p37_44641_c1 nmdc:mga05p37_44641_c1_2341_2748 135
270 3300050507 nmdc:mga05p37_99462_c1 nmdc:mga05p37_99462_c1_2931_3338 135
271 3300050508 nmdc:mga09592_1609800_c1 nmdc:mga09592_1609800_c1_81_488 135
272 3300050508 nmdc:mga09592_199181_c1 nmdc:mga09592_199181_c1_516_923 135
273 3300050508 nmdc:mga09592_279194_c1 nmdc:mga09592_279194_c1_676_1083 135
274 3300050508 nmdc:mga09592_435268_c1 nmdc:mga09592_435268_c1_634_1047 135
275 3300050508 nmdc:mga09592_8637_c1 nmdc:mga09592_8637_c1_1712_2209 135
276 3300050509 nmdc:mga0qj67_380555_c1 nmdc:mga0qj67_380555_c1_694_1101 135
277 3300050509 nmdc:mga0qj67_541182_c1 nmdc:mga0qj67_541182_c1_151_558 135
278 3300050510 nmdc:mga06r32_182162_c1 nmdc:mga06r32_182162_c1_1488_1985 135
279 3300050510 nmdc:mga06r32_35133_c1 nmdc:mga06r32_35133_c1_2889_3296 135
280 3300050510 nmdc:mga06r32_383512_c1 nmdc:mga06r32_383512_c1_772_1245 135
281 3300050511 nmdc:mga08y16_552095_c1 nmdc:mga08y16_552095_c1_350_757 135
282 3300050512 nmdc:mga0n895_583723_c1 nmdc:mga0n895_583723_c1_559_966 135
283 3300050515 nmdc:mga0a205_124792_c2 nmdc:mga0a205_124792_c2_404_814 135
284 3300050515 nmdc:mga0a205_225150_c1 nmdc:mga0a205_225150_c1_1077_1484 135
285 3300054114 Ga0501084_0007058 Ga0501084_0007058_6238_6651 135
286 3300060353 Ga0501082_0076823 Ga0501082_0076823_2277_2690 135
287 3300060353 Ga0501082_0095842 Ga0501082_0095842_734_1147 135
288 3300060353 Ga0501082_0185208 Ga0501082_0185208_104_517 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

33

163

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f22-assembly1.cif.gz_B crystal structure of zalpha in complex with d(cgtacg) 0.9105 8 67
3f23-assembly1.cif.gz_A crystal structure of zalpha in complex with d(cggccg) 0.9086 4 67
3irq-assembly1.cif.gz_A crystal structure of a z-z junction 0.9076 8 67
4hf2-assembly1.cif.gz_A crystal structure of e43a iscr mutant bound to its promoter 0.904 1 132
2lnb-assembly1.cif.gz_A solution nmr structure of n-terminal domain (6-74) of human zbp1 protein, northeast structural genomics consortium target hr8174a. 0.9035 5 70
ID Description Score Start End Superfamily
af_Q9H171_1_74_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9159 5 69 1.10.10.10
5zuoC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9116 10 67 1.10.10.10
3f22A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9098 4 67 1.10.10.10
af_P55265_129_209_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9074 6 69 1.10.10.10
4hf2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.904 1 132 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A523U450-F1-model_v4 Rrf2 family transcriptional regulator 0.926 1 130 GO:0003700
GO:0005829
AF-A0A7C4P5T0-F1-model_v4 Rrf2 family transcriptional regulator 0.9252 1 133 GO:0003700
GO:0005829
AF-A0A1F8NLS4-F1-model_v4 Rrf2 family transcriptional regulator 0.9243 1 134 GO:0003700
GO:0005829
AF-A0A7X6XJA7-F1-model_v4 Rrf2 family transcriptional regulator 0.9236 1 134 GO:0003700
GO:0005829
AF-A0A3S4V4P8-F1-model_v4 deleted 0.9235 1 135

Feature Viewer

pLDDT pTM Quality
87.13 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map