F388852

General Info

Members Datasets Scaffolds Average Seq Length
288 190 576 130

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0513533|Ga0501067_0513533_160_588
Length 131
Sequence MAAMPAESIRVTRSVTLPLEEIQLRFSRSSGPGGQHAQRSETRVEAVYDVEASTALTEAQKRRVIAKAGPTLRAVAQDERSQHRNRELAVEVPRKRRPTRPTAASRERRLDQKRXXSEVKRLRRGARDSIE

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
81 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
82 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
85 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
98 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
99 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
100 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
106 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
114 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
120 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
121 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
127 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 1.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.78
Rhizosphere 96.88
Stem 0
Stem Tuber 0
Unclassified 10.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0513533 3300049583 Bacteria 670
2 JGI25407J50210_10018665 3300003373 Unclassified 1803
3 Ga0070658_10017458 3300005327 Bacteria 5741
4 Ga0070658_10614867 3300005327 Bacteria 942
5 Ga0070683_100028025 3300005329 Bacteria 5087
6 Ga0070683_100029533 3300005329 Bacteria 4964
7 Ga0070670_100005425 3300005331 Archaea 10759
8 Ga0068869_100138547 3300005334 Bacteria 1877
9 Ga0070660_100080555 3300005339 Bacteria 2555
10 Ga0070687_100105030 3300005343 Bacteria 1589
11 Ga0070661_100774402 3300005344 Bacteria 786
12 Ga0070688_100033516 3300005365 Bacteria 3105
13 Ga0070709_10052340 3300005434 Bacteria 2565
14 Ga0070709_10534986 3300005434 Bacteria 895
15 Ga0070714_100172559 3300005435 Bacteria 1963
16 Ga0070713_101186137 3300005436 Unclassified 739
17 Ga0070710_10509376 3300005437 Bacteria 825
18 Ga0070694_100807219 3300005444 Bacteria 770
19 Ga0070678_100346730 3300005456 Bacteria 1275
20 Ga0070681_10805544 3300005458 Unclassified 856
21 Ga0070706_100245793 3300005467 Bacteria 1671
22 Ga0070707_101823323 3300005468 Unclassified 576
23 Ga0070699_100047910 3300005518 Bacteria 3698
24 Ga0070679_100273022 3300005530 Bacteria 1644
25 Ga0070684_100008630 3300005535 Archaea 7983
26 Ga0070672_100133476 3300005543 Bacteria 2043
27 Ga0070665_100101188 3300005548 Unclassified 2886
28 Ga0068855_100072216 3300005563 Bacteria 4012
29 Ga0068855_100076167 3300005563 Bacteria 3894
30 Ga0070664_100118393 3300005564 Bacteria 2317
31 Ga0070664_100279336 3300005564 Unclassified 1506
32 Ga0070664_100961243 3300005564 Unclassified 802
33 Ga0070702_100614215 3300005615 Bacteria 817
34 Ga0068852_100526468 3300005616 Bacteria 1180
35 Ga0068859_100152311 3300005617 Bacteria 2388
36 Ga0068864_100030085 3300005618 Bacteria 4602
37 Ga0081538_10000562 3300005981 Bacteria 41236
38 Ga0081538_10000853 3300005981 Bacteria 32893
39 Ga0081538_10010402 3300005981 Bacteria 7627
40 Ga0081539_10001284 3300005985 Bacteria 44182
41 Ga0070717_10331460 3300006028 Unclassified 1358
42 Ga0070716_100136595 3300006173 Unclassified 1558
43 Ga0068871_101347671 3300006358 Unclassified 672
44 Ga0075431_100076028 3300006847 Bacteria 3465
45 Ga0097620_100152313 3300006931 Bacteria 2388
46 Ga0075435_101011153 3300007076 Unclassified 726
47 Ga0111539_10825785 3300009094 Unclassified 1078
48 Ga0111539_11667965 3300009094 Bacteria 739
49 Ga0105245_10353565 3300009098 Bacteria 1456
50 Ga0105245_11611291 3300009098 Unclassified 701
51 Ga0105247_10717849 3300009101 Bacteria 754
52 Ga0114129_10035872 3300009147 Bacteria 7003
53 Ga0114129_10173819 3300009147 Unclassified 2935
54 Ga0114129_11742791 3300009147 Unclassified 759
55 Ga0105243_10244233 3300009148 Bacteria 1599
56 Ga0105242_10060157 3300009176 Bacteria 3120
57 Ga0105237_11841601 3300009545 Bacteria 613
58 Ga0105239_10411117 3300010375 Bacteria 1532
59 Ga0105246_10471584 3300011119 Bacteria 1060
60 Ga0157375_10055141 3300013308 Bacteria 3918
61 Ga0163163_10122846 3300014325 Bacteria 2631
62 Ga0157377_10013165 3300014745 Bacteria 4180
63 Ga0157376_10292706 3300014969 Bacteria 1538
64 Ga0182007_10033092 3300015262 Bacteria 1753
65 Ga0206356_11236435 3300020070 Bacteria 2417
66 Ga0206353_11867585 3300020082 Bacteria 1697
67 Ga0206353_12016091 3300020082 Bacteria 3625
68 Ga0207688_10005032 3300025901 Bacteria 7187
69 Ga0207699_10118146 3300025906 Bacteria 1710
70 Ga0207643_10096254 3300025908 Unclassified 1731
71 Ga0207705_10085132 3300025909 Unclassified 2309
72 Ga0207705_10474795 3300025909 Bacteria 971
73 Ga0207695_10114961 3300025913 Unclassified 2666
74 Ga0207693_10371810 3300025915 Bacteria 1118
75 Ga0207660_10108020 3300025917 Bacteria 2089
76 Ga0207657_10012634 3300025919 Bacteria 8323
77 Ga0207652_10185066 3300025921 Bacteria 1873
78 Ga0207650_10060474 3300025925 Bacteria 2827
79 Ga0207659_10159269 3300025926 Bacteria 1770
80 Ga0207687_10662522 3300025927 Bacteria 884
81 Ga0207700_10000028 3300025928 Bacteria 135555
82 Ga0207664_10171040 3300025929 Bacteria 1859
83 Ga0207664_10577581 3300025929 Bacteria 1009
84 Ga0207704_10070751 3300025938 Unclassified 2211
85 Ga0207704_10707426 3300025938 Bacteria 835
86 Ga0207665_10001082 3300025939 Bacteria 18356
87 Ga0207691_10010005 3300025940 Bacteria 9106
88 Ga0207661_10138437 3300025944 Bacteria 2093
89 Ga0207679_10104155 3300025945 Bacteria 2226
90 Ga0207667_10081555 3300025949 Bacteria 3351
91 Ga0207667_10707934 3300025949 Bacteria 1009
92 Ga0207651_10100873 3300025960 Bacteria 2141
93 Ga0207676_10500734 3300026095 Bacteria 1153
94 Ga0207674_10038322 3300026116 Bacteria 4976
95 Ga0207683_10280824 3300026121 Unclassified 1522
96 Ga0207428_10019242 3300027907 Bacteria 5822
97 Ga0265326_10018324 3300028558 Unclassified 2016
98 Ga0265319_1053374 3300028563 Bacteria 1328
99 Ga0265319_1059034 3300028563 Bacteria 1248
100 Ga0265318_10072408 3300028577 Bacteria 1277
101 Ga0265318_10135245 3300028577 Bacteria 906
102 Ga0265338_10211424 3300028800 Bacteria 1456
103 Ga0265328_10116407 3300031239 Bacteria 995
104 Ga0265320_10023095 3300031240 Bacteria 3316
105 Ga0265314_10341865 3300031711 Bacteria 826
106 Ga0307409_100265104 3300031995 Bacteria 1579
107 Ga0307416_100020627 3300032002 Bacteria 4708
108 Ga0307415_100513403 3300032126 Bacteria 1050
109 Ga0373953_0178626 3300035117 Bacteria 915
110 Ga0373956_0048512 3300035119 Bacteria 1902
111 Ga0373937_0320988 3300036401 Bacteria 1465
112 Ga0395899_0145816 3300037312 Bacteria 1681
113 Ga0395899_0898304 3300037312 Unclassified 540
114 Ga0395900_0039951 3300037418 Bacteria 4835
115 Ga0395900_0086330 3300037418 Bacteria 3225
116 Ga0395900_0633093 3300037418 Bacteria 1008
117 Ga0395898_0031424 3300037466 Bacteria 5305
118 Ga0395898_0427663 3300037466 Unclassified 1262
119 Ga0395901_0025086 3300038443 Bacteria 6121
120 Ga0395901_0158514 3300038443 Bacteria 2377
121 Ga0395901_0241161 3300038443 Bacteria 1885
122 Ga0451804_0727906 3300041463 Bacteria 665
123 Ga0451851_0345565 3300041507 Bacteria 1157
124 Ga0439448_0011415 3300042005 Bacteria 2648
125 Ga0439440_0054386 3300042993 Bacteria 1008
126 Ga0466963_0109420 3300044694 Bacteria 1896
127 Ga0466971_0269263 3300044719 Bacteria 814
128 Ga0466967_1607260 3300045976 Bacteria 647
129 Ga0495651_0055520 3300046462 Bacteria 3043
130 Ga0495651_0108736 3300046462 Bacteria 2053
131 Ga0495605_0186978 3300046474 Bacteria 908
132 Ga0495584_0306548 3300046491 Bacteria 806
133 Ga0495608_0003222 3300046511 Bacteria 11685
134 Ga0495608_0071473 3300046511 Bacteria 2264
135 Ga0495616_0015343 3300046513 Bacteria 4260
136 Ga0495618_0073528 3300046514 Bacteria 2176
137 Ga0495618_0100059 3300046514 Bacteria 1855
138 Ga0495628_0291133 3300046516 Bacteria 1210
139 Ga0495628_0343801 3300046516 Bacteria 1098
140 Ga0495630_0410076 3300046517 Bacteria 1038
141 Ga0495631_0111504 3300046518 Bacteria 1176
142 Ga0495637_0062509 3300046520 Bacteria 1523
143 Ga0495644_0113652 3300046523 Bacteria 1028
144 Ga0495652_0045512 3300046529 Bacteria 3771
145 Ga0495654_0127214 3300046530 Bacteria 1147
146 Ga0495640_0032496 3300046533 Bacteria 3717
147 Ga0495640_0142784 3300046533 Bacteria 1543
148 Ga0495587_0049145 3300046536 Bacteria 2497
149 Ga0495598_0080875 3300046537 Bacteria 1042
150 Ga0495597_0044856 3300046542 Bacteria 1965
151 Ga0495633_0058420 3300046558 Bacteria 1811
152 Ga0495667_0079736 3300046559 Bacteria 2128
153 Ga0495634_0090980 3300046642 Bacteria 1981
154 Ga0495634_0386126 3300046642 Bacteria 834
155 Ga0495611_0049053 3300046648 Bacteria 1899
156 Ga0495635_0052898 3300046663 Bacteria 2797
157 Ga0495635_0118649 3300046663 Bacteria 1805
158 Ga0495659_0102618 3300046664 Bacteria 1109
159 Ga0495661_0151372 3300046665 Bacteria 1253
160 Ga0495657_0059603 3300046675 Bacteria 2532
161 Ga0495657_0073721 3300046675 Bacteria 2222
162 Ga0495646_0094085 3300046680 Bacteria 1726
163 Ga0495670_0085689 3300046691 Bacteria 1608
164 Ga0495589_0174414 3300046794 Bacteria 1021
165 Ga0495660_0058143 3300046810 Bacteria 2084
166 Ga0495604_0447078 3300047317 Bacteria 845
167 Ga0495674_0053985 3300047319 Bacteria 3530
168 Ga0495680_0003404 3300047322 Bacteria 15696
169 Ga0495680_0242094 3300047322 Bacteria 1281
170 Ga0495683_0488754 3300047323 Unclassified 501
171 Ga0495675_0096649 3300047444 Bacteria 1852
172 Ga0495677_0041978 3300047445 Bacteria 1675
173 Ga0495673_0167931 3300047469 Bacteria 838
174 Ga0495684_0036918 3300047471 Bacteria 3746
175 Ga0495684_0161456 3300047471 Bacteria 1671
176 Ga0495615_0014538 3300048090 Bacteria 1666
177 Ga0496104_0274335 3300048907 Bacteria 1599
178 Ga0496104_0590700 3300048907 Bacteria 1021
179 Ga0496105_0046157 3300048908 Bacteria 3596
180 Ga0496106_0021123 3300048909 Bacteria 4834
181 Ga0496110_0058795 3300048913 Bacteria 3386
182 Ga0496111_0030268 3300048914 Bacteria 3850
183 Ga0496114_0075653 3300048917 Unclassified 2836
184 Ga0501031_0001953 3300049568 Bacteria 12999
185 Ga0501031_0161936 3300049568 Bacteria 1462
186 Ga0501032_0106460 3300049569 Bacteria 1857
187 Ga0501033_0001164 3300049570 Bacteria 23800
188 Ga0501033_0046451 3300049570 Bacteria 3229
189 Ga0501036_0052834 3300049572 Bacteria 3441
190 Ga0501036_0053329 3300049572 Bacteria 3424
191 Ga0501036_0252999 3300049572 Bacteria 1476
192 Ga0501036_0253798 3300049572 Bacteria 1473
193 Ga0501037_0015453 3300049573 Bacteria 5618
194 Ga0501038_0019415 3300049574 Bacteria 6125
195 Ga0501038_0052782 3300049574 Bacteria 3503
196 Ga0501038_0068173 3300049574 Bacteria 3025
197 Ga0501038_0216689 3300049574 Bacteria 1529
198 Ga0501039_0003315 3300049575 Bacteria 12041
199 Ga0501039_0024937 3300049575 Bacteria 4594
200 Ga0501039_0029023 3300049575 Bacteria 4259
201 Ga0501040_0011880 3300049576 Bacteria 5696
202 Ga0501040_0066560 3300049576 Bacteria 2482
203 Ga0501040_0092812 3300049576 Bacteria 2099
204 Ga0501040_0387801 3300049576 Bacteria 1002
205 Ga0501040_1161915 3300049576 Bacteria 560
206 Ga0501041_0001797 3300049577 Bacteria 12014
207 Ga0501041_0009157 3300049577 Bacteria 5830
208 Ga0501041_0088129 3300049577 Bacteria 1915
209 Ga0501041_0419246 3300049577 Bacteria 849
210 Ga0501042_0019739 3300049578 Bacteria 4685
211 Ga0501042_0026783 3300049578 Bacteria 4051
212 Ga0501042_0295156 3300049578 Bacteria 1171
213 Ga0501043_0005336 3300049579 Bacteria 10386
214 Ga0501043_0323740 3300049579 Bacteria 1175
215 Ga0501046_0024694 3300049580 Bacteria 4925
216 Ga0501046_0198281 3300049580 Bacteria 1494
217 Ga0501048_0017658 3300049582 Bacteria 5251
218 Ga0501048_0025611 3300049582 Bacteria 4300
219 Ga0501048_0070697 3300049582 Bacteria 2465
220 Ga0501048_0769306 3300049582 Bacteria 692
221 Ga0501068_0001051 3300049584 Bacteria 14629
222 Ga0501068_0190639 3300049584 Bacteria 1298
223 Ga0501069_0001394 3300049585 Bacteria 11864
224 Ga0501070_0010399 3300049586 Bacteria 7866
225 Ga0501071_0011778 3300049587 Bacteria 5899
226 Ga0501071_0016177 3300049587 Bacteria 5127
227 Ga0501071_0046544 3300049587 Bacteria 3115
228 Ga0501071_0064574 3300049587 Bacteria 2656
229 Ga0501071_0097954 3300049587 Bacteria 2159
230 Ga0501071_0362451 3300049587 Unclassified 1104
231 Ga0501072_0003142 3300049588 Bacteria 12427
232 Ga0501072_0006063 3300049588 Bacteria 9227
233 Ga0501072_0020956 3300049588 Bacteria 5067
234 Ga0501072_0462453 3300049588 Bacteria 1004
235 Ga0501072_0847847 3300049588 Bacteria 715
236 Ga0501073_0029774 3300049589 Bacteria 3901
237 Ga0501074_0018032 3300049590 Bacteria 5127
238 Ga0501074_0254952 3300049590 Bacteria 1247
239 Ga0501075_0010268 3300049591 Bacteria 6578
240 Ga0501075_0015269 3300049591 Bacteria 5509
241 Ga0501075_0180321 3300049591 Bacteria 1611
242 Ga0501075_0544909 3300049591 Bacteria 885
243 Ga0501076_0008497 3300049592 Bacteria 7525
244 Ga0501076_0090401 3300049592 Bacteria 2462
245 Ga0501076_0113434 3300049592 Unclassified 2192
246 Ga0501076_0310352 3300049592 Bacteria 1293
247 Ga0501076_0479237 3300049592 Bacteria 1025
248 Ga0501077_0003870 3300049593 Bacteria 9023
249 Ga0501077_0017773 3300049593 Bacteria 4492
250 Ga0501077_0147501 3300049593 Bacteria 1492
251 Ga0501079_0004333 3300049741 Bacteria 10530
252 Ga0501079_0027163 3300049741 Bacteria 4387
253 Ga0501079_0231788 3300049741 Bacteria 1442
254 Ga0501080_0058000 3300049742 Bacteria 3605
255 Ga0501080_0063349 3300049742 Bacteria 3441
256 Ga0501080_0854600 3300049742 Bacteria 795
257 Ga0501081_0030364 3300049743 Bacteria 3658
258 Ga0501081_0072719 3300049743 Bacteria 2397
259 Ga0501081_0656651 3300049743 Bacteria 786
260 Ga0501081_1131819 3300049743 Bacteria 592
261 Ga0501083_0002572 3300049744 Bacteria 12477
262 Ga0501035_0001358 3300049822 Bacteria 25181
263 Ga0501035_0171020 3300049822 Bacteria 1877
264 Ga0501045_0005910 3300049824 Bacteria 8466
265 Ga0501045_0010848 3300049824 Bacteria 6388
266 Ga0501045_0023433 3300049824 Bacteria 4425
267 nmdc:mga05p37_267077_c1 3300050507 Bacteria 2046
268 nmdc:mga09592_1637167_c1 3300050508 Unclassified 520
269 nmdc:mga08y16_546949_c1 3300050511 Bacteria 1172
270 nmdc:mga08y16_9177_c1 3300050511 Bacteria 10383
271 nmdc:mga0rr50_1443161_c1 3300050513 Bacteria 582
272 nmdc:mga0rr50_906816_c1 3300050513 Unclassified 751
273 nmdc:mga0a205_28604_c1 3300050515 Bacteria 5330
274 Ga0495601_0023272 3300053077 Bacteria 3806
275 Ga0495612_0187486 3300053078 Bacteria 910
276 Ga0495595_0008508 3300053084 Bacteria 4214
277 Ga0495619_0106799 3300053085 Bacteria 1909
278 Ga0495619_0108926 3300053085 Bacteria 1891
279 Ga0501084_0013701 3300054114 Bacteria 6712
280 Ga0501084_0025040 3300054114 Bacteria 4979
281 Ga0501084_0110502 3300054114 Bacteria 2309
282 Ga0590074_016857 3300059423 Unclassified 1246
283 Ga0501082_0027473 3300060353 Bacteria 4898
284 Ga0501082_0057552 3300060353 Bacteria 3349
285 Ga0466962_0177476 3300061719 Bacteria 1038
286 Ga0530510_0008413 3300061734 Bacteria 7191
287 Ga0530510_0042169 3300061734 Bacteria 3296
288 Ga0530510_0050183 3300061734 Bacteria 3013
289 Ga0501067_0513533
290 JGI25407J50210_10018665
291 Ga0070658_10017458
292 Ga0070658_10614867
293 Ga0070683_100028025
294 Ga0070683_100029533
295 Ga0070670_100005425
296 Ga0068869_100138547
297 Ga0070660_100080555
298 Ga0070687_100105030
299 Ga0070661_100774402
300 Ga0070688_100033516
301 Ga0070709_10052340
302 Ga0070709_10534986
303 Ga0070714_100172559
304 Ga0070713_101186137
305 Ga0070710_10509376
306 Ga0070694_100807219
307 Ga0070678_100346730
308 Ga0070681_10805544
309 Ga0070706_100245793
310 Ga0070707_101823323
311 Ga0070699_100047910
312 Ga0070679_100273022
313 Ga0070684_100008630
314 Ga0070672_100133476
315 Ga0070665_100101188
316 Ga0068855_100072216
317 Ga0068855_100076167
318 Ga0070664_100118393
319 Ga0070664_100279336
320 Ga0070664_100961243
321 Ga0070702_100614215
322 Ga0068852_100526468
323 Ga0068859_100152311
324 Ga0068864_100030085
325 Ga0081538_10000562
326 Ga0081538_10000853
327 Ga0081538_10010402
328 Ga0081539_10001284
329 Ga0070717_10331460
330 Ga0070716_100136595
331 Ga0068871_101347671
332 Ga0075431_100076028
333 Ga0097620_100152313
334 Ga0075435_101011153
335 Ga0111539_10825785
336 Ga0111539_11667965
337 Ga0105245_10353565
338 Ga0105245_11611291
339 Ga0105247_10717849
340 Ga0114129_10035872
341 Ga0114129_10173819
342 Ga0114129_11742791
343 Ga0105243_10244233
344 Ga0105242_10060157
345 Ga0105237_11841601
346 Ga0105239_10411117
347 Ga0105246_10471584
348 Ga0157375_10055141
349 Ga0163163_10122846
350 Ga0157377_10013165
351 Ga0157376_10292706
352 Ga0182007_10033092
353 Ga0206356_11236435
354 Ga0206353_11867585
355 Ga0206353_12016091
356 Ga0207688_10005032
357 Ga0207699_10118146
358 Ga0207643_10096254
359 Ga0207705_10085132
360 Ga0207705_10474795
361 Ga0207695_10114961
362 Ga0207693_10371810
363 Ga0207660_10108020
364 Ga0207657_10012634
365 Ga0207652_10185066
366 Ga0207650_10060474
367 Ga0207659_10159269
368 Ga0207687_10662522
369 Ga0207700_10000028
370 Ga0207664_10171040
371 Ga0207664_10577581
372 Ga0207704_10070751
373 Ga0207704_10707426
374 Ga0207665_10001082
375 Ga0207691_10010005
376 Ga0207661_10138437
377 Ga0207679_10104155
378 Ga0207667_10081555
379 Ga0207667_10707934
380 Ga0207651_10100873
381 Ga0207676_10500734
382 Ga0207674_10038322
383 Ga0207683_10280824
384 Ga0207428_10019242
385 Ga0265326_10018324
386 Ga0265319_1053374
387 Ga0265319_1059034
388 Ga0265318_10072408
389 Ga0265318_10135245
390 Ga0265338_10211424
391 Ga0265328_10116407
392 Ga0265320_10023095
393 Ga0265314_10341865
394 Ga0307409_100265104
395 Ga0307416_100020627
396 Ga0307415_100513403
397 Ga0373953_0178626
398 Ga0373956_0048512
399 Ga0373937_0320988
400 Ga0395899_0145816
401 Ga0395899_0898304
402 Ga0395900_0039951
403 Ga0395900_0086330
404 Ga0395900_0633093
405 Ga0395898_0031424
406 Ga0395898_0427663
407 Ga0395901_0025086
408 Ga0395901_0158514
409 Ga0395901_0241161
410 Ga0451804_0727906
411 Ga0451851_0345565
412 Ga0439448_0011415
413 Ga0439440_0054386
414 Ga0466963_0109420
415 Ga0466971_0269263
416 Ga0466967_1607260
417 Ga0495651_0055520
418 Ga0495651_0108736
419 Ga0495605_0186978
420 Ga0495584_0306548
421 Ga0495608_0003222
422 Ga0495608_0071473
423 Ga0495616_0015343
424 Ga0495618_0073528
425 Ga0495618_0100059
426 Ga0495628_0291133
427 Ga0495628_0343801
428 Ga0495630_0410076
429 Ga0495631_0111504
430 Ga0495637_0062509
431 Ga0495644_0113652
432 Ga0495652_0045512
433 Ga0495654_0127214
434 Ga0495640_0032496
435 Ga0495640_0142784
436 Ga0495587_0049145
437 Ga0495598_0080875
438 Ga0495597_0044856
439 Ga0495633_0058420
440 Ga0495667_0079736
441 Ga0495634_0090980
442 Ga0495634_0386126
443 Ga0495611_0049053
444 Ga0495635_0052898
445 Ga0495635_0118649
446 Ga0495659_0102618
447 Ga0495661_0151372
448 Ga0495657_0059603
449 Ga0495657_0073721
450 Ga0495646_0094085
451 Ga0495670_0085689
452 Ga0495589_0174414
453 Ga0495660_0058143
454 Ga0495604_0447078
455 Ga0495674_0053985
456 Ga0495680_0003404
457 Ga0495680_0242094
458 Ga0495683_0488754
459 Ga0495675_0096649
460 Ga0495677_0041978
461 Ga0495673_0167931
462 Ga0495684_0036918
463 Ga0495684_0161456
464 Ga0495615_0014538
465 Ga0496104_0274335
466 Ga0496104_0590700
467 Ga0496105_0046157
468 Ga0496106_0021123
469 Ga0496110_0058795
470 Ga0496111_0030268
471 Ga0496114_0075653
472 Ga0501031_0001953
473 Ga0501031_0161936
474 Ga0501032_0106460
475 Ga0501033_0001164
476 Ga0501033_0046451
477 Ga0501036_0052834
478 Ga0501036_0053329
479 Ga0501036_0252999
480 Ga0501036_0253798
481 Ga0501037_0015453
482 Ga0501038_0019415
483 Ga0501038_0052782
484 Ga0501038_0068173
485 Ga0501038_0216689
486 Ga0501039_0003315
487 Ga0501039_0024937
488 Ga0501039_0029023
489 Ga0501040_0011880
490 Ga0501040_0066560
491 Ga0501040_0092812
492 Ga0501040_0387801
493 Ga0501040_1161915
494 Ga0501041_0001797
495 Ga0501041_0009157
496 Ga0501041_0088129
497 Ga0501041_0419246
498 Ga0501042_0019739
499 Ga0501042_0026783
500 Ga0501042_0295156
501 Ga0501043_0005336
502 Ga0501043_0323740
503 Ga0501046_0024694
504 Ga0501046_0198281
505 Ga0501048_0017658
506 Ga0501048_0025611
507 Ga0501048_0070697
508 Ga0501048_0769306
509 Ga0501068_0001051
510 Ga0501068_0190639
511 Ga0501069_0001394
512 Ga0501070_0010399
513 Ga0501071_0011778
514 Ga0501071_0016177
515 Ga0501071_0046544
516 Ga0501071_0064574
517 Ga0501071_0097954
518 Ga0501071_0362451
519 Ga0501072_0003142
520 Ga0501072_0006063
521 Ga0501072_0020956
522 Ga0501072_0462453
523 Ga0501072_0847847
524 Ga0501073_0029774
525 Ga0501074_0018032
526 Ga0501074_0254952
527 Ga0501075_0010268
528 Ga0501075_0015269
529 Ga0501075_0180321
530 Ga0501075_0544909
531 Ga0501076_0008497
532 Ga0501076_0090401
533 Ga0501076_0113434
534 Ga0501076_0310352
535 Ga0501076_0479237
536 Ga0501077_0003870
537 Ga0501077_0017773
538 Ga0501077_0147501
539 Ga0501079_0004333
540 Ga0501079_0027163
541 Ga0501079_0231788
542 Ga0501080_0058000
543 Ga0501080_0063349
544 Ga0501080_0854600
545 Ga0501081_0030364
546 Ga0501081_0072719
547 Ga0501081_0656651
548 Ga0501081_1131819
549 Ga0501083_0002572
550 Ga0501035_0001358
551 Ga0501035_0171020
552 Ga0501045_0005910
553 Ga0501045_0010848
554 Ga0501045_0023433
555 nmdc:mga05p37_267077_c1
556 nmdc:mga09592_1637167_c1
557 nmdc:mga08y16_546949_c1
558 nmdc:mga08y16_9177_c1
559 nmdc:mga0rr50_1443161_c1
560 nmdc:mga0rr50_906816_c1
561 nmdc:mga0a205_28604_c1
562 Ga0495601_0023272
563 Ga0495612_0187486
564 Ga0495595_0008508
565 Ga0495619_0106799
566 Ga0495619_0108926
567 Ga0501084_0013701
568 Ga0501084_0025040
569 Ga0501084_0110502
570 Ga0590074_016857
571 Ga0501082_0027473
572 Ga0501082_0057552
573 Ga0466962_0177476
574 Ga0530510_0008413
575 Ga0530510_0042169
576 Ga0530510_0050183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00472

RF-1

RF-1 domain

9

127

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h4n-assembly1.cif.gz_x structure of a hibernating 100s ribosome reveals an inactive conformation of the ribosomal protein s1 - 70s hibernating e. coli ribosome 0.8165 20 95
2rtx-assembly1.cif.gz_A solution structure of the ggq domain of yaej protein from escherichia coli 0.7639 8 111
4ce4-assembly1.cif.gz_u 39s large subunit of the porcine mitochondrial ribosome 0.7274 15 101
2jva-assembly1.cif.gz_A nmr solution structure of peptidyl-trna hydrolase domain protein from pseudomonas syringae pv. tomato. northeast structural genomics consortium target psr211 0.7259 7 104
3j7y-assembly1.cif.gz_p structure of the large ribosomal subunit from human mitochondria 0.7208 16 100
ID Description Score Start End Superfamily
2rtxA00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7639 8 111 3.30.160.20
2b3tB03 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7296 18 98 3.30.160.20
2jvaA00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7259 7 104 3.30.160.20
3j7yp00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7208 16 100 3.30.160.20
3j7yp00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6988 16 100 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A1N7D0J6-F1-model_v4 Ribosome-associated protein 0.9377 6 64 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-A0A7V9FYZ4-F1-model_v4 HAD hydrolase-like protein 0.9073 3 103 GO:0003747
GO:0005737
GO:0016791
AF-A0A838V0D5-F1-model_v4 Prokaryotic-type class I peptide chain release factors domain-containing protein 0.9054 3 100 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-A0A7X5WQ63-F1-model_v4 Aminoacyl-tRNA hydrolase 0.9049 15 78
AF-A0A661A123-F1-model_v4 Aminoacyl-tRNA hydrolase 0.9003 7 71 GO:0003747
GO:0004045
GO:0043022
GO:0072344

Map