F388582

General Info

Members Datasets Scaffolds Average Seq Length
288 201 576 157

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10198154|Ga0163162_101981544
Length 187
Sequence LGLLFFEFPVTKFKFINNNFVITCFKIIIVITREEKFMKEAVELSRSGCISNDGGPFGCVVVKGDKIVGRGNNKVICNNDPTAHAEVVAIRDACKNLNSFQLEDCEIYTSCEPCPMCLGAIYWARPKVVYYANNRQDAANIGFDDSMIYDEMGLEPHKRKIPVIAMGKDDALKIFEEWIKKHNKTLY

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
128 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
129 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
130 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
131 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
132 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
133 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
134 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
137 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
149 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
150 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
151 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
152 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
153 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
158 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
159 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
160 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
161 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
162 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
163 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
164 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
165 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
166 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
167 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
168 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
169 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
170 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
171 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
172 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
173 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
174 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
175 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
176 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
177 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
178 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
179 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
180 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
181 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
182 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
183 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
184 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
185 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
186 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
187 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
188 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
189 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
190 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
191 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
192 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
193 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
199 2818991444 Filimonas endophytica 3197 Isolate Unclassified
200 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
201 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0
Isolates 1.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 0.35
Rhizosphere 96.18
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10198154 3300013306 Unclassified 2137
2 Ga0065714_10068892 3300005288 Bacteria 4491
3 Ga0065704_10367807 3300005289 Bacteria 789
4 Ga0070670_100020891 3300005331 Bacteria 5631
5 Ga0068869_100124353 3300005334 Unclassified 1977
6 Ga0068869_100767325 3300005334 Bacteria 827
7 Ga0070666_10001384 3300005335 Bacteria 14685
8 Ga0070666_10361931 3300005335 Bacteria 1039
9 Ga0070680_100017537 3300005336 Bacteria 5646
10 Ga0068868_100003664 3300005338 Bacteria 10728
11 Ga0068868_100638694 3300005338 Bacteria 947
12 Ga0070660_100000583 3300005339 Bacteria 24522
13 Ga0070660_100627354 3300005339 Bacteria 900
14 Ga0070692_10061737 3300005345 Bacteria 1977
15 Ga0070668_100140027 3300005347 Bacteria 1949
16 Ga0070668_100332424 3300005347 Unclassified 1282
17 Ga0070668_100607355 3300005347 Bacteria 957
18 Ga0070669_100090700 3300005353 Unclassified 2291
19 Ga0070675_100810853 3300005354 Bacteria 856
20 Ga0070671_100217409 3300005355 Bacteria 1621
21 Ga0070671_100828330 3300005355 Unclassified 806
22 Ga0070674_100080807 3300005356 Bacteria 2322
23 Ga0070673_100254972 3300005364 Bacteria 1530
24 Ga0070659_100022054 3300005366 Bacteria 4859
25 Ga0070667_100266735 3300005367 Bacteria 1534
26 Ga0070667_100448862 3300005367 Bacteria 1178
27 Ga0070667_100949450 3300005367 Bacteria 801
28 Ga0070667_101376147 3300005367 Bacteria 662
29 Ga0070663_100067486 3300005455 Bacteria 2595
30 Ga0070681_10011796 3300005458 Bacteria 8663
31 Ga0068867_100025303 3300005459 Bacteria 4258
32 Ga0068867_100111776 3300005459 Bacteria 2100
33 Ga0068867_100213507 3300005459 Bacteria 1551
34 Ga0070679_100008240 3300005530 Bacteria 9802
35 Ga0070679_100140029 3300005530 Bacteria 2399
36 Ga0070684_100482773 3300005535 Bacteria 1147
37 Ga0070704_100533463 3300005549 Bacteria 1023
38 Ga0068855_100013330 3300005563 Bacteria 9917
39 Ga0068855_100158359 3300005563 Bacteria 2572
40 Ga0068855_100583684 3300005563 Bacteria 1207
41 Ga0068857_100022160 3300005577 Bacteria 5588
42 Ga0068854_100129642 3300005578 Bacteria 1924
43 Ga0068856_100012198 3300005614 Bacteria 8325
44 Ga0068852_100004389 3300005616 Bacteria 9968
45 Ga0068852_100579470 3300005616 Bacteria 1125
46 Ga0068852_101314898 3300005616 Unclassified 745
47 Ga0068859_100002895 3300005617 Bacteria 17441
48 Ga0068859_100335250 3300005617 Bacteria 1607
49 Ga0068859_100429170 3300005617 Bacteria 1418
50 Ga0068864_100006057 3300005618 Bacteria 9923
51 Ga0068864_100085031 3300005618 Bacteria 2780
52 Ga0068866_10022339 3300005718 Bacteria 2927
53 Ga0068861_101697379 3300005719 Bacteria 624
54 Ga0068851_10033020 3300005834 Bacteria 2577
55 Ga0068870_11131726 3300005840 Bacteria 564
56 Ga0068863_100005619 3300005841 Bacteria 12322
57 Ga0068863_100056989 3300005841 Unclassified 3698
58 Ga0068863_100074886 3300005841 Bacteria 3203
59 Ga0068858_100003124 3300005842 Bacteria 16573
60 Ga0068860_100001849 3300005843 Bacteria 22535
61 Ga0068860_100002566 3300005843 Bacteria 19005
62 Ga0068860_100008679 3300005843 Bacteria 10123
63 Ga0068860_100030171 3300005843 Bacteria 5215
64 Ga0068862_100048233 3300005844 Bacteria 3636
65 Ga0068862_100246082 3300005844 Bacteria 1628
66 Ga0097621_100041865 3300006237 Bacteria 3689
67 Ga0097621_100232930 3300006237 Unclassified 1608
68 Ga0068871_100013362 3300006358 Bacteria 6092
69 Ga0097620_100002895 3300006931 Bacteria 17441
70 Ga0097620_100335256 3300006931 Bacteria 1607
71 Ga0097620_100429179 3300006931 Bacteria 1418
72 Ga0075435_100424448 3300007076 Bacteria 1145
73 Ga0111539_10948168 3300009094 Bacteria 1000
74 Ga0105245_10531285 3300009098 Bacteria 1196
75 Ga0105247_10030249 3300009101 Bacteria 3282
76 Ga0105247_10349760 3300009101 Bacteria 1039
77 Ga0105243_11125102 3300009148 Bacteria 795
78 Ga0105241_10007998 3300009174 Bacteria 7778
79 Ga0105241_10141971 3300009174 Bacteria 1956
80 Ga0105242_10025922 3300009176 Bacteria 4643
81 Ga0105242_10638660 3300009176 Bacteria 1034
82 Ga0105237_10003238 3300009545 Bacteria 19477
83 Ga0105238_10524601 3300009551 Bacteria 1187
84 Ga0105249_10199242 3300009553 Bacteria 1959
85 Ga0105249_11651558 3300009553 Bacteria 713
86 Ga0105239_10066902 3300010375 Bacteria 3947
87 Ga0105246_10074642 3300011119 Bacteria 2398
88 Ga0157373_10010128 3300013100 Bacteria 6947
89 Ga0157373_10151222 3300013100 Bacteria 1633
90 Ga0157371_10004968 3300013102 Bacteria 11422
91 Ga0157371_10005501 3300013102 Bacteria 10662
92 Ga0157371_10015759 3300013102 Bacteria 5658
93 Ga0157371_10153451 3300013102 Bacteria 1643
94 Ga0157371_10161092 3300013102 Bacteria 1602
95 Ga0157370_10000290 3300013104 Bacteria 63441
96 Ga0157370_10007713 3300013104 Bacteria 11670
97 Ga0157370_10222368 3300013104 Bacteria 1749
98 Ga0157369_10015441 3300013105 Bacteria 8606
99 Ga0157369_10148328 3300013105 Bacteria 2480
100 Ga0157374_10078568 3300013296 Bacteria 3125
101 Ga0157378_10012426 3300013297 Bacteria 7456
102 Ga0157378_10014367 3300013297 Bacteria 6932
103 Ga0157378_10346806 3300013297 Bacteria 1449
104 Ga0157378_10773587 3300013297 Bacteria 984
105 Ga0163162_10000414 3300013306 Bacteria 39202
106 Ga0163162_10194477 3300013306 Bacteria 2157
107 Ga0157372_10070597 3300013307 Bacteria 3930
108 Ga0157372_10211037 3300013307 Bacteria 2250
109 Ga0157372_10340133 3300013307 Bacteria 1748
110 Ga0157375_10196653 3300013308 Bacteria 2171
111 Ga0157375_10649865 3300013308 Bacteria 1211
112 Ga0157375_12021950 3300013308 Bacteria 685
113 Ga0163163_10124726 3300014325 Bacteria 2612
114 Ga0163163_10204712 3300014325 Unclassified 2022
115 Ga0163163_11731932 3300014325 Bacteria 685
116 Ga0157380_10000701 3300014326 Bacteria 20886
117 Ga0157377_10134822 3300014745 Unclassified 1512
118 Ga0157379_10065229 3300014968 Bacteria 3255
119 Ga0157379_10092262 3300014968 Bacteria 2717
120 Ga0163161_10476988 3300017792 Bacteria 1012
121 Ga0213874_10005523 3300021377 Bacteria 2949
122 Ga0207642_10050702 3300025899 Bacteria 1873
123 Ga0207645_10318282 3300025907 Bacteria 1037
124 Ga0207705_10001125 3300025909 Bacteria 21755
125 Ga0207707_10750033 3300025912 Bacteria 816
126 Ga0207660_10022084 3300025917 Bacteria 4285
127 Ga0207657_10001364 3300025919 Bacteria 26041
128 Ga0207657_10364075 3300025919 Bacteria 1139
129 Ga0207657_10379219 3300025919 Unclassified 1114
130 Ga0207652_10000010 3300025921 Bacteria 247079
131 Ga0207652_10000475 3300025921 Bacteria 41112
132 Ga0207652_10519376 3300025921 Bacteria 1071
133 Ga0207681_10989257 3300025923 Bacteria 706
134 Ga0207650_10153488 3300025925 Bacteria 1819
135 Ga0207644_10121087 3300025931 Bacteria 1992
136 Ga0207690_10169877 3300025932 Bacteria 1633
137 Ga0207690_10610267 3300025932 Unclassified 891
138 Ga0207686_10012628 3300025934 Bacteria 4647
139 Ga0207669_10006100 3300025937 Bacteria 5474
140 Ga0207689_10514825 3300025942 Bacteria 1003
141 Ga0207661_10024854 3300025944 Bacteria 4547
142 Ga0207667_10002780 3300025949 Bacteria 21662
143 Ga0207667_10226393 3300025949 Bacteria 1916
144 Ga0207651_10892514 3300025960 Unclassified 791
145 Ga0207668_10016175 3300025972 Bacteria 4650
146 Ga0207640_10174166 3300025981 Bacteria 1607
147 Ga0207658_10031739 3300025986 Bacteria 3754
148 Ga0207658_10446653 3300025986 Bacteria 1144
149 Ga0207677_10005820 3300026023 Bacteria 6710
150 Ga0207677_10102817 3300026023 Bacteria 2107
151 Ga0207639_10189234 3300026041 Bacteria 1757
152 Ga0207678_10007815 3300026067 Bacteria 9441
153 Ga0207708_10272176 3300026075 Bacteria 1370
154 Ga0207641_10037327 3300026088 Bacteria 4057
155 Ga0207648_10006799 3300026089 Bacteria 11336
156 Ga0207648_10111273 3300026089 Bacteria 2404
157 Ga0207648_10980300 3300026089 Bacteria 791
158 Ga0207676_11683919 3300026095 Bacteria 632
159 Ga0207674_10013121 3300026116 Bacteria 9221
160 Ga0207674_10056103 3300026116 Bacteria 4001
161 Ga0207674_10458066 3300026116 Bacteria 1233
162 Ga0207674_10663370 3300026116 Bacteria 1007
163 Ga0207675_100291466 3300026118 Bacteria 1587
164 Ga0207698_10805119 3300026142 Unclassified 942
165 Ga0268264_10007641 3300028381 Bacteria 9010
166 Ga0268264_10035787 3300028381 Bacteria 4088
167 Ga0265324_10054313 3300029957 Bacteria 1375
168 Ga0265327_10000006 3300031251 Bacteria 693716
169 Ga0307509_10207060 3300031507 Bacteria 1791
170 Ga0307408_100134245 3300031548 Unclassified 1934
171 Ga0307405_10091216 3300031731 Unclassified 2018
172 Ga0307413_10089220 3300031824 Unclassified 2002
173 Ga0307410_10121917 3300031852 Unclassified 1902
174 Ga0307406_10058119 3300031901 Unclassified 2484
175 Ga0307407_10563787 3300031903 Bacteria 843
176 Ga0307407_11321864 3300031903 Bacteria 566
177 Ga0307412_10028105 3300031911 Bacteria 3515
178 Ga0307409_100073905 3300031995 Unclassified 2721
179 Ga0307416_100091454 3300032002 Unclassified 2613
180 Ga0307416_100135613 3300032002 Unclassified 2226
181 Ga0307414_10052829 3300032004 Unclassified 2830
182 Ga0307414_10205771 3300032004 Bacteria 1605
183 Ga0307411_10026835 3300032005 Bacteria 3473
184 Ga0373955_0585318 3300035172 Bacteria 683
185 Ga0373924_0192413 3300035410 Bacteria 899
186 Ga0395899_0005054 3300037312 Bacteria 10261
187 Ga0395899_0042379 3300037312 Bacteria 3398
188 Ga0395900_0106262 3300037418 Bacteria 2883
189 Ga0395900_0253515 3300037418 Bacteria 1760
190 Ga0395898_0011250 3300037466 Bacteria 9311
191 Ga0395898_0049522 3300037466 Bacteria 4116
192 Ga0395898_0106236 3300037466 Bacteria 2693
193 Ga0395905_0196806 3300037471 Bacteria 1890
194 Ga0436364_0043853 3300037853 Bacteria 3250
195 Ga0395901_0021209 3300038443 Bacteria 6654
196 Ga0436360_1301870 3300039438 Bacteria 900
197 Ga0436361_0929119 3300039447 Bacteria 764
198 Ga0436361_1002982 3300039447 Bacteria 745
199 Ga0436363_1161502 3300039450 Bacteria 7426
200 Ga0439465_0181370 3300041413 Bacteria 762
201 Ga0451807_1095228 3300041486 Bacteria 690
202 Ga0451843_0003418 3300041509 Bacteria 637
203 Ga0439445_0013011 3300042004 Bacteria 2009
204 Ga0439445_0148344 3300042004 Bacteria 682
205 Ga0439445_0155145 3300042004 Bacteria 667
206 Ga0439449_0021269 3300042007 Bacteria 2429
207 Ga0439454_016304 3300042011 Bacteria 1049
208 Ga0450897_004212 3300042128 Bacteria 1192
209 Ga0450896_010375 3300042133 Bacteria 1307
210 Ga0450899_001465 3300042135 Bacteria 2633
211 Ga0450900_077414 3300042136 Bacteria 532
212 Ga0439446_0063344 3300042156 Bacteria 1121
213 Ga0439434_0012882 3300042435 Bacteria 2478
214 Ga0439435_0194372 3300042436 Bacteria 667
215 Ga0451577_0132692 3300042876 Bacteria 2235
216 Ga0453683_0075586 3300044673 Bacteria 2108
217 Ga0453684_0590999 3300044712 Bacteria 1218
218 Ga0495580_0098227 3300046472 Bacteria 2037
219 Ga0495582_0062494 3300046473 Bacteria 2057
220 Ga0495639_0363722 3300046475 Bacteria 727
221 Ga0495665_0700161 3300046531 Bacteria 502
222 Ga0495581_0020766 3300047315 Bacteria 3809
223 Ga0495674_0808513 3300047319 Bacteria 729
224 Ga0495684_0452323 3300047471 Bacteria 892
225 Ga0501290_004850 3300049513 Bacteria 1680
226 Ga0501292_033187 3300049515 Bacteria 873
227 Ga0501293_004195 3300049516 Bacteria 1130
228 Ga0501297_001988 3300049520 Bacteria 1941
229 Ga0501298_007927 3300049521 Bacteria 1773
230 Ga0501299_026427 3300049522 Bacteria 1096
231 Ga0501032_0040424 3300049569 Bacteria 3170
232 Ga0501032_0563682 3300049569 Bacteria 726
233 Ga0501034_0001267 3300049571 Bacteria 34303
234 Ga0501039_1373976 3300049575 Bacteria 544
235 Ga0501198_000745 3300049649 Bacteria 4059
236 Ga0501201_000188 3300049651 Bacteria 5416
237 Ga0501202_008046 3300049652 Bacteria 1916
238 Ga0501206_003847 3300049653 Bacteria 1907
239 Ga0501207_015154 3300049654 Bacteria 1184
240 Ga0501207_025781 3300049654 Bacteria 966
241 Ga0501209_100520 3300049656 Bacteria 848
242 Ga0501216_037646 3300049660 Bacteria 915
243 Ga0501217_010220 3300049661 Bacteria 2051
244 Ga0501217_016121 3300049661 Bacteria 1709
245 Ga0501222_003267 3300049662 Bacteria 2226
246 Ga0501223_003049 3300049663 Bacteria 3668
247 Ga0501223_008238 3300049663 Unclassified 2125
248 Ga0501224_001410 3300049664 Bacteria 3183
249 Ga0501224_018217 3300049664 Bacteria 1046
250 Ga0501224_028993 3300049664 Unclassified 829
251 Ga0501227_043622 3300049665 Unclassified 1115
252 Ga0501233_002664 3300049668 Bacteria 3161
253 Ga0501233_094024 3300049668 Unclassified 786
254 Ga0501235_005618 3300049669 Unclassified 2727
255 Ga0501235_080501 3300049669 Unclassified 778
256 Ga0501236_046779 3300049670 Bacteria 732
257 Ga0501240_003306 3300049673 Bacteria 1785
258 Ga0501242_000257 3300049674 Unclassified 4256
259 Ga0501243_000143 3300049675 Bacteria 8147
260 Ga0501249_003292 3300049679 Bacteria 3249
261 Ga0501251_026573 3300049681 Bacteria 801
262 Ga0501253_043136 3300049683 Bacteria 917
263 Ga0501257_008989 3300049686 Unclassified 2252
264 Ga0501258_014796 3300049687 Bacteria 868
265 Ga0501259_000213 3300049688 Bacteria 8900
266 Ga0501259_007734 3300049688 Unclassified 1722
267 Ga0501261_002871 3300049690 Bacteria 2117
268 Ga0501221_000806 3300049704 Bacteria 5086
269 Ga0501225_0044134 3300049705 Unclassified 1232
270 Ga0501234_000804 3300049707 Bacteria 4921
271 Ga0501245_003033 3300049708 Bacteria 2265
272 Ga0501241_037182 3300049758 Bacteria 935
273 Ga0501262_012488 3300049759 Bacteria 1086
274 Ga0501265_016236 3300049762 Bacteria 964
275 Ga0501268_001763 3300049765 Unclassified 2754
276 Ga0501270_004526 3300049767 Bacteria 1566
277 Ga0501270_030442 3300049767 Bacteria 887
278 Ga0501271_009386 3300049768 Bacteria 1018
279 Ga0501274_011094 3300049771 Bacteria 838
280 Ga0501283_046882 3300049779 Bacteria 759
281 nmdc:mga0k408_575234_c1 3300050493 Bacteria 665
282 nmdc:mga08y16_1157023_c1 3300050511 Unclassified 746
283 nmdc:mga0a205_803266_c1 3300050515 Unclassified 788
284 Ga0495619_0092673 3300053085 Bacteria 2047
285 Ga0500611_000006 3300053727 Bacteria 226069
286 2819590621 2818991444 Bacteria 6968812
287 2884636871 2884634485 Bacteria 3928637
288 2936364019 2936361878 Bacteria 5632809
289 Ga0163162_10198154
290 Ga0065714_10068892
291 Ga0065704_10367807
292 Ga0070670_100020891
293 Ga0068869_100124353
294 Ga0068869_100767325
295 Ga0070666_10001384
296 Ga0070666_10361931
297 Ga0070680_100017537
298 Ga0068868_100003664
299 Ga0068868_100638694
300 Ga0070660_100000583
301 Ga0070660_100627354
302 Ga0070692_10061737
303 Ga0070668_100140027
304 Ga0070668_100332424
305 Ga0070668_100607355
306 Ga0070669_100090700
307 Ga0070675_100810853
308 Ga0070671_100217409
309 Ga0070671_100828330
310 Ga0070674_100080807
311 Ga0070673_100254972
312 Ga0070659_100022054
313 Ga0070667_100266735
314 Ga0070667_100448862
315 Ga0070667_100949450
316 Ga0070667_101376147
317 Ga0070663_100067486
318 Ga0070681_10011796
319 Ga0068867_100025303
320 Ga0068867_100111776
321 Ga0068867_100213507
322 Ga0070679_100008240
323 Ga0070679_100140029
324 Ga0070684_100482773
325 Ga0070704_100533463
326 Ga0068855_100013330
327 Ga0068855_100158359
328 Ga0068855_100583684
329 Ga0068857_100022160
330 Ga0068854_100129642
331 Ga0068856_100012198
332 Ga0068852_100004389
333 Ga0068852_100579470
334 Ga0068852_101314898
335 Ga0068859_100002895
336 Ga0068859_100335250
337 Ga0068859_100429170
338 Ga0068864_100006057
339 Ga0068864_100085031
340 Ga0068866_10022339
341 Ga0068861_101697379
342 Ga0068851_10033020
343 Ga0068870_11131726
344 Ga0068863_100005619
345 Ga0068863_100056989
346 Ga0068863_100074886
347 Ga0068858_100003124
348 Ga0068860_100001849
349 Ga0068860_100002566
350 Ga0068860_100008679
351 Ga0068860_100030171
352 Ga0068862_100048233
353 Ga0068862_100246082
354 Ga0097621_100041865
355 Ga0097621_100232930
356 Ga0068871_100013362
357 Ga0097620_100002895
358 Ga0097620_100335256
359 Ga0097620_100429179
360 Ga0075435_100424448
361 Ga0111539_10948168
362 Ga0105245_10531285
363 Ga0105247_10030249
364 Ga0105247_10349760
365 Ga0105243_11125102
366 Ga0105241_10007998
367 Ga0105241_10141971
368 Ga0105242_10025922
369 Ga0105242_10638660
370 Ga0105237_10003238
371 Ga0105238_10524601
372 Ga0105249_10199242
373 Ga0105249_11651558
374 Ga0105239_10066902
375 Ga0105246_10074642
376 Ga0157373_10010128
377 Ga0157373_10151222
378 Ga0157371_10004968
379 Ga0157371_10005501
380 Ga0157371_10015759
381 Ga0157371_10153451
382 Ga0157371_10161092
383 Ga0157370_10000290
384 Ga0157370_10007713
385 Ga0157370_10222368
386 Ga0157369_10015441
387 Ga0157369_10148328
388 Ga0157374_10078568
389 Ga0157378_10012426
390 Ga0157378_10014367
391 Ga0157378_10346806
392 Ga0157378_10773587
393 Ga0163162_10000414
394 Ga0163162_10194477
395 Ga0157372_10070597
396 Ga0157372_10211037
397 Ga0157372_10340133
398 Ga0157375_10196653
399 Ga0157375_10649865
400 Ga0157375_12021950
401 Ga0163163_10124726
402 Ga0163163_10204712
403 Ga0163163_11731932
404 Ga0157380_10000701
405 Ga0157377_10134822
406 Ga0157379_10065229
407 Ga0157379_10092262
408 Ga0163161_10476988
409 Ga0213874_10005523
410 Ga0207642_10050702
411 Ga0207645_10318282
412 Ga0207705_10001125
413 Ga0207707_10750033
414 Ga0207660_10022084
415 Ga0207657_10001364
416 Ga0207657_10364075
417 Ga0207657_10379219
418 Ga0207652_10000010
419 Ga0207652_10000475
420 Ga0207652_10519376
421 Ga0207681_10989257
422 Ga0207650_10153488
423 Ga0207644_10121087
424 Ga0207690_10169877
425 Ga0207690_10610267
426 Ga0207686_10012628
427 Ga0207669_10006100
428 Ga0207689_10514825
429 Ga0207661_10024854
430 Ga0207667_10002780
431 Ga0207667_10226393
432 Ga0207651_10892514
433 Ga0207668_10016175
434 Ga0207640_10174166
435 Ga0207658_10031739
436 Ga0207658_10446653
437 Ga0207677_10005820
438 Ga0207677_10102817
439 Ga0207639_10189234
440 Ga0207678_10007815
441 Ga0207708_10272176
442 Ga0207641_10037327
443 Ga0207648_10006799
444 Ga0207648_10111273
445 Ga0207648_10980300
446 Ga0207676_11683919
447 Ga0207674_10013121
448 Ga0207674_10056103
449 Ga0207674_10458066
450 Ga0207674_10663370
451 Ga0207675_100291466
452 Ga0207698_10805119
453 Ga0268264_10007641
454 Ga0268264_10035787
455 Ga0265324_10054313
456 Ga0265327_10000006
457 Ga0307509_10207060
458 Ga0307408_100134245
459 Ga0307405_10091216
460 Ga0307413_10089220
461 Ga0307410_10121917
462 Ga0307406_10058119
463 Ga0307407_10563787
464 Ga0307407_11321864
465 Ga0307412_10028105
466 Ga0307409_100073905
467 Ga0307416_100091454
468 Ga0307416_100135613
469 Ga0307414_10052829
470 Ga0307414_10205771
471 Ga0307411_10026835
472 Ga0373955_0585318
473 Ga0373924_0192413
474 Ga0395899_0005054
475 Ga0395899_0042379
476 Ga0395900_0106262
477 Ga0395900_0253515
478 Ga0395898_0011250
479 Ga0395898_0049522
480 Ga0395898_0106236
481 Ga0395905_0196806
482 Ga0436364_0043853
483 Ga0395901_0021209
484 Ga0436360_1301870
485 Ga0436361_0929119
486 Ga0436361_1002982
487 Ga0436363_1161502
488 Ga0439465_0181370
489 Ga0451807_1095228
490 Ga0451843_0003418
491 Ga0439445_0013011
492 Ga0439445_0148344
493 Ga0439445_0155145
494 Ga0439449_0021269
495 Ga0439454_016304
496 Ga0450897_004212
497 Ga0450896_010375
498 Ga0450899_001465
499 Ga0450900_077414
500 Ga0439446_0063344
501 Ga0439434_0012882
502 Ga0439435_0194372
503 Ga0451577_0132692
504 Ga0453683_0075586
505 Ga0453684_0590999
506 Ga0495580_0098227
507 Ga0495582_0062494
508 Ga0495639_0363722
509 Ga0495665_0700161
510 Ga0495581_0020766
511 Ga0495674_0808513
512 Ga0495684_0452323
513 Ga0501290_004850
514 Ga0501292_033187
515 Ga0501293_004195
516 Ga0501297_001988
517 Ga0501298_007927
518 Ga0501299_026427
519 Ga0501032_0040424
520 Ga0501032_0563682
521 Ga0501034_0001267
522 Ga0501039_1373976
523 Ga0501198_000745
524 Ga0501201_000188
525 Ga0501202_008046
526 Ga0501206_003847
527 Ga0501207_015154
528 Ga0501207_025781
529 Ga0501209_100520
530 Ga0501216_037646
531 Ga0501217_010220
532 Ga0501217_016121
533 Ga0501222_003267
534 Ga0501223_003049
535 Ga0501223_008238
536 Ga0501224_001410
537 Ga0501224_018217
538 Ga0501224_028993
539 Ga0501227_043622
540 Ga0501233_002664
541 Ga0501233_094024
542 Ga0501235_005618
543 Ga0501235_080501
544 Ga0501236_046779
545 Ga0501240_003306
546 Ga0501242_000257
547 Ga0501243_000143
548 Ga0501249_003292
549 Ga0501251_026573
550 Ga0501253_043136
551 Ga0501257_008989
552 Ga0501258_014796
553 Ga0501259_000213
554 Ga0501259_007734
555 Ga0501261_002871
556 Ga0501221_000806
557 Ga0501225_0044134
558 Ga0501234_000804
559 Ga0501245_003033
560 Ga0501241_037182
561 Ga0501262_012488
562 Ga0501265_016236
563 Ga0501268_001763
564 Ga0501270_004526
565 Ga0501270_030442
566 Ga0501271_009386
567 Ga0501274_011094
568 Ga0501283_046882
569 nmdc:mga0k408_575234_c1
570 nmdc:mga08y16_1157023_c1
571 nmdc:mga0a205_803266_c1
572 Ga0495619_0092673
573 Ga0500611_000006
574 2819590621
575 2884636871
576 2936364019

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

31

133

0.95

PF14437

MafB19-deam

MafB19-like deaminase

32

182

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jfy-assembly1.cif.gz_B crystal structure of a plant cytidine deaminase 0.9803 1 101
5jfy-assembly2.cif.gz_D crystal structure of a plant cytidine deaminase 0.9757 1 101
1tiy-assembly1.cif.gz_A x-ray structure of guanine deaminase from bacillus subtilis northeast structural genomics consortium target sr160 0.9746 1 157
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.9729 6 104
8e2q-assembly2.cif.gz_C crystal structure of tadac-1.17 in a complex with ssdna 0.9693 7 104
ID Description Score Start End Superfamily
af_A0A1D6PV52_1_75_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9952 45 101 3.40.140.10
af_A0A1D6ELV0_114_227_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.981 5 114 3.40.140.10
1tiyB00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9699 5 151 3.40.140.10
2a8nA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9617 2 104 3.40.140.10
af_Q95Y87_1_153_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9582 6 157 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A060BSU2-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9973 27 104 GO:0002100
GO:0008270
GO:0052717
AF-A0A2H9LF16-F1-model_v4 Nucleoside deaminase 0.9957 6 102 GO:0006152
GO:0008270
GO:0047974
AF-A0A7H5EVD5-F1-model_v4 Transporter substrate-binding domain-containing protein 0.9938 5 157 GO:0006152
GO:0008270
GO:0047974
AF-A0A3P1CQI5-F1-model_v4 Probable molybdenum cofactor guanylyltransferase (MoCo guanylyltransferase) (EC 2.7.7.77) (GTP:molybdopterin guanylyltransferase) (Mo-MPT guanylyltransferase) (Molybdopterin guanylyltransferase) (Molybdopterin-guanine dinucleotide synthase) (MGD synthase) 0.991 3 157 GO:0005525
GO:0005737
GO:0006152
GO:0006777
GO:0008270
GO:0047974
GO:0061603
AF-W4VBG4-F1-model_v4 tRNA-specific adenosine-34 deaminase 0.9894 3 103 GO:0006152
GO:0008270
GO:0047974

Map