F388569

General Info

Members Datasets Scaffolds Average Seq Length
288 168 576 171

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10708197|Ga0105237_107081971
Length 196
Sequence VRIALREAGGSKNSGEKDGLTQPNMIRFQTILEQFQEQGEKTGWTYIRVPEKLAQQLKPGNKRSFRIKGKIDAHVISAVALLPMGEGDFIMPVNAEMRKAIGKRKGATVKLEFHTDDRPLKINAQFMECLEDEPSALQYFNSLQKSVQNYYSKWIDSAKTEPTKVKRMAMAVSALARKMDFGEMLREQKKIKDSNS

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
138 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
139 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
160 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
161 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
167 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
168 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0
Isolates 1.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 1.74
Rhizosphere 93.06
Stem 0
Stem Tuber 0
Unclassified 17.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10708197 3300009545 Bacteria 1013
2 SwRhRL2b_contig_1705844 2162886007 Bacteria 1641
3 MBSR1b_contig_10641577 2162886012 Bacteria 2921
4 rootH2_10195894 3300003320 Bacteria 5039
5 rootL2_10131299 3300003322 Bacteria 1611
6 rootH1_10133817 3300003323 Bacteria 1251
7 rootH1_10253648 3300003323 Unclassified 1445
8 Ga0065704_10071974 3300005289 Bacteria 9480
9 Ga0065715_10089245 3300005293 Bacteria 11962
10 Ga0065715_10224788 3300005293 Bacteria 1253
11 Ga0065707_10184248 3300005295 Bacteria 1399
12 Ga0065707_10279007 3300005295 Bacteria 1052
13 Ga0070658_10250627 3300005327 Unclassified 1502
14 Ga0070676_10011875 3300005328 Unclassified 4745
15 Ga0070676_10027881 3300005328 Bacteria 3206
16 Ga0070683_100021881 3300005329 Bacteria 5708
17 Ga0070683_100762427 3300005329 Unclassified 927
18 Ga0070690_100050954 3300005330 Bacteria 2641
19 Ga0070690_100107994 3300005330 Bacteria 1853
20 Ga0070670_101725672 3300005331 Unclassified 576
21 Ga0068869_100002729 3300005334 Bacteria 10689
22 Ga0068869_100005384 3300005334 Bacteria 8043
23 Ga0068869_100099308 3300005334 Unclassified 2200
24 Ga0070666_10044961 3300005335 Bacteria 2960
25 Ga0070682_100089767 3300005337 Unclassified 2008
26 Ga0068868_100004505 3300005338 Bacteria 9774
27 Ga0068868_100048610 3300005338 Bacteria 3328
28 Ga0068868_100871596 3300005338 Bacteria 816
29 Ga0070689_100004819 3300005340 Bacteria 9156
30 Ga0070689_100530781 3300005340 Bacteria 1012
31 Ga0070661_100045820 3300005344 Bacteria 3198
32 Ga0070661_100358623 3300005344 Bacteria 1145
33 Ga0070668_100465434 3300005347 Bacteria 1089
34 Ga0070668_100678697 3300005347 Bacteria 907
35 Ga0070669_100027006 3300005353 Bacteria 4132
36 Ga0070675_100036967 3300005354 Unclassified 3976
37 Ga0070675_100585593 3300005354 Bacteria 1011
38 Ga0070671_100197763 3300005355 Bacteria 1704
39 Ga0070673_100115276 3300005364 Bacteria 2234
40 Ga0070688_100009856 3300005365 Bacteria 5250
41 Ga0070688_100037470 3300005365 Bacteria 2955
42 Ga0070659_101512367 3300005366 Unclassified 598
43 Ga0070667_100010081 3300005367 Bacteria 7823
44 Ga0070714_100141543 3300005435 Bacteria 2160
45 Ga0070701_10157896 3300005438 Unclassified 1311
46 Ga0070700_100951405 3300005441 Bacteria 703
47 Ga0070678_100155467 3300005456 Unclassified 1847
48 Ga0070678_100838511 3300005456 Bacteria 837
49 Ga0070662_100004418 3300005457 Bacteria 8888
50 Ga0070662_100026225 3300005457 Bacteria 4035
51 Ga0070662_100732698 3300005457 Bacteria 838
52 Ga0068867_100042901 3300005459 Bacteria 3310
53 Ga0068867_100065360 3300005459 Bacteria 2707
54 Ga0068867_100246924 3300005459 Bacteria 1450
55 Ga0068867_100252981 3300005459 Bacteria 1433
56 Ga0068867_100335345 3300005459 Bacteria 1257
57 Ga0070707_100104556 3300005468 Bacteria 2745
58 Ga0070698_100228023 3300005471 Unclassified 1796
59 Ga0070699_100345193 3300005518 Unclassified 1340
60 Ga0070684_100002466 3300005535 Bacteria 13612
61 Ga0070684_100040227 3300005535 Bacteria 4025
62 Ga0068853_101496380 3300005539 Bacteria 653
63 Ga0070672_100621772 3300005543 Bacteria 942
64 Ga0070665_101136639 3300005548 Bacteria 792
65 Ga0068855_100513258 3300005563 Bacteria 1301
66 Ga0070664_100040321 3300005564 Bacteria 3936
67 Ga0070664_100040374 3300005564 Unclassified 3933
68 Ga0070664_100054480 3300005564 Unclassified 3393
69 Ga0068857_100808356 3300005577 Bacteria 895
70 Ga0068857_100810017 3300005577 Bacteria 895
71 Ga0068854_100074158 3300005578 Bacteria 2496
72 Ga0068856_101599465 3300005614 Bacteria 665
73 Ga0068852_100070589 3300005616 Bacteria 3065
74 Ga0068852_100179945 3300005616 Bacteria 1988
75 Ga0068852_100465359 3300005616 Unclassified 1254
76 Ga0068859_100070948 3300005617 Bacteria 3519
77 Ga0068859_100120979 3300005617 Bacteria 2684
78 Ga0068859_100552871 3300005617 Bacteria 1245
79 Ga0068859_101259587 3300005617 Bacteria 815
80 Ga0068864_100010021 3300005618 Bacteria 7823
81 Ga0068861_100146959 3300005719 Bacteria 1930
82 Ga0068861_100256542 3300005719 Bacteria 1495
83 Ga0068858_100155063 3300005842 Bacteria 2154
84 Ga0068860_100079998 3300005843 Bacteria 3108
85 Ga0068862_100090273 3300005844 Bacteria 2667
86 Ga0070716_100591287 3300006173 Unclassified 833
87 Ga0075366_10001355 3300006195 Bacteria 12235
88 Ga0075366_10010056 3300006195 Bacteria 5303
89 Ga0075366_10429677 3300006195 Bacteria 814
90 Ga0097621_100066153 3300006237 Bacteria 2976
91 Ga0097621_100192678 3300006237 Bacteria 1766
92 Ga0097621_101270268 3300006237 Unclassified 695
93 Ga0068871_100026145 3300006358 Bacteria 4551
94 Ga0068871_100106638 3300006358 Unclassified 2352
95 Ga0075428_100009075 3300006844 Bacteria 11037
96 Ga0075428_100058109 3300006844 Bacteria 4234
97 Ga0075428_100819178 3300006844 Bacteria 989
98 Ga0075430_100013464 3300006846 Bacteria 6972
99 Ga0075430_100291019 3300006846 Bacteria 1351
100 Ga0075431_100031956 3300006847 Bacteria 5423
101 Ga0075431_100309324 3300006847 Bacteria 1595
102 Ga0075434_100801982 3300006871 Bacteria 958
103 Ga0075429_100014505 3300006880 Bacteria 6830
104 Ga0075429_100023258 3300006880 Bacteria 5375
105 Ga0068865_100119305 3300006881 Bacteria 1958
106 Ga0068865_100460978 3300006881 Unclassified 1053
107 Ga0068865_101144360 3300006881 Unclassified 687
108 Ga0097620_100070946 3300006931 Bacteria 3519
109 Ga0097620_100120974 3300006931 Bacteria 2684
110 Ga0097620_100552860 3300006931 Bacteria 1245
111 Ga0097620_101259654 3300006931 Bacteria 815
112 Ga0105240_11922606 3300009093 Bacteria 615
113 Ga0114129_12115922 3300009147 Bacteria 679
114 Ga0105241_10097947 3300009174 Bacteria 2326
115 Ga0105241_10353751 3300009174 Bacteria 1276
116 Ga0105242_10342570 3300009176 Bacteria 1378
117 Ga0105242_10538931 3300009176 Unclassified 1117
118 Ga0105242_11174271 3300009176 Bacteria 785
119 Ga0105248_10138799 3300009177 Bacteria 2742
120 Ga0105249_10190170 3300009553 Bacteria 2003
121 Ga0105239_10701401 3300010375 Bacteria 1157
122 Ga0105239_11159785 3300010375 Bacteria 890
123 Ga0105246_10153056 3300011119 Bacteria 1748
124 Ga0157373_10037155 3300013100 Bacteria 3493
125 Ga0157371_10202853 3300013102 Bacteria 1422
126 Ga0157371_10256751 3300013102 Bacteria 1259
127 Ga0157370_10000839 3300013104 Bacteria 39014
128 Ga0157374_10020128 3300013296 Bacteria 5916
129 Ga0157374_10043721 3300013296 Unclassified 4139
130 Ga0157374_10132132 3300013296 Unclassified 2416
131 Ga0157378_10063092 3300013297 Unclassified 3310
132 Ga0157378_10132350 3300013297 Bacteria 2310
133 Ga0157378_11126192 3300013297 Bacteria 822
134 Ga0163162_10005098 3300013306 Bacteria 12662
135 Ga0163162_10105739 3300013306 Bacteria 2909
136 Ga0163162_10566064 3300013306 Bacteria 1264
137 Ga0157372_10101094 3300013307 Bacteria 3291
138 Ga0157372_10343233 3300013307 Bacteria 1739
139 Ga0157375_10007748 3300013308 Bacteria 9398
140 Ga0157375_10040832 3300013308 Bacteria 4475
141 Ga0157375_10047931 3300013308 Bacteria 4176
142 Ga0163163_10000078 3300014325 Bacteria 107017
143 Ga0163163_10394733 3300014325 Bacteria 1441
144 Ga0163163_10710295 3300014325 Bacteria 1069
145 Ga0163163_10951029 3300014325 Bacteria 922
146 Ga0157380_10967740 3300014326 Bacteria 882
147 Ga0157377_10098188 3300014745 Bacteria 1740
148 Ga0157377_10102509 3300014745 Bacteria 1708
149 Ga0157379_10060917 3300014968 Bacteria 3375
150 Ga0157379_10160821 3300014968 Bacteria 2027
151 Ga0157379_10211827 3300014968 Bacteria 1754
152 Ga0157379_10849117 3300014968 Bacteria 864
153 Ga0157376_10051211 3300014969 Unclassified 3429
154 Ga0157376_10097030 3300014969 Bacteria 2567
155 Ga0157376_10141194 3300014969 Bacteria 2161
156 Ga0157376_10873199 3300014969 Bacteria 916
157 Ga0207697_10041486 3300025315 Bacteria 1890
158 Ga0207642_10013182 3300025899 Bacteria 3009
159 Ga0207642_10015807 3300025899 Bacteria 2824
160 Ga0207688_10074531 3300025901 Bacteria 1930
161 Ga0207680_10581271 3300025903 Bacteria 801
162 Ga0207647_10008381 3300025904 Bacteria 7415
163 Ga0207645_10002700 3300025907 Bacteria 13825
164 Ga0207645_10013025 3300025907 Bacteria 5619
165 Ga0207645_10603350 3300025907 Bacteria 745
166 Ga0207705_10295312 3300025909 Unclassified 1242
167 Ga0207707_10540699 3300025912 Bacteria 991
168 Ga0207657_10423034 3300025919 Bacteria 1047
169 Ga0207649_10003172 3300025920 Bacteria 9021
170 Ga0207649_10012896 3300025920 Unclassified 4655
171 Ga0207649_10109043 3300025920 Bacteria 1846
172 Ga0207646_10255742 3300025922 Unclassified 1583
173 Ga0207681_10030979 3300025923 Bacteria 3491
174 Ga0207681_10302044 3300025923 Bacteria 1267
175 Ga0207650_10558663 3300025925 Bacteria 960
176 Ga0207659_10059643 3300025926 Unclassified 2744
177 Ga0207659_10161863 3300025926 Bacteria 1758
178 Ga0207644_10249414 3300025931 Unclassified 1416
179 Ga0207644_10341710 3300025931 Bacteria 1214
180 Ga0207644_10742691 3300025931 Bacteria 819
181 Ga0207706_10005994 3300025933 Bacteria 11302
182 Ga0207706_10048725 3300025933 Bacteria 3747
183 Ga0207706_10070762 3300025933 Bacteria 3068
184 Ga0207686_10041634 3300025934 Bacteria 2802
185 Ga0207686_10240618 3300025934 Bacteria 1317
186 Ga0207669_10006100 3300025937 Bacteria 5474
187 Ga0207704_10030655 3300025938 Bacteria 3018
188 Ga0207704_10225243 3300025938 Bacteria 1390
189 Ga0207704_10474718 3300025938 Unclassified 1003
190 Ga0207665_10598652 3300025939 Unclassified 861
191 Ga0207691_10334731 3300025940 Bacteria 1296
192 Ga0207691_10517021 3300025940 Bacteria 1013
193 Ga0207691_10588124 3300025940 Bacteria 943
194 Ga0207689_10030682 3300025942 Unclassified 4480
195 Ga0207689_10102437 3300025942 Bacteria 2352
196 Ga0207689_10208960 3300025942 Bacteria 1612
197 Ga0207689_10683139 3300025942 Bacteria 865
198 Ga0207661_10011199 3300025944 Bacteria 6487
199 Ga0207661_10060452 3300025944 Bacteria 3057
200 Ga0207661_11124619 3300025944 Unclassified 723
201 Ga0207679_10000720 3300025945 Bacteria 21987
202 Ga0207679_10038078 3300025945 Bacteria 3424
203 Ga0207679_10038633 3300025945 Unclassified 3402
204 Ga0207679_10804314 3300025945 Bacteria 857
205 Ga0207651_10117745 3300025960 Bacteria 2008
206 Ga0207651_10192440 3300025960 Bacteria 1628
207 Ga0207651_10196754 3300025960 Unclassified 1612
208 Ga0207712_10117914 3300025961 Bacteria 2003
209 Ga0207668_10216613 3300025972 Bacteria 1535
210 Ga0207668_10264940 3300025972 Bacteria 1402
211 Ga0207640_10110095 3300025981 Bacteria 1950
212 Ga0207640_10703662 3300025981 Bacteria 866
213 Ga0207658_10024299 3300025986 Bacteria 4239
214 Ga0207658_10203413 3300025986 Bacteria 1655
215 Ga0207658_10402752 3300025986 Bacteria 1203
216 Ga0207677_10037600 3300026023 Bacteria 3165
217 Ga0207677_10130294 3300026023 Bacteria 1908
218 Ga0207677_10195181 3300026023 Unclassified 1604
219 Ga0207703_10063556 3300026035 Bacteria 3027
220 Ga0207639_10004707 3300026041 Bacteria 9187
221 Ga0207639_10613450 3300026041 Bacteria 1004
222 Ga0207678_10406308 3300026067 Bacteria 1179
223 Ga0207708_10303787 3300026075 Bacteria 1298
224 Ga0207648_10006799 3300026089 Bacteria 11336
225 Ga0207648_10037693 3300026089 Bacteria 4259
226 Ga0207648_10055888 3300026089 Bacteria 3445
227 Ga0207648_10125575 3300026089 Bacteria 2257
228 Ga0207648_10567657 3300026089 Bacteria 1044
229 Ga0207676_10006913 3300026095 Bacteria 8041
230 Ga0207674_10007360 3300026116 Bacteria 12822
231 Ga0207674_10100394 3300026116 Bacteria 2875
232 Ga0207675_100016243 3300026118 Bacteria 6948
233 Ga0207675_100607959 3300026118 Bacteria 1097
234 Ga0207683_10100822 3300026121 Unclassified 2578
235 Ga0207683_11178196 3300026121 Unclassified 710
236 Ga0207698_10061971 3300026142 Bacteria 2918
237 Ga0207698_10382513 3300026142 Unclassified 1339
238 Ga0268266_10233092 3300028379 Bacteria 1696
239 Ga0268266_10938239 3300028379 Bacteria 837
240 Ga0268265_10487804 3300028380 Bacteria 1159
241 Ga0268264_10437084 3300028381 Bacteria 1265
242 Ga0307513_10088312 3300031456 Bacteria 3169
243 Ga0307414_10055660 3300032004 Bacteria 2771
244 Ga0373944_0057146 3300035089 Bacteria 1243
245 Ga0373943_0557564 3300035170 Unclassified 673
246 Ga0373933_0659722 3300035724 Unclassified 688
247 Ga0373937_0045954 3300036401 Bacteria 3991
248 Ga0373925_0336500 3300037068 Bacteria 1224
249 Ga0436365_1090577 3300039437 Bacteria 1426
250 Ga0439453_0008857 3300041408 Bacteria 1627
251 Ga0451800_0619577 3300041459 Unclassified 717
252 Ga0451843_0155246 3300041509 Unclassified 659
253 Ga0439434_0027125 3300042435 Bacteria 1731
254 Ga0451577_0225598 3300042876 Bacteria 1694
255 Ga0451577_1511589 3300042876 Unclassified 594
256 Ga0453684_0161371 3300044712 Bacteria 2651
257 Ga0453684_0195004 3300044712 Unclassified 2366
258 Ga0466959_0656124 3300045049 Unclassified 704
259 Ga0451576_0549096 3300045051 Bacteria 1214
260 Ga0495651_0427629 3300046462 Bacteria 860
261 Ga0495606_0509497 3300046507 Unclassified 606
262 Ga0495608_0166085 3300046511 Bacteria 1402
263 Ga0495640_0140407 3300046533 Bacteria 1558
264 Ga0495645_0503676 3300046543 Unclassified 757
265 Ga0495658_0080206 3300046683 Bacteria 1914
266 Ga0495624_0746593 3300046690 Bacteria 580
267 Ga0495680_0076776 3300047322 Bacteria 2532
268 Ga0495675_0152377 3300047444 Unclassified 1428
269 Ga0495686_0001677 3300047472 Bacteria 23025
270 Ga0495686_0020604 3300047472 Bacteria 4395
271 Ga0496100_0496622 3300048903 Bacteria 940
272 Ga0496104_0144594 3300048907 Bacteria 2284
273 Ga0496110_0084677 3300048913 Bacteria 2830
274 Ga0496111_0234153 3300048914 Bacteria 1364
275 Ga0501199_009577 3300049650 Bacteria 1026
276 Ga0501257_005552 3300049686 Bacteria 2783
277 Ga0501225_0010884 3300049705 Bacteria 2568
278 nmdc:mga0k408_35235_c1 3300050493 Bacteria 2870
279 nmdc:mga0k408_380428_c1 3300050493 Bacteria 841
280 nmdc:mga0k408_4483_c1 3300050493 Bacteria 7409
281 nmdc:mga09592_44385_c1 3300050508 Bacteria 3742
282 nmdc:mga0qj67_5946_c1 3300050509 Bacteria 8940
283 nmdc:mga0qj67_68413_c1 3300050509 Bacteria 1890
284 nmdc:mga06r32_450394_c1 3300050510 Bacteria 1267
285 nmdc:mga06r32_9171_c1 3300050510 Bacteria 8917
286 2840678414 2840677318 Bacteria 2664183
287 2896086231 2896085136 Bacteria 6129793
288 2896113499 2896109856 Bacteria 7140722
289 Ga0105237_10708197
290 SwRhRL2b_contig_1705844
291 MBSR1b_contig_10641577
292 rootH2_10195894
293 rootL2_10131299
294 rootH1_10133817
295 rootH1_10253648
296 Ga0065704_10071974
297 Ga0065715_10089245
298 Ga0065715_10224788
299 Ga0065707_10184248
300 Ga0065707_10279007
301 Ga0070658_10250627
302 Ga0070676_10011875
303 Ga0070676_10027881
304 Ga0070683_100021881
305 Ga0070683_100762427
306 Ga0070690_100050954
307 Ga0070690_100107994
308 Ga0070670_101725672
309 Ga0068869_100002729
310 Ga0068869_100005384
311 Ga0068869_100099308
312 Ga0070666_10044961
313 Ga0070682_100089767
314 Ga0068868_100004505
315 Ga0068868_100048610
316 Ga0068868_100871596
317 Ga0070689_100004819
318 Ga0070689_100530781
319 Ga0070661_100045820
320 Ga0070661_100358623
321 Ga0070668_100465434
322 Ga0070668_100678697
323 Ga0070669_100027006
324 Ga0070675_100036967
325 Ga0070675_100585593
326 Ga0070671_100197763
327 Ga0070673_100115276
328 Ga0070688_100009856
329 Ga0070688_100037470
330 Ga0070659_101512367
331 Ga0070667_100010081
332 Ga0070714_100141543
333 Ga0070701_10157896
334 Ga0070700_100951405
335 Ga0070678_100155467
336 Ga0070678_100838511
337 Ga0070662_100004418
338 Ga0070662_100026225
339 Ga0070662_100732698
340 Ga0068867_100042901
341 Ga0068867_100065360
342 Ga0068867_100246924
343 Ga0068867_100252981
344 Ga0068867_100335345
345 Ga0070707_100104556
346 Ga0070698_100228023
347 Ga0070699_100345193
348 Ga0070684_100002466
349 Ga0070684_100040227
350 Ga0068853_101496380
351 Ga0070672_100621772
352 Ga0070665_101136639
353 Ga0068855_100513258
354 Ga0070664_100040321
355 Ga0070664_100040374
356 Ga0070664_100054480
357 Ga0068857_100808356
358 Ga0068857_100810017
359 Ga0068854_100074158
360 Ga0068856_101599465
361 Ga0068852_100070589
362 Ga0068852_100179945
363 Ga0068852_100465359
364 Ga0068859_100070948
365 Ga0068859_100120979
366 Ga0068859_100552871
367 Ga0068859_101259587
368 Ga0068864_100010021
369 Ga0068861_100146959
370 Ga0068861_100256542
371 Ga0068858_100155063
372 Ga0068860_100079998
373 Ga0068862_100090273
374 Ga0070716_100591287
375 Ga0075366_10001355
376 Ga0075366_10010056
377 Ga0075366_10429677
378 Ga0097621_100066153
379 Ga0097621_100192678
380 Ga0097621_101270268
381 Ga0068871_100026145
382 Ga0068871_100106638
383 Ga0075428_100009075
384 Ga0075428_100058109
385 Ga0075428_100819178
386 Ga0075430_100013464
387 Ga0075430_100291019
388 Ga0075431_100031956
389 Ga0075431_100309324
390 Ga0075434_100801982
391 Ga0075429_100014505
392 Ga0075429_100023258
393 Ga0068865_100119305
394 Ga0068865_100460978
395 Ga0068865_101144360
396 Ga0097620_100070946
397 Ga0097620_100120974
398 Ga0097620_100552860
399 Ga0097620_101259654
400 Ga0105240_11922606
401 Ga0114129_12115922
402 Ga0105241_10097947
403 Ga0105241_10353751
404 Ga0105242_10342570
405 Ga0105242_10538931
406 Ga0105242_11174271
407 Ga0105248_10138799
408 Ga0105249_10190170
409 Ga0105239_10701401
410 Ga0105239_11159785
411 Ga0105246_10153056
412 Ga0157373_10037155
413 Ga0157371_10202853
414 Ga0157371_10256751
415 Ga0157370_10000839
416 Ga0157374_10020128
417 Ga0157374_10043721
418 Ga0157374_10132132
419 Ga0157378_10063092
420 Ga0157378_10132350
421 Ga0157378_11126192
422 Ga0163162_10005098
423 Ga0163162_10105739
424 Ga0163162_10566064
425 Ga0157372_10101094
426 Ga0157372_10343233
427 Ga0157375_10007748
428 Ga0157375_10040832
429 Ga0157375_10047931
430 Ga0163163_10000078
431 Ga0163163_10394733
432 Ga0163163_10710295
433 Ga0163163_10951029
434 Ga0157380_10967740
435 Ga0157377_10098188
436 Ga0157377_10102509
437 Ga0157379_10060917
438 Ga0157379_10160821
439 Ga0157379_10211827
440 Ga0157379_10849117
441 Ga0157376_10051211
442 Ga0157376_10097030
443 Ga0157376_10141194
444 Ga0157376_10873199
445 Ga0207697_10041486
446 Ga0207642_10013182
447 Ga0207642_10015807
448 Ga0207688_10074531
449 Ga0207680_10581271
450 Ga0207647_10008381
451 Ga0207645_10002700
452 Ga0207645_10013025
453 Ga0207645_10603350
454 Ga0207705_10295312
455 Ga0207707_10540699
456 Ga0207657_10423034
457 Ga0207649_10003172
458 Ga0207649_10012896
459 Ga0207649_10109043
460 Ga0207646_10255742
461 Ga0207681_10030979
462 Ga0207681_10302044
463 Ga0207650_10558663
464 Ga0207659_10059643
465 Ga0207659_10161863
466 Ga0207644_10249414
467 Ga0207644_10341710
468 Ga0207644_10742691
469 Ga0207706_10005994
470 Ga0207706_10048725
471 Ga0207706_10070762
472 Ga0207686_10041634
473 Ga0207686_10240618
474 Ga0207669_10006100
475 Ga0207704_10030655
476 Ga0207704_10225243
477 Ga0207704_10474718
478 Ga0207665_10598652
479 Ga0207691_10334731
480 Ga0207691_10517021
481 Ga0207691_10588124
482 Ga0207689_10030682
483 Ga0207689_10102437
484 Ga0207689_10208960
485 Ga0207689_10683139
486 Ga0207661_10011199
487 Ga0207661_10060452
488 Ga0207661_11124619
489 Ga0207679_10000720
490 Ga0207679_10038078
491 Ga0207679_10038633
492 Ga0207679_10804314
493 Ga0207651_10117745
494 Ga0207651_10192440
495 Ga0207651_10196754
496 Ga0207712_10117914
497 Ga0207668_10216613
498 Ga0207668_10264940
499 Ga0207640_10110095
500 Ga0207640_10703662
501 Ga0207658_10024299
502 Ga0207658_10203413
503 Ga0207658_10402752
504 Ga0207677_10037600
505 Ga0207677_10130294
506 Ga0207677_10195181
507 Ga0207703_10063556
508 Ga0207639_10004707
509 Ga0207639_10613450
510 Ga0207678_10406308
511 Ga0207708_10303787
512 Ga0207648_10006799
513 Ga0207648_10037693
514 Ga0207648_10055888
515 Ga0207648_10125575
516 Ga0207648_10567657
517 Ga0207676_10006913
518 Ga0207674_10007360
519 Ga0207674_10100394
520 Ga0207675_100016243
521 Ga0207675_100607959
522 Ga0207683_10100822
523 Ga0207683_11178196
524 Ga0207698_10061971
525 Ga0207698_10382513
526 Ga0268266_10233092
527 Ga0268266_10938239
528 Ga0268265_10487804
529 Ga0268264_10437084
530 Ga0307513_10088312
531 Ga0307414_10055660
532 Ga0373944_0057146
533 Ga0373943_0557564
534 Ga0373933_0659722
535 Ga0373937_0045954
536 Ga0373925_0336500
537 Ga0436365_1090577
538 Ga0439453_0008857
539 Ga0451800_0619577
540 Ga0451843_0155246
541 Ga0439434_0027125
542 Ga0451577_0225598
543 Ga0451577_1511589
544 Ga0453684_0161371
545 Ga0453684_0195004
546 Ga0466959_0656124
547 Ga0451576_0549096
548 Ga0495651_0427629
549 Ga0495606_0509497
550 Ga0495608_0166085
551 Ga0495640_0140407
552 Ga0495645_0503676
553 Ga0495658_0080206
554 Ga0495624_0746593
555 Ga0495680_0076776
556 Ga0495675_0152377
557 Ga0495686_0001677
558 Ga0495686_0020604
559 Ga0496100_0496622
560 Ga0496104_0144594
561 Ga0496110_0084677
562 Ga0496111_0234153
563 Ga0501199_009577
564 Ga0501257_005552
565 Ga0501225_0010884
566 nmdc:mga0k408_35235_c1
567 nmdc:mga0k408_380428_c1
568 nmdc:mga0k408_4483_c1
569 nmdc:mga09592_44385_c1
570 nmdc:mga0qj67_5946_c1
571 nmdc:mga0qj67_68413_c1
572 nmdc:mga06r32_450394_c1
573 nmdc:mga06r32_9171_c1
574 2840678414
575 2896086231
576 2896113499

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13376

OmdA

Bacteriocin-protection, YdeI or OmpD-Associated

119

178

0.96

PF08922

DUF1905

Domain of unknown function (DUF1905)

28

113

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.8773 2 92
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.8491 2 92
5trd-assembly1.cif.gz_B structure of rbkr (riboflavin kinase) from thermoplasma acidophilum determined in complex with ctp and its cognate dna operator 0.5499 2 92
5mrt-assembly2.cif.gz_B crystal structure of l5 protease lysobacter sp. xl1 0.5486 6 72
2glw-assembly1.cif.gz_A the solution structure of phs018 from pyrococcus horikoshii 0.5427 3 94
ID Description Score Start End Superfamily
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.8783 2 92 2.40.30.100
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.8495 2 92 2.40.30.100
af_Q851V5_317_412_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6665 4 83 2.40.330.10
af_B6SN49_38_138_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6505 2 86 2.40.330.10
af_A0A1D6KH04_183_287_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6312 3 86 2.40.330.10
ID Description Score Start End GO Terms
AF-A0A536FMH8-F1-model_v4 YdeI/OmpD-associated family protein 0.9732 97 155
AF-A0A085WM30-F1-model_v4 Putative periplasmic membrane protein 0.9688 96 157
AF-A0A4Q3PMM3-F1-model_v4 deleted 0.9684 2 96
AF-A0A3N5LWX9-F1-model_v4 YdhG-like domain-containing protein 0.9642 98 158
AF-A0A4R5K9N7-F1-model_v4 Bacteriocin-protection protein 0.9612 97 157

Map