F388527

General Info

Members Datasets Scaffolds Average Seq Length
288 147 576 221

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100034348|Ga0075436_1000343482
Length 246
Sequence MTNPLRIKRGSDINDASRNASGQGNTLTSPKLAPSILSADFARLADAVVAAEAGGADWIHVDVMDGHFVPNLTFGPKMVADLRKATRLPLDVHLMIDKPEEWVATYVESGATYVTVHVEATADPGGTLTAIRAAGARAGITLNPETEVARIAPYVDLADLVLVMSVHPGFGGQAFIASALDKVRALRSLLDARGSNAELEVDGGIKPENAKAIAVAGASVLVAGSAVYLDPDGVTAALAKFRRAVA

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
65 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
85 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
144 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
145 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 4.51
Rhizosphere 92.36
Stem 0
Stem Tuber 0
Unclassified 4.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100034348 3300006914 Bacteria 3497
2 Ga0065704_10000658 3300005289 Bacteria 25213
3 Ga0065704_10151534 3300005289 Bacteria 1425
4 Ga0065707_10295300 3300005295 Bacteria 1016
5 Ga0070670_100282747 3300005331 Bacteria 1449
6 Ga0068868_100731081 3300005338 Bacteria 888
7 Ga0070689_100008200 3300005340 Bacteria 7344
8 Ga0070689_100149239 3300005340 Bacteria 1885
9 Ga0070689_100458493 3300005340 Bacteria 1086
10 Ga0070687_100201173 3300005343 Bacteria 1207
11 Ga0070668_100310656 3300005347 Bacteria 1325
12 Ga0070703_10000566 3300005406 Bacteria 13508
13 Ga0070705_100102196 3300005440 Bacteria 1812
14 Ga0070694_100004477 3300005444 Bacteria 8403
15 Ga0070694_100215793 3300005444 Bacteria 1437
16 Ga0070694_100349226 3300005444 Bacteria 1145
17 Ga0070708_100003559 3300005445 Bacteria 12216
18 Ga0070708_100005282 3300005445 Bacteria 10228
19 Ga0070708_100034137 3300005445 Bacteria 4424
20 Ga0070708_100079049 3300005445 Bacteria 2974
21 Ga0070708_100093986 3300005445 Unclassified 2735
22 Ga0070708_100385581 3300005445 Bacteria 1321
23 Ga0070663_100428114 3300005455 Bacteria 1087
24 Ga0070706_100007065 3300005467 Bacteria 10571
25 Ga0070706_100013639 3300005467 Bacteria 7514
26 Ga0070706_100057146 3300005467 Bacteria 3600
27 Ga0070706_100081236 3300005467 Unclassified 3002
28 Ga0070706_100097499 3300005467 Unclassified 2730
29 Ga0070706_100233191 3300005467 Bacteria 1718
30 Ga0070706_100522166 3300005467 Bacteria 1105
31 Ga0070706_100631295 3300005467 Bacteria 995
32 Ga0070707_100015132 3300005468 Bacteria 7242
33 Ga0070707_100031208 3300005468 Bacteria 5074
34 Ga0070707_100037164 3300005468 Bacteria 4647
35 Ga0070707_100219323 3300005468 Bacteria 1853
36 Ga0070707_100245664 3300005468 Bacteria 1742
37 Ga0070707_100303793 3300005468 Bacteria 1551
38 Ga0070707_100419979 3300005468 Bacteria 1298
39 Ga0070707_100920847 3300005468 Bacteria 839
40 Ga0070707_101000189 3300005468 Bacteria 801
41 Ga0070698_100000121 3300005471 Bacteria 67418
42 Ga0070698_100000190 3300005471 Bacteria 58673
43 Ga0070698_100001807 3300005471 Bacteria 23791
44 Ga0070698_100011447 3300005471 Bacteria 9412
45 Ga0070698_100034058 3300005471 Bacteria 5276
46 Ga0070698_100047266 3300005471 Bacteria 4400
47 Ga0070698_100086168 3300005471 Bacteria 3127
48 Ga0070698_100134540 3300005471 Bacteria 2426
49 Ga0070698_100327618 3300005471 Unclassified 1462
50 Ga0070698_100658470 3300005471 Bacteria 988
51 Ga0070698_100831900 3300005471 Bacteria 868
52 Ga0070699_100040530 3300005518 Bacteria 4032
53 Ga0070699_100043607 3300005518 Bacteria 3882
54 Ga0070699_100069093 3300005518 Bacteria 3069
55 Ga0070699_100071497 3300005518 Bacteria 3017
56 Ga0070699_100169826 3300005518 Bacteria 1932
57 Ga0070699_100198435 3300005518 Bacteria 1784
58 Ga0070699_100297731 3300005518 Bacteria 1447
59 Ga0070699_100363236 3300005518 Bacteria 1305
60 Ga0070699_100636620 3300005518 Unclassified 973
61 Ga0070697_100004553 3300005536 Bacteria 10651
62 Ga0070697_100125449 3300005536 Bacteria 2150
63 Ga0070697_100138213 3300005536 Bacteria 2047
64 Ga0070697_100147721 3300005536 Bacteria 1980
65 Ga0070697_100151398 3300005536 Bacteria 1955
66 Ga0070697_100307597 3300005536 Bacteria 1363
67 Ga0070695_100611622 3300005545 Bacteria 856
68 Ga0070696_100013961 3300005546 Bacteria 5394
69 Ga0070693_100639961 3300005547 Bacteria 772
70 Ga0070704_100235684 3300005549 Bacteria 1495
71 Ga0070664_100199266 3300005564 Bacteria 1786
72 Ga0068857_100007009 3300005577 Bacteria 9700
73 Ga0068857_100746936 3300005577 Bacteria 932
74 Ga0068854_100050924 3300005578 Bacteria 2965
75 Ga0068856_100029806 3300005614 Bacteria 5332
76 Ga0068859_100018684 3300005617 Bacteria 6965
77 Ga0068862_100064232 3300005844 Bacteria 3160
78 Ga0081539_10013415 3300005985 Bacteria 6175
79 Ga0070716_100206525 3300006173 Bacteria 1309
80 Ga0070716_100607523 3300006173 Bacteria 823
81 Ga0075367_10051606 3300006178 Bacteria 2431
82 Ga0075367_10099050 3300006178 Bacteria 1780
83 Ga0075428_100145595 3300006844 Unclassified 2575
84 Ga0075430_100146877 3300006846 Unclassified 1964
85 Ga0075433_10000855 3300006852 Bacteria 21379
86 Ga0075433_10020004 3300006852 Bacteria 5590
87 Ga0075433_10049083 3300006852 Bacteria 3671
88 Ga0075433_10057645 3300006852 Bacteria 3395
89 Ga0075434_100000940 3300006871 Bacteria 23428
90 Ga0075434_100059188 3300006871 Bacteria 3809
91 Ga0075434_100250409 3300006871 Bacteria 1791
92 Ga0075429_100000945 3300006880 Bacteria 22997
93 Ga0075436_100014295 3300006914 Bacteria 5435
94 Ga0075436_100067843 3300006914 Bacteria 2465
95 Ga0097620_100018684 3300006931 Bacteria 6965
96 Ga0075435_100001232 3300007076 Bacteria 16405
97 Ga0075435_100086781 3300007076 Bacteria 2577
98 Ga0075435_100122541 3300007076 Bacteria 2171
99 Ga0105247_10364909 3300009101 Bacteria 1019
100 Ga0114129_10000942 3300009147 Bacteria 38014
101 Ga0114129_10001256 3300009147 Bacteria 33852
102 Ga0114129_10011979 3300009147 Bacteria 12335
103 Ga0114129_10013507 3300009147 Bacteria 11637
104 Ga0114129_10017318 3300009147 Bacteria 10258
105 Ga0114129_10044695 3300009147 Bacteria 6231
106 Ga0114129_10064408 3300009147 Bacteria 5115
107 Ga0114129_10133524 3300009147 Bacteria 3408
108 Ga0114129_10201166 3300009147 Unclassified 2698
109 Ga0114129_10285150 3300009147 Bacteria 2205
110 Ga0105241_10223348 3300009174 Bacteria 1584
111 Ga0105242_11057338 3300009176 Bacteria 823
112 Ga0105249_10080701 3300009553 Bacteria 3023
113 Ga0105246_10030704 3300011119 Bacteria 3551
114 Ga0157373_10112246 3300013100 Bacteria 1916
115 Ga0157380_10557914 3300014326 Bacteria 1125
116 Ga0157380_11055183 3300014326 Bacteria 849
117 Ga0157376_11570378 3300014969 Bacteria 692
118 Ga0207645_10115554 3300025907 Bacteria 1740
119 Ga0207684_10000044 3300025910 Bacteria 258218
120 Ga0207684_10000108 3300025910 Bacteria 156641
121 Ga0207684_10015861 3300025910 Bacteria 6476
122 Ga0207684_10024916 3300025910 Bacteria 5098
123 Ga0207684_10063158 3300025910 Bacteria 3144
124 Ga0207684_10064272 3300025910 Bacteria 3116
125 Ga0207684_10077195 3300025910 Bacteria 2832
126 Ga0207684_10084276 3300025910 Bacteria 2707
127 Ga0207684_10682067 3300025910 Unclassified 874
128 Ga0207693_10032612 3300025915 Bacteria 4110
129 Ga0207652_10308587 3300025921 Bacteria 1428
130 Ga0207646_10003615 3300025922 Bacteria 17309
131 Ga0207646_10014669 3300025922 Bacteria 7424
132 Ga0207646_10043994 3300025922 Bacteria 4008
133 Ga0207646_10053512 3300025922 Bacteria 3611
134 Ga0207646_10115466 3300025922 Bacteria 2411
135 Ga0207646_10129961 3300025922 Bacteria 2266
136 Ga0207646_10152733 3300025922 Bacteria 2082
137 Ga0207709_10032272 3300025935 Bacteria 3065
138 Ga0207670_10005522 3300025936 Bacteria 6949
139 Ga0207665_10058241 3300025939 Bacteria 2611
140 Ga0207651_10332980 3300025960 Bacteria 1273
141 Ga0207640_10038624 3300025981 Bacteria 3015
142 Ga0207658_10110286 3300025986 Bacteria 2174
143 Ga0207639_10595651 3300026041 Bacteria 1019
144 Ga0207678_10011794 3300026067 Bacteria 7674
145 Ga0207676_10617882 3300026095 Bacteria 1043
146 Ga0207674_10010619 3300026116 Bacteria 10418
147 Ga0268265_10049043 3300028380 Bacteria 3174
148 Ga0268265_10116705 3300028380 Bacteria 2191
149 Ga0265334_10057217 3300028573 Bacteria 1478
150 Ga0265318_10025384 3300028577 Bacteria 2340
151 Ga0265338_10118272 3300028800 Bacteria 2118
152 Ga0265330_10015429 3300031235 Bacteria 3534
153 Ga0265320_10051452 3300031240 Bacteria 1998
154 Ga0265329_10037234 3300031242 Bacteria 1568
155 Ga0265340_10043326 3300031247 Bacteria 2206
156 Ga0265339_10005630 3300031249 Bacteria 8312
157 Ga0265339_10127889 3300031249 Bacteria 1301
158 Ga0265331_10001911 3300031250 Bacteria 14591
159 Ga0265331_10010794 3300031250 Bacteria 5026
160 Ga0265331_10055730 3300031250 Bacteria 1879
161 Ga0265316_10123758 3300031344 Bacteria 1952
162 Ga0265313_10052789 3300031595 Bacteria 1938
163 Ga0265314_10011922 3300031711 Bacteria 7136
164 Ga0265314_10339444 3300031711 Bacteria 830
165 Ga0265342_10036149 3300031712 Bacteria 3019
166 Ga0265342_10153381 3300031712 Bacteria 1278
167 Ga0316576_10069040 3300031727 Bacteria 2605
168 Ga0307410_10012556 3300031852 Bacteria 4905
169 Ga0307409_100008329 3300031995 Bacteria 6285
170 Ga0307409_101041993 3300031995 Bacteria 838
171 Ga0307416_100381886 3300032002 Bacteria 1439
172 Ga0307414_10260390 3300032004 Bacteria 1447
173 Ga0307411_10004785 3300032005 Bacteria 6557
174 Ga0307411_10890962 3300032005 Bacteria 790
175 Ga0307415_100392784 3300032126 Bacteria 1182
176 Ga0316585_10005821 3300032137 Bacteria 3495
177 Ga0373944_0013436 3300035089 Bacteria 2271
178 Ga0373939_0088207 3300035114 Bacteria 1044
179 Ga0373955_0032406 3300035172 Bacteria 2743
180 Ga0373962_0033480 3300035242 Bacteria 1419
181 Ga0316574_0164169 3300035398 Bacteria 1430
182 Ga0316574_0330572 3300035398 Bacteria 966
183 Ga0373924_0211579 3300035410 Bacteria 856
184 Ga0373935_0048906 3300035692 Bacteria 2679
185 Ga0373935_0151805 3300035692 Bacteria 1572
186 Ga0373947_0137832 3300035725 Bacteria 1563
187 Ga0373947_0240158 3300035725 Bacteria 1195
188 Ga0373937_0465325 3300036401 Bacteria 1201
189 Ga0316582_0048794 3300036647 Bacteria 2677
190 Ga0316584_0008008 3300036712 Bacteria 7255
191 Ga0395900_0660690 3300037418 Bacteria 981
192 Ga0395905_0109052 3300037471 Bacteria 2599
193 Ga0395905_0207135 3300037471 Bacteria 1838
194 Ga0395905_0251174 3300037471 Bacteria 1652
195 Ga0400483_231983 3300039062 Bacteria 4871
196 Ga0436365_0977285 3300039437 Bacteria 1000
197 Ga0436365_1742793 3300039437 Bacteria 3746
198 Ga0439434_0154425 3300042435 Bacteria 761
199 Ga0451577_0002943 3300042876 Bacteria 19515
200 Ga0451577_0300298 3300042876 Bacteria 1455
201 Ga0451577_0308310 3300042876 Bacteria 1435
202 Ga0453683_0029460 3300044673 Bacteria 3470
203 Ga0453684_0007246 3300044712 Bacteria 20532
204 Ga0453684_0015595 3300044712 Bacteria 11992
205 Ga0453684_0039975 3300044712 Bacteria 6378
206 Ga0453684_0048623 3300044712 Bacteria 5603
207 Ga0453684_0364963 3300044712 Bacteria 1625
208 Ga0453684_0378733 3300044712 Bacteria 1589
209 Ga0453684_1183191 3300044712 Bacteria 803
210 Ga0451576_0000836 3300045051 Bacteria 59974
211 Ga0451576_0076352 3300045051 Bacteria 3486
212 Ga0451576_0284541 3300045051 Bacteria 1729
213 Ga0451576_0386760 3300045051 Bacteria 1466
214 Ga0451576_0547373 3300045051 Bacteria 1216
215 Ga0466967_0036230 3300045976 Bacteria 4210
216 Ga0495638_0184702 3300046460 Bacteria 1187
217 Ga0495672_0047851 3300047320 Bacteria 2540
218 Ga0496101_0106113 3300048904 Bacteria 2109
219 Ga0496102_0017641 3300048905 Bacteria 6255
220 Ga0496103_0091822 3300048906 Bacteria 1916
221 Ga0496105_0253869 3300048908 Bacteria 1424
222 Ga0496106_0168008 3300048909 Bacteria 1737
223 Ga0496108_0113869 3300048911 Bacteria 2315
224 Ga0496109_0107802 3300048912 Bacteria 2588
225 Ga0496110_0076472 3300048913 Bacteria 2977
226 Ga0496111_0051140 3300048914 Bacteria 2983
227 Ga0496112_0064123 3300048915 Bacteria 3625
228 Ga0496112_0182992 3300048915 Bacteria 2059
229 Ga0496112_0194827 3300048915 Bacteria 1987
230 Ga0496115_0130314 3300048918 Bacteria 2073
231 Ga0501034_0375949 3300049571 Bacteria 1346
232 Ga0501037_0143727 3300049573 Bacteria 1707
233 Ga0501047_0007417 3300049581 Bacteria 10319
234 Ga0501069_0203582 3300049585 Bacteria 1147
235 Ga0501071_0140499 3300049587 Bacteria 1798
236 Ga0501071_0574884 3300049587 Bacteria 866
237 Ga0501073_0478184 3300049589 Bacteria 861
238 Ga0501075_0010655 3300049591 Bacteria 6469
239 Ga0501075_0298267 3300049591 Bacteria 1228
240 Ga0501075_0433352 3300049591 Bacteria 1002
241 Ga0501076_0012399 3300049592 Bacteria 6371
242 Ga0501076_0160973 3300049592 Bacteria 1828
243 Ga0501076_0501088 3300049592 Bacteria 1001
244 Ga0501079_0142810 3300049741 Bacteria 1865
245 Ga0501080_0231975 3300049742 Bacteria 1687
246 Ga0501080_0439754 3300049742 Bacteria 1170
247 Ga0501081_0009066 3300049743 Bacteria 6469
248 Ga0501035_0395549 3300049822 Bacteria 1150
249 Ga0501045_0149408 3300049824 Bacteria 1738
250 nmdc:mga00v17_123079_c1 3300050491 Bacteria 1653
251 nmdc:mga06z11_63618_c1 3300050494 Bacteria 1931
252 nmdc:mga05p37_122966_c1 3300050507 Unclassified 3188
253 nmdc:mga05p37_254081_c1 3300050507 Bacteria 2107
254 nmdc:mga05p37_28583_c1 3300050507 Bacteria 6800
255 nmdc:mga05p37_356252_c1 3300050507 Bacteria 1722
256 nmdc:mga05p37_41710_c1 3300050507 Bacteria 5636
257 nmdc:mga05p37_461_c1 3300050507 Bacteria 44218
258 nmdc:mga05p37_51887_c1 3300050507 Bacteria 5043
259 nmdc:mga05p37_73590_c1 3300050507 Bacteria 4205
260 nmdc:mga09592_22970_c1 3300050508 Bacteria 5147
261 nmdc:mga09592_8018_c1 3300050508 Bacteria 8588
262 nmdc:mga0qj67_130522_c1 3300050509 Unclassified 2035
263 nmdc:mga0n895_217305_c1 3300050512 Bacteria 1941
264 nmdc:mga0n895_288372_c1 3300050512 Bacteria 1664
265 nmdc:mga0n895_385012_c1 3300050512 Bacteria 1419
266 nmdc:mga0n895_730_c1 3300050512 Bacteria 23148
267 nmdc:mga0rr50_1396_c1 3300050513 Bacteria 13223
268 nmdc:mga0rr50_229516_c1 3300050513 Bacteria 1535
269 nmdc:mga0rr50_299270_c1 3300050513 Bacteria 1345
270 nmdc:mga0rr50_52088_c1 3300050513 Bacteria 3040
271 nmdc:mga0rr50_92734_c1 3300050513 Bacteria 2355
272 nmdc:mga08x19_181664_c1 3300050514 Unclassified 1436
273 nmdc:mga08x19_59240_c1 3300050514 Bacteria 2478
274 nmdc:mga0a205_140374_c1 3300050515 Bacteria 2316
275 nmdc:mga0a205_2012_c1 3300050515 Bacteria 17742
276 nmdc:mga0a205_42053_c1 3300050515 Bacteria 4403
277 nmdc:mga0a205_433656_c1 3300050515 Unclassified 1175
278 nmdc:mga0a205_55394_c1 3300050515 Bacteria 3830
279 nmdc:mga0a205_723256_c1 3300050515 Bacteria 845
280 nmdc:mga0a205_88536_c1 3300050515 Bacteria 2992
281 Ga0495601_0006110 3300053077 Bacteria 7030
282 Ga0495595_0236585 3300053084 Bacteria 913
283 Ga0495619_0007171 3300053085 Bacteria 7062
284 Ga0500644_0041757 3300053088 Bacteria 1525
285 Ga0500568_0002853 3300053139 Bacteria 9948
286 Ga0501084_0079683 3300054114 Bacteria 2745
287 Ga0501082_0129519 3300060353 Bacteria 2189
288 Ga0501082_0411287 3300060353 Bacteria 1181
289 Ga0075436_100034348
290 Ga0065704_10000658
291 Ga0065704_10151534
292 Ga0065707_10295300
293 Ga0070670_100282747
294 Ga0068868_100731081
295 Ga0070689_100008200
296 Ga0070689_100149239
297 Ga0070689_100458493
298 Ga0070687_100201173
299 Ga0070668_100310656
300 Ga0070703_10000566
301 Ga0070705_100102196
302 Ga0070694_100004477
303 Ga0070694_100215793
304 Ga0070694_100349226
305 Ga0070708_100003559
306 Ga0070708_100005282
307 Ga0070708_100034137
308 Ga0070708_100079049
309 Ga0070708_100093986
310 Ga0070708_100385581
311 Ga0070663_100428114
312 Ga0070706_100007065
313 Ga0070706_100013639
314 Ga0070706_100057146
315 Ga0070706_100081236
316 Ga0070706_100097499
317 Ga0070706_100233191
318 Ga0070706_100522166
319 Ga0070706_100631295
320 Ga0070707_100015132
321 Ga0070707_100031208
322 Ga0070707_100037164
323 Ga0070707_100219323
324 Ga0070707_100245664
325 Ga0070707_100303793
326 Ga0070707_100419979
327 Ga0070707_100920847
328 Ga0070707_101000189
329 Ga0070698_100000121
330 Ga0070698_100000190
331 Ga0070698_100001807
332 Ga0070698_100011447
333 Ga0070698_100034058
334 Ga0070698_100047266
335 Ga0070698_100086168
336 Ga0070698_100134540
337 Ga0070698_100327618
338 Ga0070698_100658470
339 Ga0070698_100831900
340 Ga0070699_100040530
341 Ga0070699_100043607
342 Ga0070699_100069093
343 Ga0070699_100071497
344 Ga0070699_100169826
345 Ga0070699_100198435
346 Ga0070699_100297731
347 Ga0070699_100363236
348 Ga0070699_100636620
349 Ga0070697_100004553
350 Ga0070697_100125449
351 Ga0070697_100138213
352 Ga0070697_100147721
353 Ga0070697_100151398
354 Ga0070697_100307597
355 Ga0070695_100611622
356 Ga0070696_100013961
357 Ga0070693_100639961
358 Ga0070704_100235684
359 Ga0070664_100199266
360 Ga0068857_100007009
361 Ga0068857_100746936
362 Ga0068854_100050924
363 Ga0068856_100029806
364 Ga0068859_100018684
365 Ga0068862_100064232
366 Ga0081539_10013415
367 Ga0070716_100206525
368 Ga0070716_100607523
369 Ga0075367_10051606
370 Ga0075367_10099050
371 Ga0075428_100145595
372 Ga0075430_100146877
373 Ga0075433_10000855
374 Ga0075433_10020004
375 Ga0075433_10049083
376 Ga0075433_10057645
377 Ga0075434_100000940
378 Ga0075434_100059188
379 Ga0075434_100250409
380 Ga0075429_100000945
381 Ga0075436_100014295
382 Ga0075436_100067843
383 Ga0097620_100018684
384 Ga0075435_100001232
385 Ga0075435_100086781
386 Ga0075435_100122541
387 Ga0105247_10364909
388 Ga0114129_10000942
389 Ga0114129_10001256
390 Ga0114129_10011979
391 Ga0114129_10013507
392 Ga0114129_10017318
393 Ga0114129_10044695
394 Ga0114129_10064408
395 Ga0114129_10133524
396 Ga0114129_10201166
397 Ga0114129_10285150
398 Ga0105241_10223348
399 Ga0105242_11057338
400 Ga0105249_10080701
401 Ga0105246_10030704
402 Ga0157373_10112246
403 Ga0157380_10557914
404 Ga0157380_11055183
405 Ga0157376_11570378
406 Ga0207645_10115554
407 Ga0207684_10000044
408 Ga0207684_10000108
409 Ga0207684_10015861
410 Ga0207684_10024916
411 Ga0207684_10063158
412 Ga0207684_10064272
413 Ga0207684_10077195
414 Ga0207684_10084276
415 Ga0207684_10682067
416 Ga0207693_10032612
417 Ga0207652_10308587
418 Ga0207646_10003615
419 Ga0207646_10014669
420 Ga0207646_10043994
421 Ga0207646_10053512
422 Ga0207646_10115466
423 Ga0207646_10129961
424 Ga0207646_10152733
425 Ga0207709_10032272
426 Ga0207670_10005522
427 Ga0207665_10058241
428 Ga0207651_10332980
429 Ga0207640_10038624
430 Ga0207658_10110286
431 Ga0207639_10595651
432 Ga0207678_10011794
433 Ga0207676_10617882
434 Ga0207674_10010619
435 Ga0268265_10049043
436 Ga0268265_10116705
437 Ga0265334_10057217
438 Ga0265318_10025384
439 Ga0265338_10118272
440 Ga0265330_10015429
441 Ga0265320_10051452
442 Ga0265329_10037234
443 Ga0265340_10043326
444 Ga0265339_10005630
445 Ga0265339_10127889
446 Ga0265331_10001911
447 Ga0265331_10010794
448 Ga0265331_10055730
449 Ga0265316_10123758
450 Ga0265313_10052789
451 Ga0265314_10011922
452 Ga0265314_10339444
453 Ga0265342_10036149
454 Ga0265342_10153381
455 Ga0316576_10069040
456 Ga0307410_10012556
457 Ga0307409_100008329
458 Ga0307409_101041993
459 Ga0307416_100381886
460 Ga0307414_10260390
461 Ga0307411_10004785
462 Ga0307411_10890962
463 Ga0307415_100392784
464 Ga0316585_10005821
465 Ga0373944_0013436
466 Ga0373939_0088207
467 Ga0373955_0032406
468 Ga0373962_0033480
469 Ga0316574_0164169
470 Ga0316574_0330572
471 Ga0373924_0211579
472 Ga0373935_0048906
473 Ga0373935_0151805
474 Ga0373947_0137832
475 Ga0373947_0240158
476 Ga0373937_0465325
477 Ga0316582_0048794
478 Ga0316584_0008008
479 Ga0395900_0660690
480 Ga0395905_0109052
481 Ga0395905_0207135
482 Ga0395905_0251174
483 Ga0400483_231983
484 Ga0436365_0977285
485 Ga0436365_1742793
486 Ga0439434_0154425
487 Ga0451577_0002943
488 Ga0451577_0300298
489 Ga0451577_0308310
490 Ga0453683_0029460
491 Ga0453684_0007246
492 Ga0453684_0015595
493 Ga0453684_0039975
494 Ga0453684_0048623
495 Ga0453684_0364963
496 Ga0453684_0378733
497 Ga0453684_1183191
498 Ga0451576_0000836
499 Ga0451576_0076352
500 Ga0451576_0284541
501 Ga0451576_0386760
502 Ga0451576_0547373
503 Ga0466967_0036230
504 Ga0495638_0184702
505 Ga0495672_0047851
506 Ga0496101_0106113
507 Ga0496102_0017641
508 Ga0496103_0091822
509 Ga0496105_0253869
510 Ga0496106_0168008
511 Ga0496108_0113869
512 Ga0496109_0107802
513 Ga0496110_0076472
514 Ga0496111_0051140
515 Ga0496112_0064123
516 Ga0496112_0182992
517 Ga0496112_0194827
518 Ga0496115_0130314
519 Ga0501034_0375949
520 Ga0501037_0143727
521 Ga0501047_0007417
522 Ga0501069_0203582
523 Ga0501071_0140499
524 Ga0501071_0574884
525 Ga0501073_0478184
526 Ga0501075_0010655
527 Ga0501075_0298267
528 Ga0501075_0433352
529 Ga0501076_0012399
530 Ga0501076_0160973
531 Ga0501076_0501088
532 Ga0501079_0142810
533 Ga0501080_0231975
534 Ga0501080_0439754
535 Ga0501081_0009066
536 Ga0501035_0395549
537 Ga0501045_0149408
538 nmdc:mga00v17_123079_c1
539 nmdc:mga06z11_63618_c1
540 nmdc:mga05p37_122966_c1
541 nmdc:mga05p37_254081_c1
542 nmdc:mga05p37_28583_c1
543 nmdc:mga05p37_356252_c1
544 nmdc:mga05p37_41710_c1
545 nmdc:mga05p37_461_c1
546 nmdc:mga05p37_51887_c1
547 nmdc:mga05p37_73590_c1
548 nmdc:mga09592_22970_c1
549 nmdc:mga09592_8018_c1
550 nmdc:mga0qj67_130522_c1
551 nmdc:mga0n895_217305_c1
552 nmdc:mga0n895_288372_c1
553 nmdc:mga0n895_385012_c1
554 nmdc:mga0n895_730_c1
555 nmdc:mga0rr50_1396_c1
556 nmdc:mga0rr50_229516_c1
557 nmdc:mga0rr50_299270_c1
558 nmdc:mga0rr50_52088_c1
559 nmdc:mga0rr50_92734_c1
560 nmdc:mga08x19_181664_c1
561 nmdc:mga08x19_59240_c1
562 nmdc:mga0a205_140374_c1
563 nmdc:mga0a205_2012_c1
564 nmdc:mga0a205_42053_c1
565 nmdc:mga0a205_433656_c1
566 nmdc:mga0a205_55394_c1
567 nmdc:mga0a205_723256_c1
568 nmdc:mga0a205_88536_c1
569 Ga0495601_0006110
570 Ga0495595_0236585
571 Ga0495619_0007171
572 Ga0500644_0041757
573 Ga0500568_0002853
574 Ga0501084_0079683
575 Ga0501082_0129519
576 Ga0501082_0411287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

31

228

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9782 5 219
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9722 6 220
1tqj-assembly1.cif.gz_D crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9717 5 217
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9705 5 220
1tqj-assembly1.cif.gz_B crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9702 5 217
ID Description Score Start End Superfamily
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9774 5 220 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9774 5 220 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9719 5 220 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9717 5 217 3.20.20.70
af_P9WI51_4_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9605 1 220 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A850C8H0-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9977 26 220 GO:0004750
GO:0005975
GO:0006098
GO:0046872
AF-A0A7C4YT74-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.997 6 220 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A1Q7VCL4-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9919 5 218 GO:0004750
GO:0005975
GO:0006098
GO:0046872
AF-A0A7C2DNQ3-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9917 5 220 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A349LF31-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9913 10 180 GO:0004750
GO:0005975
GO:0006098

Map