F388500

General Info

Members Datasets Scaffolds Average Seq Length
288 214 262 214

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10002610|Ga0075364_100026104
Length 239
Sequence MACTSCSSARPAPNNNPGWRRALWIALIVNGAMFVAEMTAGVAGGSKALQADALDFLGDAANYAISLGVAGMVLAWRARAAILKGATLAILGLYVLAATIWTIWNGRVPEAEVMGIIGIVALLANAGVAIMLYRFRNGDANMRSVWICSRNDAIGNIAVVLAAAGVFGTGSAWPDLVVAAIMAALGLSGGVQIMIQARRELPGSRTPSLGARQRGPLAGARKEVMPIPHSRGALLQDDT

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
6 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
7 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
8 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
9 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
10 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
11 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
12 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
13 2851153111 Caulobacter radicis 736 Isolate Unclassified
14 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
15 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
16 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
17 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
18 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
19 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
20 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
21 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
133 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
182 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
185 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
203 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
204 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
205 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
206 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
207 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
208 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
209 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
210 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
211 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
212 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
213 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
214 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.62
Metatranscriptomes 0.35
Isolates 9.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.79
Nodule 3.12
Rhizoplane 1.39
Rhizosphere 68.4
Stem 0
Stem Tuber 0.35
Unclassified 6.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_3173165 2162886006 Bacteria 1564
2 JGI24739J22299_10002530 3300001989 Bacteria 7044
3 JGI24750J21931_1011241 3300002070 Bacteria 1175
4 JGI24751J29686_10003625 3300002459 Bacteria 3111
5 JGI25151J46595_10072523 3300003187 Bacteria 1035
6 Ga0055536_1004008 3300003781 Bacteria 7695
7 Ga0055536_1004837 3300003781 Bacteria 6732
8 Ga0055530_10001241 3300003791 Bacteria 19468
9 Ga0055531_10004486 3300003794 Bacteria 8482
10 Ga0065707_10000679 3300005295 Bacteria 13733
11 Ga0070658_10000081 3300005327 Bacteria 90275
12 Ga0070658_10186601 3300005327 Bacteria 1747
13 Ga0070670_100000053 3300005331 Bacteria 128475
14 Ga0070670_100001886 3300005331 Bacteria 17123
15 Ga0070666_10000392 3300005335 Bacteria 27574
16 Ga0070668_100012774 3300005347 Bacteria 6251
17 Ga0070669_100000023 3300005353 Bacteria 174496
18 Ga0070669_100000030 3300005353 Bacteria 160753
19 Ga0070667_100002263 3300005367 Bacteria 16955
20 Ga0070713_100070612 3300005436 Bacteria 2949
21 Ga0070713_100279666 3300005436 Bacteria 1531
22 Ga0070711_100174348 3300005439 Bacteria 1642
23 Ga0070705_100359477 3300005440 Bacteria 1064
24 Ga0070708_100063173 3300005445 Bacteria 3314
25 Ga0070662_100052313 3300005457 Bacteria 2951
26 Ga0070679_100283078 3300005530 Unclassified 1610
27 Ga0068853_100000140 3300005539 Bacteria 49375
28 Ga0070672_100173904 3300005543 Bacteria 1792
29 Ga0070665_100030306 3300005548 Bacteria 5444
30 Ga0070665_100118053 3300005548 Bacteria 2655
31 Ga0068855_100000313 3300005563 Bacteria 60285
32 Ga0070664_100154970 3300005564 Bacteria 2024
33 Ga0068854_100001416 3300005578 Bacteria 14489
34 Ga0068856_100210631 3300005614 Bacteria 1959
35 Ga0070702_100162974 3300005615 Bacteria 1443
36 Ga0068852_100000112 3300005616 Bacteria 54817
37 Ga0068859_100000958 3300005617 Bacteria 29557
38 Ga0068864_100000055 3300005618 Bacteria 128475
39 Ga0068864_100007326 3300005618 Bacteria 9079
40 Ga0068861_100020314 3300005719 Bacteria 4755
41 Ga0068863_100001618 3300005841 Bacteria 22236
42 Ga0068858_100008736 3300005842 Bacteria 9726
43 Ga0068860_100017887 3300005843 Bacteria 6903
44 Ga0068860_100591459 3300005843 Bacteria 1114
45 Ga0068862_100000425 3300005844 Bacteria 45885
46 Ga0068862_100035914 3300005844 Bacteria 4199
47 Ga0070717_10122752 3300006028 Bacteria 2227
48 Ga0075365_10002035 3300006038 Bacteria 9614
49 Ga0075365_10168947 3300006038 Bacteria 1526
50 Ga0075364_10000022 3300006051 Bacteria 53466
51 Ga0075364_10002610 3300006051 Bacteria 10114
52 Ga0075362_10057120 3300006177 Bacteria 1758
53 Ga0075362_10238472 3300006177 Bacteria 892
54 Ga0075367_10008181 3300006178 Bacteria 5404
55 Ga0075369_10000796 3300006186 Bacteria 10326
56 Ga0075369_10073034 3300006186 Bacteria 1512
57 Ga0075366_10002037 3300006195 Bacteria 10254
58 Ga0075370_10004385 3300006353 Bacteria 6843
59 Ga0075370_10055041 3300006353 Bacteria 2260
60 Ga0075430_100168351 3300006846 Bacteria 1823
61 Ga0097620_100000958 3300006931 Bacteria 29557
62 Ga0105250_10000551 3300009092 Bacteria 25565
63 Ga0105240_10000156 3300009093 Bacteria 139950
64 Ga0105245_11389626 3300009098 Bacteria 752
65 Ga0105247_10007890 3300009101 Bacteria 6510
66 Ga0105248_10137571 3300009177 Bacteria 2755
67 Ga0105248_10308863 3300009177 Bacteria 1781
68 Ga0105237_10000325 3300009545 Bacteria 67280
69 Ga0105249_10006886 3300009553 Bacteria 9908
70 Ga0105249_11053412 3300009553 Bacteria 883
71 Ga0105239_10000118 3300010375 Bacteria 112168
72 Ga0105239_11379736 3300010375 Bacteria 813
73 Ga0157371_10015758 3300013102 Bacteria 5658
74 Ga0163162_11073775 3300013306 Bacteria 912
75 Ga0157372_10000722 3300013307 Bacteria 36035
76 Ga0157379_10095535 3300014968 Bacteria 2667
77 Ga0157379_10691777 3300014968 Bacteria 957
78 Ga0224712_10139000 3300022467 Bacteria 1067
79 Ga0209677_101589 3300025253 Bacteria 9606
80 Ga0209675_1000555 3300025291 Bacteria 27086
81 Ga0209676_1000421 3300025292 Bacteria 74706
82 Ga0209676_1001076 3300025292 Bacteria 30900
83 Ga0209676_1005589 3300025292 Bacteria 6497
84 Ga0209025_1009760 3300025294 Bacteria 6627
85 Ga0209025_1111270 3300025294 Bacteria 841
86 Ga0209050_1000112 3300025298 Bacteria 210320
87 Ga0209050_1006833 3300025298 Bacteria 6632
88 Ga0209257_1000877 3300025304 Bacteria 42562
89 Ga0209257_1003857 3300025304 Bacteria 12255
90 Ga0209257_1008253 3300025304 Bacteria 5989
91 Ga0209257_1019666 3300025304 Bacteria 2531
92 Ga0209257_1038677 3300025304 Bacteria 1443
93 Ga0207697_10000005 3300025315 Bacteria 85907
94 Ga0207696_1010781 3300025711 Bacteria 3332
95 Ga0207710_10003734 3300025900 Bacteria 6740
96 Ga0207680_10000062 3300025903 Bacteria 48850
97 Ga0207647_10012703 3300025904 Bacteria 5852
98 Ga0207705_10000193 3300025909 Bacteria 61961
99 Ga0207695_10000250 3300025913 Bacteria 139984
100 Ga0207671_10000100 3300025914 Bacteria 131821
101 Ga0207663_10157516 3300025916 Bacteria 1599
102 Ga0207652_10046746 3300025921 Bacteria 3695
103 Ga0207681_10000004 3300025923 Bacteria 559005
104 Ga0207681_10000036 3300025923 Bacteria 161782
105 Ga0207694_10022609 3300025924 Bacteria 4771
106 Ga0207650_10000075 3300025925 Bacteria 134026
107 Ga0207650_10001277 3300025925 Bacteria 18255
108 Ga0207706_10020134 3300025933 Bacteria 5995
109 Ga0207691_10503783 3300025940 Bacteria 1028
110 Ga0207711_10114774 3300025941 Bacteria 2399
111 Ga0207679_10670661 3300025945 Bacteria 939
112 Ga0207667_10000006 3300025949 Bacteria 679876
113 Ga0207667_10000091 3300025949 Bacteria 148651
114 Ga0207712_10012624 3300025961 Bacteria 5398
115 Ga0207668_10000370 3300025972 Bacteria 28629
116 Ga0207668_10006943 3300025972 Bacteria 6718
117 Ga0207668_10778051 3300025972 Bacteria 846
118 Ga0207640_10000160 3300025981 Bacteria 48881
119 Ga0207658_10001947 3300025986 Bacteria 15422
120 Ga0207703_10016115 3300026035 Bacteria 5827
121 Ga0207639_10000038 3300026041 Bacteria 145316
122 Ga0207708_10729535 3300026075 Bacteria 849
123 Ga0207702_10197059 3300026078 Bacteria 1865
124 Ga0207641_10000268 3300026088 Bacteria 66121
125 Ga0207676_10000041 3300026095 Bacteria 166172
126 Ga0207676_10001681 3300026095 Bacteria 16316
127 Ga0207675_100024746 3300026118 Bacteria 5584
128 Ga0207698_10000081 3300026142 Bacteria 63461
129 Ga0209974_10007474 3300027876 Bacteria 3765
130 Ga0209974_10212017 3300027876 Bacteria 718
131 Ga0268266_10269080 3300028379 Bacteria 1581
132 Ga0268266_10288622 3300028379 Bacteria 1527
133 Ga0268265_10000046 3300028380 Bacteria 179361
134 Ga0268264_10007525 3300028381 Bacteria 9086
135 Ga0268264_10561010 3300028381 Bacteria 1121
136 Ga0307408_100005173 3300031548 Bacteria 8752
137 Ga0307516_10515392 3300031730 Bacteria 850
138 Ga0307413_10010049 3300031824 Bacteria 4564
139 Ga0307410_10029449 3300031852 Plasmid 3496
140 Ga0307407_10276381 3300031903 Unclassified 1161
141 Ga0307412_10000159 3300031911 Bacteria 47835
142 Ga0307412_10003989 3300031911 Bacteria 8228
143 Ga0307412_10047319 3300031911 Bacteria 2825
144 Ga0307412_10201295 3300031911 Unclassified 1512
145 Ga0307416_100110446 3300032002 Bacteria 2421
146 Ga0307414_10000223 3300032004 Bacteria 37440
147 Ga0307414_10007568 3300032004 Bacteria 6107
148 Ga0307414_10008349 3300032004 Bacteria 5865
149 Ga0307414_10092712 3300032004 Bacteria 2249
150 Ga0307414_10449205 3300032004 Bacteria 1130
151 Ga0307414_11046450 3300032004 Bacteria 752
152 Ga0307411_10000546 3300032005 Bacteria 13328
153 Ga0307411_10178456 3300032005 Bacteria 1609
154 Ga0307507_10172992 3300033179 Bacteria 1564
155 Ga0373935_0443276 3300035692 Bacteria 937
156 Ga0237819_03065 3300038705 Bacteria 3085
157 Ga0237816_00251 3300039145 Bacteria 4480
158 Ga0451577_0606152 3300042876 Bacteria 994
159 Ga0451576_0008284 3300045051 Bacteria 12220
160 Ga0495627_007004 3300046453 Bacteria 4373
161 Ga0495638_0000836 3300046460 Bacteria 32322
162 Ga0495650_0012905 3300046471 Bacteria 4460
163 Ga0495605_0000103 3300046474 Bacteria 105879
164 Ga0495584_0038638 3300046491 Bacteria 2412
165 Ga0495596_0029054 3300046500 Bacteria 2218
166 Ga0495583_0086016 3300046506 Bacteria 1360
167 Ga0495610_0000090 3300046512 Bacteria 106145
168 Ga0495616_0200972 3300046513 Bacteria 876
169 Ga0495632_0000096 3300046519 Bacteria 89284
170 Ga0495637_0001690 3300046520 Bacteria 12740
171 Ga0495643_0001606 3300046522 Bacteria 20005
172 Ga0495643_0002134 3300046522 Bacteria 16303
173 Ga0495643_0019509 3300046522 Bacteria 3921
174 Ga0495643_0059525 3300046522 Bacteria 2030
175 Ga0495663_0000016 3300046525 Bacteria 142125
176 Ga0495654_0001066 3300046530 Bacteria 20022
177 Ga0495621_0090028 3300046539 Bacteria 1155
178 Ga0495597_0152489 3300046542 Bacteria 947
179 Ga0495633_0001331 3300046558 Bacteria 19380
180 Ga0495668_0001409 3300046616 Bacteria 23419
181 Ga0495625_0000031 3300046660 Bacteria 238193
182 Ga0495625_0000526 3300046660 Bacteria 56429
183 Ga0495625_0325184 3300046660 Bacteria 978
184 Ga0495625_0422395 3300046660 Bacteria 829
185 Ga0495671_0000974 3300046692 Bacteria 20005
186 Ga0495683_0210117 3300047323 Bacteria 873
187 Ga0495681_0015171 3300047470 Bacteria 4370
188 Ga0495681_0031945 3300047470 Bacteria 2655
189 Ga0495686_0000060 3300047472 Bacteria 237402
190 Ga0495686_0123110 3300047472 Bacteria 1543
191 Ga0495615_0000007 3300048090 Bacteria 90892
192 Ga0495615_0000033 3300048090 Bacteria 45796
193 Ga0496100_0003322 3300048903 Bacteria 8373
194 Ga0496101_0002485 3300048904 Bacteria 11324
195 Ga0496106_0000047 3300048909 Bacteria 100449
196 Ga0496107_0000035 3300048910 Bacteria 86628
197 Ga0496117_0046062 3300048920 Bacteria 3141
198 Ga0496121_0025741 3300048924 Bacteria 5570
199 Ga0496123_0099869 3300048926 Bacteria 1693
200 Ga0496124_0045778 3300048927 Bacteria 3750
201 Ga0496124_0058391 3300048927 Bacteria 3245
202 Ga0496125_0002524 3300048928 Bacteria 23632
203 Ga0496125_0032927 3300048928 Bacteria 4596
204 Ga0501031_0263645 3300049568 Bacteria 1119
205 Ga0501032_0017562 3300049569 Bacteria 5021
206 Ga0501033_0099787 3300049570 Bacteria 2119
207 Ga0501033_0505936 3300049570 Bacteria 835
208 Ga0501034_0283213 3300049571 Bacteria 1597
209 Ga0501036_0010833 3300049572 Bacteria 7532
210 Ga0501036_0552631 3300049572 Bacteria 957
211 Ga0501037_0056870 3300049573 Bacteria 2856
212 Ga0501038_0009132 3300049574 Bacteria 9095
213 Ga0501038_0024791 3300049574 Bacteria 5347
214 Ga0501043_0053494 3300049579 Bacteria 3170
215 Ga0501043_0364618 3300049579 Bacteria 1096
216 Ga0501047_0001707 3300049581 Bacteria 21355
217 Ga0501047_0038514 3300049581 Bacteria 4625
218 Ga0501048_0332656 3300049582 Bacteria 1082
219 Ga0501070_0152579 3300049586 Bacteria 1906
220 Ga0501073_0010038 3300049589 Bacteria 6961
221 Ga0501235_000335 3300049669 Bacteria 8962
222 Ga0501225_0002378 3300049705 Bacteria 5806
223 Ga0501080_0003602 3300049742 Bacteria 13638
224 Ga0501281_00014 3300049777 Bacteria 23792
225 Ga0501283_000570 3300049779 Bacteria 4829
226 Ga0501035_0007205 3300049822 Bacteria 10408
227 Ga0501035_0267033 3300049822 Bacteria 1449
228 Ga0501035_0297184 3300049822 Bacteria 1361
229 Ga0501044_0044143 3300049823 Bacteria 4629
230 Ga0501044_0068122 3300049823 Bacteria 3626
231 Ga0501044_0112210 3300049823 Bacteria 2733
232 Ga0501044_0699376 3300049823 Bacteria 899
233 nmdc:mga03683_16551_c1 3300050489 Bacteria 2772
234 nmdc:mga00v17_1563_c1 3300050491 Bacteria 11955
235 nmdc:mga00v17_91_c1 3300050491 Bacteria 53223
236 nmdc:mga0yw44_47892_c1 3300050492 Bacteria 2575
237 nmdc:mga0yw44_621_c1 3300050492 Bacteria 12855
238 nmdc:mga0k408_3834_c1 3300050493 Bacteria 7969
239 nmdc:mga0k408_7379_c1 3300050493 Bacteria 5869
240 nmdc:mga06z11_34382_c1 3300050494 Bacteria 2488
241 nmdc:mga07m45_1802_c1 3300050496 Bacteria 9869
242 nmdc:mga07m45_4418_c1 3300050496 Bacteria 5524
243 nmdc:mga07m45_56788_c1 3300050496 Bacteria 2213
244 nmdc:mga0qj67_245330_c1 3300050509 Bacteria 1453
245 nmdc:mga0sz30_34_c1 3300050516 Bacteria 53573
246 nmdc:mga0sz30_36256_c1 3300050516 Bacteria 1512
247 Ga0495601_0001128 3300053077 Bacteria 14641
248 Ga0495612_0010554 3300053078 Bacteria 3734
249 Ga0495619_0033200 3300053085 Bacteria 3351
250 Ga0500651_0184918 3300053093 Bacteria 1236
251 Ga0500658_0000722 3300053134 Bacteria 13655
252 Ga0500559_0008001 3300053136 Bacteria 4656
253 Ga0500564_002317 3300053138 Bacteria 7004
254 Ga0500590_000021 3300053148 Bacteria 42640
255 Ga0500590_100633 3300053148 Bacteria 1388
256 Ga0500604_0008547 3300053151 Bacteria 2719
257 Ga0500622_0000188 3300053156 Bacteria 65148
258 Ga0500622_0006837 3300053156 Bacteria 6557
259 Ga0500627_0000002 3300053158 Bacteria 235747
260 Ga0500627_0000202 3300053158 Bacteria 17284
261 Ga0500637_0004224 3300053178 Bacteria 6780
262 Ga0500596_001463 3300053735 Bacteria 4784

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10168947 Ga0075365_101689472 179
2 3300050492 nmdc:mga0yw44_47892_c1 nmdc:mga0yw44_47892_c1_1519_2208 179
3 3300053136 Ga0500559_0008001 Ga0500559_0008001_2109_2765 179
4 3300025253 Ga0209677_101589 Ga0209677_1015893 187
5 3300046530 Ga0495654_0001066 Ga0495654_0001066_7139_7738 188
6 3300046616 Ga0495668_0001409 Ga0495668_0001409_12758_13357 188
7 3300049822 Ga0501035_0267033 Ga0501035_0267033_743_1342 188
8 3300053158 Ga0500627_0000202 Ga0500627_0000202_8868_9467 188
9 iso_pu_bacteria 2885427238 2885427389 190
10 3300031911 Ga0307412_10003989 Ga0307412_100039894 191
11 3300042876 Ga0451577_0606152 Ga0451577_0606152_283_951 193
12 3300006353 Ga0075370_10055041 Ga0075370_100550414 194
13 3300009098 Ga0105245_11389626 Ga0105245_113896261 194
14 3300050496 nmdc:mga07m45_4418_c1 nmdc:mga07m45_4418_c1_660_1310 194
15 3300038705 Ga0237819_03065 Ga0237819_03065_1001_1645 195
16 3300039145 Ga0237816_00251 Ga0237816_00251_1148_1792 195
17 3300025972 Ga0207668_10006943 Ga0207668_100069438 196
18 3300046519 Ga0495632_0000096 Ga0495632_0000096_17760_18422 196
19 3300046525 Ga0495663_0000016 Ga0495663_0000016_29689_30351 196
20 3300046558 Ga0495633_0001331 Ga0495633_0001331_3124_3786 196
21 3300046660 Ga0495625_0325184 Ga0495625_0325184_64_726 196
22 3300047472 Ga0495686_0123110 Ga0495686_0123110_618_1280 196
23 3300006195 Ga0075366_10002037 Ga0075366_100020375 197
24 3300035692 Ga0373935_0443276 Ga0373935_0443276_45_692 197
25 3300050493 nmdc:mga0k408_3834_c1 nmdc:mga0k408_3834_c1_5346_6032 197
26 3300031548 Ga0307408_100005173 Ga0307408_1000051733 198
27 3300046453 Ga0495627_007004 Ga0495627_007004_426_1079 199
28 3300046471 Ga0495650_0012905 Ga0495650_0012905_3346_3999 199
29 3300046500 Ga0495596_0029054 Ga0495596_0029054_1137_1790 199
30 3300046506 Ga0495583_0086016 Ga0495583_0086016_402_1055 199
31 3300046512 Ga0495610_0000090 Ga0495610_0000090_104367_105020 199
32 3300046513 Ga0495616_0200972 Ga0495616_0200972_97_750 199
33 3300047323 Ga0495683_0210117 Ga0495683_0210117_45_698 199
34 3300047470 Ga0495681_0015171 Ga0495681_0015171_472_1125 199
35 3300048090 Ga0495615_0000007 Ga0495615_0000007_7934_8587 199
36 3300005439 Ga0070711_100174348 Ga0070711_1001743483 200
37 3300025916 Ga0207663_10157516 Ga0207663_101575163 200
38 3300049574 Ga0501038_0024791 Ga0501038_0024791_3847_4500 200
39 3300049589 Ga0501073_0010038 Ga0501073_0010038_2389_3042 200
40 3300049742 Ga0501080_0003602 Ga0501080_0003602_11266_11919 200
41 3300005614 Ga0068856_100210631 Ga0068856_1002106312 201
42 3300022467 Ga0224712_10139000 Ga0224712_101390002 201
43 3300006846 Ga0075430_100168351 Ga0075430_1001683512 202
44 3300049579 Ga0501043_0364618 Ga0501043_0364618_357_1019 202
45 3300050509 nmdc:mga0qj67_245330_c1 nmdc:mga0qj67_245330_c1_612_1253 202
46 iso_pu_bacteria 2852653556 2852657093 202
47 iso_pu_bacteria 2896253425 2896253992 202
48 3300005530 Ga0070679_100283078 Ga0070679_1002830783 203
49 3300025921 Ga0207652_10046746 Ga0207652_100467463 203
50 3300053148 Ga0500590_100633 Ga0500590_100633_637_1299 203
51 3300053151 Ga0500604_0008547 Ga0500604_0008547_1891_2523 203
52 iso_pu_bacteria 2643221563 2643832750 203
53 iso_pu_bacteria 2643221608 2644053455 203
54 iso_pu_bacteria 2852680915 2852683765 203
55 iso_pu_bacteria 2928968154 2928969806 203
56 3300046491 Ga0495584_0038638 Ga0495584_0038638_518_1180 204
57 3300046520 Ga0495637_0001690 Ga0495637_0001690_4157_4819 204
58 3300046522 Ga0495643_0001606 Ga0495643_0001606_4435_5097 204
59 3300046692 Ga0495671_0000974 Ga0495671_0000974_14909_15571 204
60 3300047470 Ga0495681_0031945 Ga0495681_0031945_437_1099 204
61 iso_pu_bacteria 2643221560 2643821475 204
62 iso_pu_bacteria 2739367664 2739652463 204
63 iso_pu_bacteria 2739367865 2740030936 204
64 3300010375 Ga0105239_11379736 Ga0105239_113797361 205
65 3300014968 Ga0157379_10691777 Ga0157379_106917771 205
66 3300027876 Ga0209974_10007474 Ga0209974_100074743 205
67 3300049669 Ga0501235_000335 Ga0501235_000335_691_1347 205
68 3300049705 Ga0501225_0002378 Ga0501225_0002378_252_908 205
69 3300049777 Ga0501281_00014 Ga0501281_00014_16834_17490 205
70 3300006038 Ga0075365_10002035 Ga0075365_100020355 206
71 3300006051 Ga0075364_10000022 Ga0075364_1000002220 206
72 3300006178 Ga0075367_10008181 Ga0075367_100081814 206
73 3300006186 Ga0075369_10000796 Ga0075369_100007963 206
74 3300027876 Ga0209974_10212017 Ga0209974_102120171 206
75 3300032004 Ga0307414_10449205 Ga0307414_104492052 206
76 3300046474 Ga0495605_0000103 Ga0495605_0000103_68754_69374 206
77 3300050491 nmdc:mga00v17_91_c1 nmdc:mga00v17_91_c1_32638_33321 206
78 3300050492 nmdc:mga0yw44_621_c1 nmdc:mga0yw44_621_c1_5992_6675 206
79 3300050494 nmdc:mga06z11_34382_c1 nmdc:mga06z11_34382_c1_1283_1903 206
80 3300050516 nmdc:mga0sz30_34_c1 nmdc:mga0sz30_34_c1_43744_44427 206
81 3300003187 JGI25151J46595_10072523 JGI25151J46595_100725232 207
82 3300003781 Ga0055536_1004008 Ga0055536_10040086 207
83 3300003781 Ga0055536_1004837 Ga0055536_10048376 207
84 3300003791 Ga0055530_10001241 Ga0055530_1000124112 207
85 3300003794 Ga0055531_10004486 Ga0055531_100044866 207
86 3300025291 Ga0209675_1000555 Ga0209675_100055523 207
87 3300025292 Ga0209676_1000421 Ga0209676_10004212 207
88 3300025292 Ga0209676_1001076 Ga0209676_100107617 207
89 3300025294 Ga0209025_1009760 Ga0209025_10097605 207
90 3300025298 Ga0209050_1000112 Ga0209050_10001122 207
91 3300025304 Ga0209257_1003857 Ga0209257_10038572 207
92 3300026075 Ga0207708_10729535 Ga0207708_107295351 207
93 3300031911 Ga0307412_10047319 Ga0307412_100473192 207
94 3300032004 Ga0307414_11046450 Ga0307414_110464501 207
95 3300032005 Ga0307411_10178456 Ga0307411_101784562 207
96 3300049568 Ga0501031_0263645 Ga0501031_0263645_164_787 207
97 3300049569 Ga0501032_0017562 Ga0501032_0017562_2633_3256 207
98 3300049570 Ga0501033_0099787 Ga0501033_0099787_132_755 207
99 3300049572 Ga0501036_0010833 Ga0501036_0010833_2939_3562 207
100 3300049573 Ga0501037_0056870 Ga0501037_0056870_1664_2287 207
101 3300049574 Ga0501038_0009132 Ga0501038_0009132_7249_7872 207
102 3300049579 Ga0501043_0053494 Ga0501043_0053494_1625_2248 207
103 3300049581 Ga0501047_0038514 Ga0501047_0038514_2752_3375 207
104 3300049582 Ga0501048_0332656 Ga0501048_0332656_194_817 207
105 3300049822 Ga0501035_0007205 Ga0501035_0007205_2407_3030 207
106 3300049823 Ga0501044_0112210 Ga0501044_0112210_718_1341 207
107 iso_pu_bacteria 2643221605 2644041024 207
108 3300005436 Ga0070713_100070612 Ga0070713_1000706123 208
109 3300005618 Ga0068864_100007326 Ga0068864_1000073266 208
110 3300005841 Ga0068863_100001618 Ga0068863_10000161810 208
111 3300009553 Ga0105249_11053412 Ga0105249_110534122 208
112 3300025292 Ga0209676_1005589 Ga0209676_10055894 208
113 3300025294 Ga0209025_1111270 Ga0209025_11112701 208
114 3300025298 Ga0209050_1006833 Ga0209050_10068332 208
115 3300025304 Ga0209257_1000877 Ga0209257_100087737 208
116 3300025304 Ga0209257_1008253 Ga0209257_10082535 208
117 3300026088 Ga0207641_10000268 Ga0207641_1000026819 208
118 3300026095 Ga0207676_10001681 Ga0207676_1000168111 208
119 3300032004 Ga0307414_10000223 Ga0307414_1000022310 208
120 3300032004 Ga0307414_10007568 Ga0307414_100075683 208
121 3300032004 Ga0307414_10092712 Ga0307414_100927122 208
122 3300045051 Ga0451576_0008284 Ga0451576_0008284_6633_7280 208
123 3300046460 Ga0495638_0000836 Ga0495638_0000836_23442_24089 208
124 3300046542 Ga0495597_0152489 Ga0495597_0152489_120_782 208
125 3300046660 Ga0495625_0000031 Ga0495625_0000031_219951_220613 208
126 3300046660 Ga0495625_0000526 Ga0495625_0000526_10270_10905 208
127 3300046660 Ga0495625_0422395 Ga0495625_0422395_179_814 208
128 3300048903 Ga0496100_0003322 Ga0496100_0003322_2814_3479 208
129 3300048904 Ga0496101_0002485 Ga0496101_0002485_4855_5520 208
130 3300048909 Ga0496106_0000047 Ga0496106_0000047_9889_10554 208
131 3300048910 Ga0496107_0000035 Ga0496107_0000035_38161_38826 208
132 3300048926 Ga0496123_0099869 Ga0496123_0099869_829_1470 208
133 3300048928 Ga0496125_0032927 Ga0496125_0032927_890_1552 208
134 3300053093 Ga0500651_0184918 Ga0500651_0184918_326_988 208
135 3300053134 Ga0500658_0000722 Ga0500658_0000722_961_1608 208
136 3300053138 Ga0500564_002317 Ga0500564_002317_5021_5683 208
137 3300053148 Ga0500590_000021 Ga0500590_000021_20957_21619 208
138 3300053158 Ga0500627_0000002 Ga0500627_0000002_61413_62042 208
139 3300005436 Ga0070713_100279666 Ga0070713_1002796663 209
140 3300005548 Ga0070665_100030306 Ga0070665_1000303063 209
141 3300005843 Ga0068860_100017887 Ga0068860_1000178876 209
142 3300006028 Ga0070717_10122752 Ga0070717_101227523 209
143 3300025304 Ga0209257_1019666 Ga0209257_10196664 209
144 3300025972 Ga0207668_10778051 Ga0207668_107780512 209
145 3300028379 Ga0268266_10288622 Ga0268266_102886222 209
146 3300028381 Ga0268264_10007525 Ga0268264_1000752510 209
147 3300033179 Ga0307507_10172992 Ga0307507_101729922 209
148 3300047472 Ga0495686_0000060 Ga0495686_0000060_7451_8110 209
149 3300048924 Ga0496121_0025741 Ga0496121_0025741_4430_5065 209
150 3300049586 Ga0501070_0152579 Ga0501070_0152579_867_1514 209
151 3300053178 Ga0500637_0004224 Ga0500637_0004224_905_1576 209
152 iso_pu_bacteria 2512564014 2512644769 209
153 3300005327 Ga0070658_10186601 Ga0070658_101866011 210
154 3300005844 Ga0068862_100035914 Ga0068862_1000359145 210
155 3300009092 Ga0105250_10000551 Ga0105250_1000055119 210
156 3300009177 Ga0105248_10308863 Ga0105248_103088633 210
157 3300025304 Ga0209257_1038677 Ga0209257_10386773 210
158 3300025711 Ga0207696_1010781 Ga0207696_10107814 210
159 3300048920 Ga0496117_0046062 Ga0496117_0046062_1388_2035 210
160 3300048927 Ga0496124_0045778 Ga0496124_0045778_1219_1866 210
161 iso_pu_bacteria 2935769743 2935771293 210
162 iso_pu_bacteria 2935785616 2935793448 210
163 iso_pu_bacteria 2935793552 2935801462 210
164 iso_pu_bacteria 8016522445 8016528464 210
165 iso_pu_bacteria 8016539877 8016546843 210
166 iso_pu_bacteria 8016548790 8016555274 210
167 iso_pu_bacteria 8016557553 8016563634 210
168 iso_pu_bacteria 8016575299 8016576159 210
169 iso_pu_bacteria 8016595262 8016601370 210
170 3300002070 JGI24750J21931_1011241 JGI24750J21931_10112411 211
171 3300002459 JGI24751J29686_10003625 JGI24751J29686_100036253 211
172 3300005331 Ga0070670_100001886 Ga0070670_10000188614 211
173 3300005335 Ga0070666_10000392 Ga0070666_1000039226 211
174 3300005347 Ga0070668_100012774 Ga0070668_1000127741 211
175 3300005353 Ga0070669_100000023 Ga0070669_100000023162 211
176 3300005367 Ga0070667_100002263 Ga0070667_10000226313 211
177 3300005440 Ga0070705_100359477 Ga0070705_1003594771 211
178 3300005445 Ga0070708_100063173 Ga0070708_1000631733 211
179 3300005548 Ga0070665_100118053 Ga0070665_1001180533 211
180 3300005615 Ga0070702_100162974 Ga0070702_1001629743 211
181 3300005617 Ga0068859_100000958 Ga0068859_10000095813 211
182 3300005719 Ga0068861_100020314 Ga0068861_1000203143 211
183 3300005842 Ga0068858_100008736 Ga0068858_10000873614 211
184 3300005843 Ga0068860_100591459 Ga0068860_1005914592 211
185 3300005844 Ga0068862_100000425 Ga0068862_10000042518 211
186 3300006177 Ga0075362_10238472 Ga0075362_102384722 211
187 3300006353 Ga0075370_10004385 Ga0075370_100043855 211
188 3300006931 Ga0097620_100000958 Ga0097620_10000095813 211
189 3300009101 Ga0105247_10007890 Ga0105247_100078908 211
190 3300009177 Ga0105248_10137571 Ga0105248_101375714 211
191 3300009553 Ga0105249_10006886 Ga0105249_100068862 211
192 3300013306 Ga0163162_11073775 Ga0163162_110737751 211
193 3300014968 Ga0157379_10095535 Ga0157379_100955352 211
194 3300025315 Ga0207697_10000005 Ga0207697_100000054 211
195 3300025900 Ga0207710_10003734 Ga0207710_100037347 211
196 3300025903 Ga0207680_10000062 Ga0207680_1000006236 211
197 3300025923 Ga0207681_10000004 Ga0207681_1000000417 211
198 3300025925 Ga0207650_10001277 Ga0207650_100012772 211
199 3300025941 Ga0207711_10114774 Ga0207711_101147744 211
200 3300025961 Ga0207712_10012624 Ga0207712_100126242 211
201 3300025972 Ga0207668_10000370 Ga0207668_1000037012 211
202 3300025986 Ga0207658_10001947 Ga0207658_1000194722 211
203 3300026035 Ga0207703_10016115 Ga0207703_100161157 211
204 3300026078 Ga0207702_10197059 Ga0207702_101970591 211
205 3300026118 Ga0207675_100024746 Ga0207675_1000247466 211
206 3300028379 Ga0268266_10269080 Ga0268266_102690802 211
207 3300028380 Ga0268265_10000046 Ga0268265_1000004617 211
208 3300028381 Ga0268264_10561010 Ga0268264_105610102 211
209 3300031730 Ga0307516_10515392 Ga0307516_105153922 211
210 3300050496 nmdc:mga07m45_1802_c1 nmdc:mga07m45_1802_c1_1367_2002 211
211 3300050496 nmdc:mga07m45_56788_c1 nmdc:mga07m45_56788_c1_196_831 211
212 iso_pu_bacteria 2851153111 2851157520 211
213 3300049570 Ga0501033_0505936 Ga0501033_0505936_24_683 212
214 3300049823 Ga0501044_0068122 Ga0501044_0068122_467_1123 212
215 3300005327 Ga0070658_10000081 Ga0070658_1000008137 213
216 3300005539 Ga0068853_100000140 Ga0068853_10000014016 213
217 3300005563 Ga0068855_100000313 Ga0068855_10000031333 213
218 3300005578 Ga0068854_100001416 Ga0068854_10000141612 213
219 3300005616 Ga0068852_100000112 Ga0068852_10000011250 213
220 3300009093 Ga0105240_10000156 Ga0105240_1000015653 213
221 3300009545 Ga0105237_10000325 Ga0105237_1000032548 213
222 3300010375 Ga0105239_10000118 Ga0105239_1000011873 213
223 3300025909 Ga0207705_10000193 Ga0207705_1000019320 213
224 3300025913 Ga0207695_10000250 Ga0207695_1000025051 213
225 3300025914 Ga0207671_10000100 Ga0207671_1000010074 213
226 3300025949 Ga0207667_10000006 Ga0207667_10000006370 213
227 3300025949 Ga0207667_10000091 Ga0207667_1000009164 213
228 3300025981 Ga0207640_10000160 Ga0207640_1000016011 213
229 3300026041 Ga0207639_10000038 Ga0207639_1000003890 213
230 3300026142 Ga0207698_10000081 Ga0207698_1000008117 213
231 3300031824 Ga0307413_10010049 Ga0307413_100100492 213
232 3300031852 Ga0307410_10029449 Ga0307410_100294497 213
233 3300031903 Ga0307407_10276381 Ga0307407_102763812 213
234 3300031911 Ga0307412_10201295 Ga0307412_102012952 213
235 3300032002 Ga0307416_100110446 Ga0307416_1001104462 213
236 3300032004 Ga0307414_10008349 Ga0307414_100083493 213
237 3300032005 Ga0307411_10000546 Ga0307411_1000054612 213
238 3300046522 Ga0495643_0002134 Ga0495643_0002134_13308_13964 213
239 3300046522 Ga0495643_0019509 Ga0495643_0019509_2226_2882 213
240 3300048090 Ga0495615_0000033 Ga0495615_0000033_42507_43169 213
241 3300048927 Ga0496124_0058391 Ga0496124_0058391_774_1442 213
242 3300048928 Ga0496125_0002524 Ga0496125_0002524_18223_18891 213
243 3300049572 Ga0501036_0552631 Ga0501036_0552631_26_667 213
244 3300049581 Ga0501047_0001707 Ga0501047_0001707_5492_6133 213
245 3300049822 Ga0501035_0297184 Ga0501035_0297184_624_1265 213
246 3300049823 Ga0501044_0044143 Ga0501044_0044143_1928_2569 213
247 3300053077 Ga0495601_0001128 Ga0495601_0001128_7119_7781 213
248 3300053078 Ga0495612_0010554 Ga0495612_0010554_2890_3552 213
249 3300053085 Ga0495619_0033200 Ga0495619_0033200_303_965 213
250 iso_pu_bacteria 2751185897 2753763147 213
251 iso_pu_bacteria 2808606401 2809064585 213
252 iso_pu_bacteria 2808606404 2809080504 213
253 iso_pu_bacteria 2808606405 2809084868 213
254 3300049571 Ga0501034_0283213 Ga0501034_0283213_24_680 214
255 3300050493 nmdc:mga0k408_7379_c1 nmdc:mga0k408_7379_c1_4518_5174 214
256 3300005543 Ga0070672_100173904 Ga0070672_1001739041 215
257 3300025940 Ga0207691_10503783 Ga0207691_105037831 215
258 3300046539 Ga0495621_0090028 Ga0495621_0090028_360_1022 216
259 3300049823 Ga0501044_0699376 Ga0501044_0699376_46_711 216
260 3300013102 Ga0157371_10015758 Ga0157371_100157584 217
261 3300031911 Ga0307412_10000159 Ga0307412_1000015943 217
262 3300046522 Ga0495643_0059525 Ga0495643_0059525_671_1333 217
263 3300053156 Ga0500622_0006837 Ga0500622_0006837_2066_2761 217
264 3300001989 JGI24739J22299_10002530 JGI24739J22299_100025302 218
265 3300005457 Ga0070662_100052313 Ga0070662_1000523132 218
266 3300005564 Ga0070664_100154970 Ga0070664_1001549702 218
267 3300013307 Ga0157372_10000722 Ga0157372_1000072234 218
268 3300025904 Ga0207647_10012703 Ga0207647_100127033 218
269 3300025933 Ga0207706_10020134 Ga0207706_100201343 218
270 3300025945 Ga0207679_10670661 Ga0207679_106706611 218
271 3300049779 Ga0501283_000570 Ga0501283_000570_1854_2543 218
272 3300053156 Ga0500622_0000188 Ga0500622_0000188_25913_26587 223
273 3300005353 Ga0070669_100000030 Ga0070669_10000003087 225
274 3300025923 Ga0207681_10000036 Ga0207681_1000003683 225
275 3300006051 Ga0075364_10002610 Ga0075364_100026104 226
276 3300006177 Ga0075362_10057120 Ga0075362_100571202 226
277 3300006186 Ga0075369_10073034 Ga0075369_100730343 226
278 3300050489 nmdc:mga03683_16551_c1 nmdc:mga03683_16551_c1_1850_2569 226
279 3300050491 nmdc:mga00v17_1563_c1 nmdc:mga00v17_1563_c1_4498_5217 226
280 3300050516 nmdc:mga0sz30_36256_c1 nmdc:mga0sz30_36256_c1_231_950 226
281 2162886006 SwRhRL3b_contig_3173165 SwRhRL3b_0446.00001170 228
282 3300005295 Ga0065707_10000679 Ga0065707_100006793 228
283 3300005331 Ga0070670_100000053 Ga0070670_10000005372 228
284 3300005618 Ga0068864_100000055 Ga0068864_10000005543 228
285 3300025924 Ga0207694_10022609 Ga0207694_100226095 228
286 3300025925 Ga0207650_10000075 Ga0207650_1000007574 228
287 3300026095 Ga0207676_10000041 Ga0207676_1000004145 228
288 3300053735 Ga0500596_001463 Ga0500596_001463_1847_2542 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01545

Cation_efflux

Cation efflux family

23

201

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f6h-assembly1.cif.gz_B cryo-em structure of a zinc-loaded asymmetrical tmd d70a mutant of the yiip-fab complex 0.8659 22 201
5vrf-assembly1.cif.gz_A cryoem structure of the zinc transporter yiip from helical crystals 0.852 21 199
8f6h-assembly1.cif.gz_A cryo-em structure of a zinc-loaded asymmetrical tmd d70a mutant of the yiip-fab complex 0.799 21 198
8j80-assembly1.cif.gz_B cryo-em structure of hznt7-fab complex in zinc state 1, determined in heterogeneous conformations- one subunit in an inward-facing zinc-bound and the other in an outward-facing zinc-unbound conformation 0.7774 16 201
8j7w-assembly1.cif.gz_B cryo-em structure of hznt7-fab complex in zinc state 2, determined in heterogeneous conformations- one subunit in an inward-facing zinc-bound and the other in an outward-facing zinc-bound conformation 0.7606 23 201
ID Description Score Start End Superfamily
af_P96876_30_219_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9007 22 198 1.20.1510.10
af_P75757_17_213_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.8964 22 203 1.20.1510.10
af_Q9M271_29_255_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.8937 23 201 1.20.1510.10
af_O35149_110_332_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.8692 23 200 1.20.1510.10
af_Q5A0W4_303_536_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.8403 23 200 1.20.1510.10
ID Description Score Start End GO Terms
AF-A0A849P7M8-F1-model_v4 Cation transporter 0.9909 20 205 GO:0005385
GO:0005886
AF-A0A7U8GRG4-F1-model_v4 Cation transporter 0.9894 20 208 GO:0005385
GO:0005886
AF-A0A1V4CIQ9-F1-model_v4 Cation transporter 0.989 17 204 GO:0005385
GO:0005886
AF-A0A6L6JIN2-F1-model_v4 Cation transporter 0.9835 20 196 GO:0005385
GO:0005886
GO:0046872
AF-A0A0A0BGM7-F1-model_v4 Cobalt-zinc-cadmium resistance protein CzcD 0.982 20 196 GO:0005385
GO:0005886
GO:0046872

Feature Viewer

pLDDT pTM Quality
81.18 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map