F388500
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 288 | 214 | 262 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300006051|Ga0075364_10002610|Ga0075364_100026104 |
| Length | 239 |
| Sequence | MACTSCSSARPAPNNNPGWRRALWIALIVNGAMFVAEMTAGVAGGSKALQADALDFLGDAANYAISLGVAGMVLAWRARAAILKGATLAILGLYVLAATIWTIWNGRVPEAEVMGIIGIVALLANAGVAIMLYRFRNGDANMRSVWICSRNDAIGNIAVVLAAAGVFGTGSAWPDLVVAAIMAALGLSGGVQIMIQARRELPGSRTPSLGARQRGPLAGARKEVMPIPHSRGALLQDDT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 4 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 5 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 6 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 7 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 8 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 9 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 10 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 11 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 12 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 13 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 14 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 15 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 16 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 17 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 18 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 19 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 20 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 21 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 22 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 23 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 26 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 122 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 123 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 124 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 125 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 126 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 129 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 130 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 131 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 133 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 134 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 135 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 136 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 163 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 164 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 165 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 166 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 167 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 168 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 169 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 182 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 183 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 185 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 186 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 189 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 190 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 191 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 192 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 193 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 194 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 196 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 200 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 201 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 202 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 203 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 204 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 205 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 206 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 207 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 208 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 209 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 210 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 211 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 212 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 213 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 214 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.62 |
| Metatranscriptomes | 0.35 |
| Isolates | 9.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.79 |
| Nodule | 3.12 |
| Rhizoplane | 1.39 |
| Rhizosphere | 68.4 |
| Stem | 0 |
| Stem Tuber | 0.35 |
| Unclassified | 6.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_3173165 | 2162886006 | Bacteria | 1564 |
| 2 | JGI24739J22299_10002530 | 3300001989 | Bacteria | 7044 |
| 3 | JGI24750J21931_1011241 | 3300002070 | Bacteria | 1175 |
| 4 | JGI24751J29686_10003625 | 3300002459 | Bacteria | 3111 |
| 5 | JGI25151J46595_10072523 | 3300003187 | Bacteria | 1035 |
| 6 | Ga0055536_1004008 | 3300003781 | Bacteria | 7695 |
| 7 | Ga0055536_1004837 | 3300003781 | Bacteria | 6732 |
| 8 | Ga0055530_10001241 | 3300003791 | Bacteria | 19468 |
| 9 | Ga0055531_10004486 | 3300003794 | Bacteria | 8482 |
| 10 | Ga0065707_10000679 | 3300005295 | Bacteria | 13733 |
| 11 | Ga0070658_10000081 | 3300005327 | Bacteria | 90275 |
| 12 | Ga0070658_10186601 | 3300005327 | Bacteria | 1747 |
| 13 | Ga0070670_100000053 | 3300005331 | Bacteria | 128475 |
| 14 | Ga0070670_100001886 | 3300005331 | Bacteria | 17123 |
| 15 | Ga0070666_10000392 | 3300005335 | Bacteria | 27574 |
| 16 | Ga0070668_100012774 | 3300005347 | Bacteria | 6251 |
| 17 | Ga0070669_100000023 | 3300005353 | Bacteria | 174496 |
| 18 | Ga0070669_100000030 | 3300005353 | Bacteria | 160753 |
| 19 | Ga0070667_100002263 | 3300005367 | Bacteria | 16955 |
| 20 | Ga0070713_100070612 | 3300005436 | Bacteria | 2949 |
| 21 | Ga0070713_100279666 | 3300005436 | Bacteria | 1531 |
| 22 | Ga0070711_100174348 | 3300005439 | Bacteria | 1642 |
| 23 | Ga0070705_100359477 | 3300005440 | Bacteria | 1064 |
| 24 | Ga0070708_100063173 | 3300005445 | Bacteria | 3314 |
| 25 | Ga0070662_100052313 | 3300005457 | Bacteria | 2951 |
| 26 | Ga0070679_100283078 | 3300005530 | Unclassified | 1610 |
| 27 | Ga0068853_100000140 | 3300005539 | Bacteria | 49375 |
| 28 | Ga0070672_100173904 | 3300005543 | Bacteria | 1792 |
| 29 | Ga0070665_100030306 | 3300005548 | Bacteria | 5444 |
| 30 | Ga0070665_100118053 | 3300005548 | Bacteria | 2655 |
| 31 | Ga0068855_100000313 | 3300005563 | Bacteria | 60285 |
| 32 | Ga0070664_100154970 | 3300005564 | Bacteria | 2024 |
| 33 | Ga0068854_100001416 | 3300005578 | Bacteria | 14489 |
| 34 | Ga0068856_100210631 | 3300005614 | Bacteria | 1959 |
| 35 | Ga0070702_100162974 | 3300005615 | Bacteria | 1443 |
| 36 | Ga0068852_100000112 | 3300005616 | Bacteria | 54817 |
| 37 | Ga0068859_100000958 | 3300005617 | Bacteria | 29557 |
| 38 | Ga0068864_100000055 | 3300005618 | Bacteria | 128475 |
| 39 | Ga0068864_100007326 | 3300005618 | Bacteria | 9079 |
| 40 | Ga0068861_100020314 | 3300005719 | Bacteria | 4755 |
| 41 | Ga0068863_100001618 | 3300005841 | Bacteria | 22236 |
| 42 | Ga0068858_100008736 | 3300005842 | Bacteria | 9726 |
| 43 | Ga0068860_100017887 | 3300005843 | Bacteria | 6903 |
| 44 | Ga0068860_100591459 | 3300005843 | Bacteria | 1114 |
| 45 | Ga0068862_100000425 | 3300005844 | Bacteria | 45885 |
| 46 | Ga0068862_100035914 | 3300005844 | Bacteria | 4199 |
| 47 | Ga0070717_10122752 | 3300006028 | Bacteria | 2227 |
| 48 | Ga0075365_10002035 | 3300006038 | Bacteria | 9614 |
| 49 | Ga0075365_10168947 | 3300006038 | Bacteria | 1526 |
| 50 | Ga0075364_10000022 | 3300006051 | Bacteria | 53466 |
| 51 | Ga0075364_10002610 | 3300006051 | Bacteria | 10114 |
| 52 | Ga0075362_10057120 | 3300006177 | Bacteria | 1758 |
| 53 | Ga0075362_10238472 | 3300006177 | Bacteria | 892 |
| 54 | Ga0075367_10008181 | 3300006178 | Bacteria | 5404 |
| 55 | Ga0075369_10000796 | 3300006186 | Bacteria | 10326 |
| 56 | Ga0075369_10073034 | 3300006186 | Bacteria | 1512 |
| 57 | Ga0075366_10002037 | 3300006195 | Bacteria | 10254 |
| 58 | Ga0075370_10004385 | 3300006353 | Bacteria | 6843 |
| 59 | Ga0075370_10055041 | 3300006353 | Bacteria | 2260 |
| 60 | Ga0075430_100168351 | 3300006846 | Bacteria | 1823 |
| 61 | Ga0097620_100000958 | 3300006931 | Bacteria | 29557 |
| 62 | Ga0105250_10000551 | 3300009092 | Bacteria | 25565 |
| 63 | Ga0105240_10000156 | 3300009093 | Bacteria | 139950 |
| 64 | Ga0105245_11389626 | 3300009098 | Bacteria | 752 |
| 65 | Ga0105247_10007890 | 3300009101 | Bacteria | 6510 |
| 66 | Ga0105248_10137571 | 3300009177 | Bacteria | 2755 |
| 67 | Ga0105248_10308863 | 3300009177 | Bacteria | 1781 |
| 68 | Ga0105237_10000325 | 3300009545 | Bacteria | 67280 |
| 69 | Ga0105249_10006886 | 3300009553 | Bacteria | 9908 |
| 70 | Ga0105249_11053412 | 3300009553 | Bacteria | 883 |
| 71 | Ga0105239_10000118 | 3300010375 | Bacteria | 112168 |
| 72 | Ga0105239_11379736 | 3300010375 | Bacteria | 813 |
| 73 | Ga0157371_10015758 | 3300013102 | Bacteria | 5658 |
| 74 | Ga0163162_11073775 | 3300013306 | Bacteria | 912 |
| 75 | Ga0157372_10000722 | 3300013307 | Bacteria | 36035 |
| 76 | Ga0157379_10095535 | 3300014968 | Bacteria | 2667 |
| 77 | Ga0157379_10691777 | 3300014968 | Bacteria | 957 |
| 78 | Ga0224712_10139000 | 3300022467 | Bacteria | 1067 |
| 79 | Ga0209677_101589 | 3300025253 | Bacteria | 9606 |
| 80 | Ga0209675_1000555 | 3300025291 | Bacteria | 27086 |
| 81 | Ga0209676_1000421 | 3300025292 | Bacteria | 74706 |
| 82 | Ga0209676_1001076 | 3300025292 | Bacteria | 30900 |
| 83 | Ga0209676_1005589 | 3300025292 | Bacteria | 6497 |
| 84 | Ga0209025_1009760 | 3300025294 | Bacteria | 6627 |
| 85 | Ga0209025_1111270 | 3300025294 | Bacteria | 841 |
| 86 | Ga0209050_1000112 | 3300025298 | Bacteria | 210320 |
| 87 | Ga0209050_1006833 | 3300025298 | Bacteria | 6632 |
| 88 | Ga0209257_1000877 | 3300025304 | Bacteria | 42562 |
| 89 | Ga0209257_1003857 | 3300025304 | Bacteria | 12255 |
| 90 | Ga0209257_1008253 | 3300025304 | Bacteria | 5989 |
| 91 | Ga0209257_1019666 | 3300025304 | Bacteria | 2531 |
| 92 | Ga0209257_1038677 | 3300025304 | Bacteria | 1443 |
| 93 | Ga0207697_10000005 | 3300025315 | Bacteria | 85907 |
| 94 | Ga0207696_1010781 | 3300025711 | Bacteria | 3332 |
| 95 | Ga0207710_10003734 | 3300025900 | Bacteria | 6740 |
| 96 | Ga0207680_10000062 | 3300025903 | Bacteria | 48850 |
| 97 | Ga0207647_10012703 | 3300025904 | Bacteria | 5852 |
| 98 | Ga0207705_10000193 | 3300025909 | Bacteria | 61961 |
| 99 | Ga0207695_10000250 | 3300025913 | Bacteria | 139984 |
| 100 | Ga0207671_10000100 | 3300025914 | Bacteria | 131821 |
| 101 | Ga0207663_10157516 | 3300025916 | Bacteria | 1599 |
| 102 | Ga0207652_10046746 | 3300025921 | Bacteria | 3695 |
| 103 | Ga0207681_10000004 | 3300025923 | Bacteria | 559005 |
| 104 | Ga0207681_10000036 | 3300025923 | Bacteria | 161782 |
| 105 | Ga0207694_10022609 | 3300025924 | Bacteria | 4771 |
| 106 | Ga0207650_10000075 | 3300025925 | Bacteria | 134026 |
| 107 | Ga0207650_10001277 | 3300025925 | Bacteria | 18255 |
| 108 | Ga0207706_10020134 | 3300025933 | Bacteria | 5995 |
| 109 | Ga0207691_10503783 | 3300025940 | Bacteria | 1028 |
| 110 | Ga0207711_10114774 | 3300025941 | Bacteria | 2399 |
| 111 | Ga0207679_10670661 | 3300025945 | Bacteria | 939 |
| 112 | Ga0207667_10000006 | 3300025949 | Bacteria | 679876 |
| 113 | Ga0207667_10000091 | 3300025949 | Bacteria | 148651 |
| 114 | Ga0207712_10012624 | 3300025961 | Bacteria | 5398 |
| 115 | Ga0207668_10000370 | 3300025972 | Bacteria | 28629 |
| 116 | Ga0207668_10006943 | 3300025972 | Bacteria | 6718 |
| 117 | Ga0207668_10778051 | 3300025972 | Bacteria | 846 |
| 118 | Ga0207640_10000160 | 3300025981 | Bacteria | 48881 |
| 119 | Ga0207658_10001947 | 3300025986 | Bacteria | 15422 |
| 120 | Ga0207703_10016115 | 3300026035 | Bacteria | 5827 |
| 121 | Ga0207639_10000038 | 3300026041 | Bacteria | 145316 |
| 122 | Ga0207708_10729535 | 3300026075 | Bacteria | 849 |
| 123 | Ga0207702_10197059 | 3300026078 | Bacteria | 1865 |
| 124 | Ga0207641_10000268 | 3300026088 | Bacteria | 66121 |
| 125 | Ga0207676_10000041 | 3300026095 | Bacteria | 166172 |
| 126 | Ga0207676_10001681 | 3300026095 | Bacteria | 16316 |
| 127 | Ga0207675_100024746 | 3300026118 | Bacteria | 5584 |
| 128 | Ga0207698_10000081 | 3300026142 | Bacteria | 63461 |
| 129 | Ga0209974_10007474 | 3300027876 | Bacteria | 3765 |
| 130 | Ga0209974_10212017 | 3300027876 | Bacteria | 718 |
| 131 | Ga0268266_10269080 | 3300028379 | Bacteria | 1581 |
| 132 | Ga0268266_10288622 | 3300028379 | Bacteria | 1527 |
| 133 | Ga0268265_10000046 | 3300028380 | Bacteria | 179361 |
| 134 | Ga0268264_10007525 | 3300028381 | Bacteria | 9086 |
| 135 | Ga0268264_10561010 | 3300028381 | Bacteria | 1121 |
| 136 | Ga0307408_100005173 | 3300031548 | Bacteria | 8752 |
| 137 | Ga0307516_10515392 | 3300031730 | Bacteria | 850 |
| 138 | Ga0307413_10010049 | 3300031824 | Bacteria | 4564 |
| 139 | Ga0307410_10029449 | 3300031852 | Plasmid | 3496 |
| 140 | Ga0307407_10276381 | 3300031903 | Unclassified | 1161 |
| 141 | Ga0307412_10000159 | 3300031911 | Bacteria | 47835 |
| 142 | Ga0307412_10003989 | 3300031911 | Bacteria | 8228 |
| 143 | Ga0307412_10047319 | 3300031911 | Bacteria | 2825 |
| 144 | Ga0307412_10201295 | 3300031911 | Unclassified | 1512 |
| 145 | Ga0307416_100110446 | 3300032002 | Bacteria | 2421 |
| 146 | Ga0307414_10000223 | 3300032004 | Bacteria | 37440 |
| 147 | Ga0307414_10007568 | 3300032004 | Bacteria | 6107 |
| 148 | Ga0307414_10008349 | 3300032004 | Bacteria | 5865 |
| 149 | Ga0307414_10092712 | 3300032004 | Bacteria | 2249 |
| 150 | Ga0307414_10449205 | 3300032004 | Bacteria | 1130 |
| 151 | Ga0307414_11046450 | 3300032004 | Bacteria | 752 |
| 152 | Ga0307411_10000546 | 3300032005 | Bacteria | 13328 |
| 153 | Ga0307411_10178456 | 3300032005 | Bacteria | 1609 |
| 154 | Ga0307507_10172992 | 3300033179 | Bacteria | 1564 |
| 155 | Ga0373935_0443276 | 3300035692 | Bacteria | 937 |
| 156 | Ga0237819_03065 | 3300038705 | Bacteria | 3085 |
| 157 | Ga0237816_00251 | 3300039145 | Bacteria | 4480 |
| 158 | Ga0451577_0606152 | 3300042876 | Bacteria | 994 |
| 159 | Ga0451576_0008284 | 3300045051 | Bacteria | 12220 |
| 160 | Ga0495627_007004 | 3300046453 | Bacteria | 4373 |
| 161 | Ga0495638_0000836 | 3300046460 | Bacteria | 32322 |
| 162 | Ga0495650_0012905 | 3300046471 | Bacteria | 4460 |
| 163 | Ga0495605_0000103 | 3300046474 | Bacteria | 105879 |
| 164 | Ga0495584_0038638 | 3300046491 | Bacteria | 2412 |
| 165 | Ga0495596_0029054 | 3300046500 | Bacteria | 2218 |
| 166 | Ga0495583_0086016 | 3300046506 | Bacteria | 1360 |
| 167 | Ga0495610_0000090 | 3300046512 | Bacteria | 106145 |
| 168 | Ga0495616_0200972 | 3300046513 | Bacteria | 876 |
| 169 | Ga0495632_0000096 | 3300046519 | Bacteria | 89284 |
| 170 | Ga0495637_0001690 | 3300046520 | Bacteria | 12740 |
| 171 | Ga0495643_0001606 | 3300046522 | Bacteria | 20005 |
| 172 | Ga0495643_0002134 | 3300046522 | Bacteria | 16303 |
| 173 | Ga0495643_0019509 | 3300046522 | Bacteria | 3921 |
| 174 | Ga0495643_0059525 | 3300046522 | Bacteria | 2030 |
| 175 | Ga0495663_0000016 | 3300046525 | Bacteria | 142125 |
| 176 | Ga0495654_0001066 | 3300046530 | Bacteria | 20022 |
| 177 | Ga0495621_0090028 | 3300046539 | Bacteria | 1155 |
| 178 | Ga0495597_0152489 | 3300046542 | Bacteria | 947 |
| 179 | Ga0495633_0001331 | 3300046558 | Bacteria | 19380 |
| 180 | Ga0495668_0001409 | 3300046616 | Bacteria | 23419 |
| 181 | Ga0495625_0000031 | 3300046660 | Bacteria | 238193 |
| 182 | Ga0495625_0000526 | 3300046660 | Bacteria | 56429 |
| 183 | Ga0495625_0325184 | 3300046660 | Bacteria | 978 |
| 184 | Ga0495625_0422395 | 3300046660 | Bacteria | 829 |
| 185 | Ga0495671_0000974 | 3300046692 | Bacteria | 20005 |
| 186 | Ga0495683_0210117 | 3300047323 | Bacteria | 873 |
| 187 | Ga0495681_0015171 | 3300047470 | Bacteria | 4370 |
| 188 | Ga0495681_0031945 | 3300047470 | Bacteria | 2655 |
| 189 | Ga0495686_0000060 | 3300047472 | Bacteria | 237402 |
| 190 | Ga0495686_0123110 | 3300047472 | Bacteria | 1543 |
| 191 | Ga0495615_0000007 | 3300048090 | Bacteria | 90892 |
| 192 | Ga0495615_0000033 | 3300048090 | Bacteria | 45796 |
| 193 | Ga0496100_0003322 | 3300048903 | Bacteria | 8373 |
| 194 | Ga0496101_0002485 | 3300048904 | Bacteria | 11324 |
| 195 | Ga0496106_0000047 | 3300048909 | Bacteria | 100449 |
| 196 | Ga0496107_0000035 | 3300048910 | Bacteria | 86628 |
| 197 | Ga0496117_0046062 | 3300048920 | Bacteria | 3141 |
| 198 | Ga0496121_0025741 | 3300048924 | Bacteria | 5570 |
| 199 | Ga0496123_0099869 | 3300048926 | Bacteria | 1693 |
| 200 | Ga0496124_0045778 | 3300048927 | Bacteria | 3750 |
| 201 | Ga0496124_0058391 | 3300048927 | Bacteria | 3245 |
| 202 | Ga0496125_0002524 | 3300048928 | Bacteria | 23632 |
| 203 | Ga0496125_0032927 | 3300048928 | Bacteria | 4596 |
| 204 | Ga0501031_0263645 | 3300049568 | Bacteria | 1119 |
| 205 | Ga0501032_0017562 | 3300049569 | Bacteria | 5021 |
| 206 | Ga0501033_0099787 | 3300049570 | Bacteria | 2119 |
| 207 | Ga0501033_0505936 | 3300049570 | Bacteria | 835 |
| 208 | Ga0501034_0283213 | 3300049571 | Bacteria | 1597 |
| 209 | Ga0501036_0010833 | 3300049572 | Bacteria | 7532 |
| 210 | Ga0501036_0552631 | 3300049572 | Bacteria | 957 |
| 211 | Ga0501037_0056870 | 3300049573 | Bacteria | 2856 |
| 212 | Ga0501038_0009132 | 3300049574 | Bacteria | 9095 |
| 213 | Ga0501038_0024791 | 3300049574 | Bacteria | 5347 |
| 214 | Ga0501043_0053494 | 3300049579 | Bacteria | 3170 |
| 215 | Ga0501043_0364618 | 3300049579 | Bacteria | 1096 |
| 216 | Ga0501047_0001707 | 3300049581 | Bacteria | 21355 |
| 217 | Ga0501047_0038514 | 3300049581 | Bacteria | 4625 |
| 218 | Ga0501048_0332656 | 3300049582 | Bacteria | 1082 |
| 219 | Ga0501070_0152579 | 3300049586 | Bacteria | 1906 |
| 220 | Ga0501073_0010038 | 3300049589 | Bacteria | 6961 |
| 221 | Ga0501235_000335 | 3300049669 | Bacteria | 8962 |
| 222 | Ga0501225_0002378 | 3300049705 | Bacteria | 5806 |
| 223 | Ga0501080_0003602 | 3300049742 | Bacteria | 13638 |
| 224 | Ga0501281_00014 | 3300049777 | Bacteria | 23792 |
| 225 | Ga0501283_000570 | 3300049779 | Bacteria | 4829 |
| 226 | Ga0501035_0007205 | 3300049822 | Bacteria | 10408 |
| 227 | Ga0501035_0267033 | 3300049822 | Bacteria | 1449 |
| 228 | Ga0501035_0297184 | 3300049822 | Bacteria | 1361 |
| 229 | Ga0501044_0044143 | 3300049823 | Bacteria | 4629 |
| 230 | Ga0501044_0068122 | 3300049823 | Bacteria | 3626 |
| 231 | Ga0501044_0112210 | 3300049823 | Bacteria | 2733 |
| 232 | Ga0501044_0699376 | 3300049823 | Bacteria | 899 |
| 233 | nmdc:mga03683_16551_c1 | 3300050489 | Bacteria | 2772 |
| 234 | nmdc:mga00v17_1563_c1 | 3300050491 | Bacteria | 11955 |
| 235 | nmdc:mga00v17_91_c1 | 3300050491 | Bacteria | 53223 |
| 236 | nmdc:mga0yw44_47892_c1 | 3300050492 | Bacteria | 2575 |
| 237 | nmdc:mga0yw44_621_c1 | 3300050492 | Bacteria | 12855 |
| 238 | nmdc:mga0k408_3834_c1 | 3300050493 | Bacteria | 7969 |
| 239 | nmdc:mga0k408_7379_c1 | 3300050493 | Bacteria | 5869 |
| 240 | nmdc:mga06z11_34382_c1 | 3300050494 | Bacteria | 2488 |
| 241 | nmdc:mga07m45_1802_c1 | 3300050496 | Bacteria | 9869 |
| 242 | nmdc:mga07m45_4418_c1 | 3300050496 | Bacteria | 5524 |
| 243 | nmdc:mga07m45_56788_c1 | 3300050496 | Bacteria | 2213 |
| 244 | nmdc:mga0qj67_245330_c1 | 3300050509 | Bacteria | 1453 |
| 245 | nmdc:mga0sz30_34_c1 | 3300050516 | Bacteria | 53573 |
| 246 | nmdc:mga0sz30_36256_c1 | 3300050516 | Bacteria | 1512 |
| 247 | Ga0495601_0001128 | 3300053077 | Bacteria | 14641 |
| 248 | Ga0495612_0010554 | 3300053078 | Bacteria | 3734 |
| 249 | Ga0495619_0033200 | 3300053085 | Bacteria | 3351 |
| 250 | Ga0500651_0184918 | 3300053093 | Bacteria | 1236 |
| 251 | Ga0500658_0000722 | 3300053134 | Bacteria | 13655 |
| 252 | Ga0500559_0008001 | 3300053136 | Bacteria | 4656 |
| 253 | Ga0500564_002317 | 3300053138 | Bacteria | 7004 |
| 254 | Ga0500590_000021 | 3300053148 | Bacteria | 42640 |
| 255 | Ga0500590_100633 | 3300053148 | Bacteria | 1388 |
| 256 | Ga0500604_0008547 | 3300053151 | Bacteria | 2719 |
| 257 | Ga0500622_0000188 | 3300053156 | Bacteria | 65148 |
| 258 | Ga0500622_0006837 | 3300053156 | Bacteria | 6557 |
| 259 | Ga0500627_0000002 | 3300053158 | Bacteria | 235747 |
| 260 | Ga0500627_0000202 | 3300053158 | Bacteria | 17284 |
| 261 | Ga0500637_0004224 | 3300053178 | Bacteria | 6780 |
| 262 | Ga0500596_001463 | 3300053735 | Bacteria | 4784 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006038 | Ga0075365_10168947 | Ga0075365_101689472 | 179 |
| 2 | 3300050492 | nmdc:mga0yw44_47892_c1 | nmdc:mga0yw44_47892_c1_1519_2208 | 179 |
| 3 | 3300053136 | Ga0500559_0008001 | Ga0500559_0008001_2109_2765 | 179 |
| 4 | 3300025253 | Ga0209677_101589 | Ga0209677_1015893 | 187 |
| 5 | 3300046530 | Ga0495654_0001066 | Ga0495654_0001066_7139_7738 | 188 |
| 6 | 3300046616 | Ga0495668_0001409 | Ga0495668_0001409_12758_13357 | 188 |
| 7 | 3300049822 | Ga0501035_0267033 | Ga0501035_0267033_743_1342 | 188 |
| 8 | 3300053158 | Ga0500627_0000202 | Ga0500627_0000202_8868_9467 | 188 |
| 9 | iso_pu_bacteria | 2885427238 | 2885427389 | 190 |
| 10 | 3300031911 | Ga0307412_10003989 | Ga0307412_100039894 | 191 |
| 11 | 3300042876 | Ga0451577_0606152 | Ga0451577_0606152_283_951 | 193 |
| 12 | 3300006353 | Ga0075370_10055041 | Ga0075370_100550414 | 194 |
| 13 | 3300009098 | Ga0105245_11389626 | Ga0105245_113896261 | 194 |
| 14 | 3300050496 | nmdc:mga07m45_4418_c1 | nmdc:mga07m45_4418_c1_660_1310 | 194 |
| 15 | 3300038705 | Ga0237819_03065 | Ga0237819_03065_1001_1645 | 195 |
| 16 | 3300039145 | Ga0237816_00251 | Ga0237816_00251_1148_1792 | 195 |
| 17 | 3300025972 | Ga0207668_10006943 | Ga0207668_100069438 | 196 |
| 18 | 3300046519 | Ga0495632_0000096 | Ga0495632_0000096_17760_18422 | 196 |
| 19 | 3300046525 | Ga0495663_0000016 | Ga0495663_0000016_29689_30351 | 196 |
| 20 | 3300046558 | Ga0495633_0001331 | Ga0495633_0001331_3124_3786 | 196 |
| 21 | 3300046660 | Ga0495625_0325184 | Ga0495625_0325184_64_726 | 196 |
| 22 | 3300047472 | Ga0495686_0123110 | Ga0495686_0123110_618_1280 | 196 |
| 23 | 3300006195 | Ga0075366_10002037 | Ga0075366_100020375 | 197 |
| 24 | 3300035692 | Ga0373935_0443276 | Ga0373935_0443276_45_692 | 197 |
| 25 | 3300050493 | nmdc:mga0k408_3834_c1 | nmdc:mga0k408_3834_c1_5346_6032 | 197 |
| 26 | 3300031548 | Ga0307408_100005173 | Ga0307408_1000051733 | 198 |
| 27 | 3300046453 | Ga0495627_007004 | Ga0495627_007004_426_1079 | 199 |
| 28 | 3300046471 | Ga0495650_0012905 | Ga0495650_0012905_3346_3999 | 199 |
| 29 | 3300046500 | Ga0495596_0029054 | Ga0495596_0029054_1137_1790 | 199 |
| 30 | 3300046506 | Ga0495583_0086016 | Ga0495583_0086016_402_1055 | 199 |
| 31 | 3300046512 | Ga0495610_0000090 | Ga0495610_0000090_104367_105020 | 199 |
| 32 | 3300046513 | Ga0495616_0200972 | Ga0495616_0200972_97_750 | 199 |
| 33 | 3300047323 | Ga0495683_0210117 | Ga0495683_0210117_45_698 | 199 |
| 34 | 3300047470 | Ga0495681_0015171 | Ga0495681_0015171_472_1125 | 199 |
| 35 | 3300048090 | Ga0495615_0000007 | Ga0495615_0000007_7934_8587 | 199 |
| 36 | 3300005439 | Ga0070711_100174348 | Ga0070711_1001743483 | 200 |
| 37 | 3300025916 | Ga0207663_10157516 | Ga0207663_101575163 | 200 |
| 38 | 3300049574 | Ga0501038_0024791 | Ga0501038_0024791_3847_4500 | 200 |
| 39 | 3300049589 | Ga0501073_0010038 | Ga0501073_0010038_2389_3042 | 200 |
| 40 | 3300049742 | Ga0501080_0003602 | Ga0501080_0003602_11266_11919 | 200 |
| 41 | 3300005614 | Ga0068856_100210631 | Ga0068856_1002106312 | 201 |
| 42 | 3300022467 | Ga0224712_10139000 | Ga0224712_101390002 | 201 |
| 43 | 3300006846 | Ga0075430_100168351 | Ga0075430_1001683512 | 202 |
| 44 | 3300049579 | Ga0501043_0364618 | Ga0501043_0364618_357_1019 | 202 |
| 45 | 3300050509 | nmdc:mga0qj67_245330_c1 | nmdc:mga0qj67_245330_c1_612_1253 | 202 |
| 46 | iso_pu_bacteria | 2852653556 | 2852657093 | 202 |
| 47 | iso_pu_bacteria | 2896253425 | 2896253992 | 202 |
| 48 | 3300005530 | Ga0070679_100283078 | Ga0070679_1002830783 | 203 |
| 49 | 3300025921 | Ga0207652_10046746 | Ga0207652_100467463 | 203 |
| 50 | 3300053148 | Ga0500590_100633 | Ga0500590_100633_637_1299 | 203 |
| 51 | 3300053151 | Ga0500604_0008547 | Ga0500604_0008547_1891_2523 | 203 |
| 52 | iso_pu_bacteria | 2643221563 | 2643832750 | 203 |
| 53 | iso_pu_bacteria | 2643221608 | 2644053455 | 203 |
| 54 | iso_pu_bacteria | 2852680915 | 2852683765 | 203 |
| 55 | iso_pu_bacteria | 2928968154 | 2928969806 | 203 |
| 56 | 3300046491 | Ga0495584_0038638 | Ga0495584_0038638_518_1180 | 204 |
| 57 | 3300046520 | Ga0495637_0001690 | Ga0495637_0001690_4157_4819 | 204 |
| 58 | 3300046522 | Ga0495643_0001606 | Ga0495643_0001606_4435_5097 | 204 |
| 59 | 3300046692 | Ga0495671_0000974 | Ga0495671_0000974_14909_15571 | 204 |
| 60 | 3300047470 | Ga0495681_0031945 | Ga0495681_0031945_437_1099 | 204 |
| 61 | iso_pu_bacteria | 2643221560 | 2643821475 | 204 |
| 62 | iso_pu_bacteria | 2739367664 | 2739652463 | 204 |
| 63 | iso_pu_bacteria | 2739367865 | 2740030936 | 204 |
| 64 | 3300010375 | Ga0105239_11379736 | Ga0105239_113797361 | 205 |
| 65 | 3300014968 | Ga0157379_10691777 | Ga0157379_106917771 | 205 |
| 66 | 3300027876 | Ga0209974_10007474 | Ga0209974_100074743 | 205 |
| 67 | 3300049669 | Ga0501235_000335 | Ga0501235_000335_691_1347 | 205 |
| 68 | 3300049705 | Ga0501225_0002378 | Ga0501225_0002378_252_908 | 205 |
| 69 | 3300049777 | Ga0501281_00014 | Ga0501281_00014_16834_17490 | 205 |
| 70 | 3300006038 | Ga0075365_10002035 | Ga0075365_100020355 | 206 |
| 71 | 3300006051 | Ga0075364_10000022 | Ga0075364_1000002220 | 206 |
| 72 | 3300006178 | Ga0075367_10008181 | Ga0075367_100081814 | 206 |
| 73 | 3300006186 | Ga0075369_10000796 | Ga0075369_100007963 | 206 |
| 74 | 3300027876 | Ga0209974_10212017 | Ga0209974_102120171 | 206 |
| 75 | 3300032004 | Ga0307414_10449205 | Ga0307414_104492052 | 206 |
| 76 | 3300046474 | Ga0495605_0000103 | Ga0495605_0000103_68754_69374 | 206 |
| 77 | 3300050491 | nmdc:mga00v17_91_c1 | nmdc:mga00v17_91_c1_32638_33321 | 206 |
| 78 | 3300050492 | nmdc:mga0yw44_621_c1 | nmdc:mga0yw44_621_c1_5992_6675 | 206 |
| 79 | 3300050494 | nmdc:mga06z11_34382_c1 | nmdc:mga06z11_34382_c1_1283_1903 | 206 |
| 80 | 3300050516 | nmdc:mga0sz30_34_c1 | nmdc:mga0sz30_34_c1_43744_44427 | 206 |
| 81 | 3300003187 | JGI25151J46595_10072523 | JGI25151J46595_100725232 | 207 |
| 82 | 3300003781 | Ga0055536_1004008 | Ga0055536_10040086 | 207 |
| 83 | 3300003781 | Ga0055536_1004837 | Ga0055536_10048376 | 207 |
| 84 | 3300003791 | Ga0055530_10001241 | Ga0055530_1000124112 | 207 |
| 85 | 3300003794 | Ga0055531_10004486 | Ga0055531_100044866 | 207 |
| 86 | 3300025291 | Ga0209675_1000555 | Ga0209675_100055523 | 207 |
| 87 | 3300025292 | Ga0209676_1000421 | Ga0209676_10004212 | 207 |
| 88 | 3300025292 | Ga0209676_1001076 | Ga0209676_100107617 | 207 |
| 89 | 3300025294 | Ga0209025_1009760 | Ga0209025_10097605 | 207 |
| 90 | 3300025298 | Ga0209050_1000112 | Ga0209050_10001122 | 207 |
| 91 | 3300025304 | Ga0209257_1003857 | Ga0209257_10038572 | 207 |
| 92 | 3300026075 | Ga0207708_10729535 | Ga0207708_107295351 | 207 |
| 93 | 3300031911 | Ga0307412_10047319 | Ga0307412_100473192 | 207 |
| 94 | 3300032004 | Ga0307414_11046450 | Ga0307414_110464501 | 207 |
| 95 | 3300032005 | Ga0307411_10178456 | Ga0307411_101784562 | 207 |
| 96 | 3300049568 | Ga0501031_0263645 | Ga0501031_0263645_164_787 | 207 |
| 97 | 3300049569 | Ga0501032_0017562 | Ga0501032_0017562_2633_3256 | 207 |
| 98 | 3300049570 | Ga0501033_0099787 | Ga0501033_0099787_132_755 | 207 |
| 99 | 3300049572 | Ga0501036_0010833 | Ga0501036_0010833_2939_3562 | 207 |
| 100 | 3300049573 | Ga0501037_0056870 | Ga0501037_0056870_1664_2287 | 207 |
| 101 | 3300049574 | Ga0501038_0009132 | Ga0501038_0009132_7249_7872 | 207 |
| 102 | 3300049579 | Ga0501043_0053494 | Ga0501043_0053494_1625_2248 | 207 |
| 103 | 3300049581 | Ga0501047_0038514 | Ga0501047_0038514_2752_3375 | 207 |
| 104 | 3300049582 | Ga0501048_0332656 | Ga0501048_0332656_194_817 | 207 |
| 105 | 3300049822 | Ga0501035_0007205 | Ga0501035_0007205_2407_3030 | 207 |
| 106 | 3300049823 | Ga0501044_0112210 | Ga0501044_0112210_718_1341 | 207 |
| 107 | iso_pu_bacteria | 2643221605 | 2644041024 | 207 |
| 108 | 3300005436 | Ga0070713_100070612 | Ga0070713_1000706123 | 208 |
| 109 | 3300005618 | Ga0068864_100007326 | Ga0068864_1000073266 | 208 |
| 110 | 3300005841 | Ga0068863_100001618 | Ga0068863_10000161810 | 208 |
| 111 | 3300009553 | Ga0105249_11053412 | Ga0105249_110534122 | 208 |
| 112 | 3300025292 | Ga0209676_1005589 | Ga0209676_10055894 | 208 |
| 113 | 3300025294 | Ga0209025_1111270 | Ga0209025_11112701 | 208 |
| 114 | 3300025298 | Ga0209050_1006833 | Ga0209050_10068332 | 208 |
| 115 | 3300025304 | Ga0209257_1000877 | Ga0209257_100087737 | 208 |
| 116 | 3300025304 | Ga0209257_1008253 | Ga0209257_10082535 | 208 |
| 117 | 3300026088 | Ga0207641_10000268 | Ga0207641_1000026819 | 208 |
| 118 | 3300026095 | Ga0207676_10001681 | Ga0207676_1000168111 | 208 |
| 119 | 3300032004 | Ga0307414_10000223 | Ga0307414_1000022310 | 208 |
| 120 | 3300032004 | Ga0307414_10007568 | Ga0307414_100075683 | 208 |
| 121 | 3300032004 | Ga0307414_10092712 | Ga0307414_100927122 | 208 |
| 122 | 3300045051 | Ga0451576_0008284 | Ga0451576_0008284_6633_7280 | 208 |
| 123 | 3300046460 | Ga0495638_0000836 | Ga0495638_0000836_23442_24089 | 208 |
| 124 | 3300046542 | Ga0495597_0152489 | Ga0495597_0152489_120_782 | 208 |
| 125 | 3300046660 | Ga0495625_0000031 | Ga0495625_0000031_219951_220613 | 208 |
| 126 | 3300046660 | Ga0495625_0000526 | Ga0495625_0000526_10270_10905 | 208 |
| 127 | 3300046660 | Ga0495625_0422395 | Ga0495625_0422395_179_814 | 208 |
| 128 | 3300048903 | Ga0496100_0003322 | Ga0496100_0003322_2814_3479 | 208 |
| 129 | 3300048904 | Ga0496101_0002485 | Ga0496101_0002485_4855_5520 | 208 |
| 130 | 3300048909 | Ga0496106_0000047 | Ga0496106_0000047_9889_10554 | 208 |
| 131 | 3300048910 | Ga0496107_0000035 | Ga0496107_0000035_38161_38826 | 208 |
| 132 | 3300048926 | Ga0496123_0099869 | Ga0496123_0099869_829_1470 | 208 |
| 133 | 3300048928 | Ga0496125_0032927 | Ga0496125_0032927_890_1552 | 208 |
| 134 | 3300053093 | Ga0500651_0184918 | Ga0500651_0184918_326_988 | 208 |
| 135 | 3300053134 | Ga0500658_0000722 | Ga0500658_0000722_961_1608 | 208 |
| 136 | 3300053138 | Ga0500564_002317 | Ga0500564_002317_5021_5683 | 208 |
| 137 | 3300053148 | Ga0500590_000021 | Ga0500590_000021_20957_21619 | 208 |
| 138 | 3300053158 | Ga0500627_0000002 | Ga0500627_0000002_61413_62042 | 208 |
| 139 | 3300005436 | Ga0070713_100279666 | Ga0070713_1002796663 | 209 |
| 140 | 3300005548 | Ga0070665_100030306 | Ga0070665_1000303063 | 209 |
| 141 | 3300005843 | Ga0068860_100017887 | Ga0068860_1000178876 | 209 |
| 142 | 3300006028 | Ga0070717_10122752 | Ga0070717_101227523 | 209 |
| 143 | 3300025304 | Ga0209257_1019666 | Ga0209257_10196664 | 209 |
| 144 | 3300025972 | Ga0207668_10778051 | Ga0207668_107780512 | 209 |
| 145 | 3300028379 | Ga0268266_10288622 | Ga0268266_102886222 | 209 |
| 146 | 3300028381 | Ga0268264_10007525 | Ga0268264_1000752510 | 209 |
| 147 | 3300033179 | Ga0307507_10172992 | Ga0307507_101729922 | 209 |
| 148 | 3300047472 | Ga0495686_0000060 | Ga0495686_0000060_7451_8110 | 209 |
| 149 | 3300048924 | Ga0496121_0025741 | Ga0496121_0025741_4430_5065 | 209 |
| 150 | 3300049586 | Ga0501070_0152579 | Ga0501070_0152579_867_1514 | 209 |
| 151 | 3300053178 | Ga0500637_0004224 | Ga0500637_0004224_905_1576 | 209 |
| 152 | iso_pu_bacteria | 2512564014 | 2512644769 | 209 |
| 153 | 3300005327 | Ga0070658_10186601 | Ga0070658_101866011 | 210 |
| 154 | 3300005844 | Ga0068862_100035914 | Ga0068862_1000359145 | 210 |
| 155 | 3300009092 | Ga0105250_10000551 | Ga0105250_1000055119 | 210 |
| 156 | 3300009177 | Ga0105248_10308863 | Ga0105248_103088633 | 210 |
| 157 | 3300025304 | Ga0209257_1038677 | Ga0209257_10386773 | 210 |
| 158 | 3300025711 | Ga0207696_1010781 | Ga0207696_10107814 | 210 |
| 159 | 3300048920 | Ga0496117_0046062 | Ga0496117_0046062_1388_2035 | 210 |
| 160 | 3300048927 | Ga0496124_0045778 | Ga0496124_0045778_1219_1866 | 210 |
| 161 | iso_pu_bacteria | 2935769743 | 2935771293 | 210 |
| 162 | iso_pu_bacteria | 2935785616 | 2935793448 | 210 |
| 163 | iso_pu_bacteria | 2935793552 | 2935801462 | 210 |
| 164 | iso_pu_bacteria | 8016522445 | 8016528464 | 210 |
| 165 | iso_pu_bacteria | 8016539877 | 8016546843 | 210 |
| 166 | iso_pu_bacteria | 8016548790 | 8016555274 | 210 |
| 167 | iso_pu_bacteria | 8016557553 | 8016563634 | 210 |
| 168 | iso_pu_bacteria | 8016575299 | 8016576159 | 210 |
| 169 | iso_pu_bacteria | 8016595262 | 8016601370 | 210 |
| 170 | 3300002070 | JGI24750J21931_1011241 | JGI24750J21931_10112411 | 211 |
| 171 | 3300002459 | JGI24751J29686_10003625 | JGI24751J29686_100036253 | 211 |
| 172 | 3300005331 | Ga0070670_100001886 | Ga0070670_10000188614 | 211 |
| 173 | 3300005335 | Ga0070666_10000392 | Ga0070666_1000039226 | 211 |
| 174 | 3300005347 | Ga0070668_100012774 | Ga0070668_1000127741 | 211 |
| 175 | 3300005353 | Ga0070669_100000023 | Ga0070669_100000023162 | 211 |
| 176 | 3300005367 | Ga0070667_100002263 | Ga0070667_10000226313 | 211 |
| 177 | 3300005440 | Ga0070705_100359477 | Ga0070705_1003594771 | 211 |
| 178 | 3300005445 | Ga0070708_100063173 | Ga0070708_1000631733 | 211 |
| 179 | 3300005548 | Ga0070665_100118053 | Ga0070665_1001180533 | 211 |
| 180 | 3300005615 | Ga0070702_100162974 | Ga0070702_1001629743 | 211 |
| 181 | 3300005617 | Ga0068859_100000958 | Ga0068859_10000095813 | 211 |
| 182 | 3300005719 | Ga0068861_100020314 | Ga0068861_1000203143 | 211 |
| 183 | 3300005842 | Ga0068858_100008736 | Ga0068858_10000873614 | 211 |
| 184 | 3300005843 | Ga0068860_100591459 | Ga0068860_1005914592 | 211 |
| 185 | 3300005844 | Ga0068862_100000425 | Ga0068862_10000042518 | 211 |
| 186 | 3300006177 | Ga0075362_10238472 | Ga0075362_102384722 | 211 |
| 187 | 3300006353 | Ga0075370_10004385 | Ga0075370_100043855 | 211 |
| 188 | 3300006931 | Ga0097620_100000958 | Ga0097620_10000095813 | 211 |
| 189 | 3300009101 | Ga0105247_10007890 | Ga0105247_100078908 | 211 |
| 190 | 3300009177 | Ga0105248_10137571 | Ga0105248_101375714 | 211 |
| 191 | 3300009553 | Ga0105249_10006886 | Ga0105249_100068862 | 211 |
| 192 | 3300013306 | Ga0163162_11073775 | Ga0163162_110737751 | 211 |
| 193 | 3300014968 | Ga0157379_10095535 | Ga0157379_100955352 | 211 |
| 194 | 3300025315 | Ga0207697_10000005 | Ga0207697_100000054 | 211 |
| 195 | 3300025900 | Ga0207710_10003734 | Ga0207710_100037347 | 211 |
| 196 | 3300025903 | Ga0207680_10000062 | Ga0207680_1000006236 | 211 |
| 197 | 3300025923 | Ga0207681_10000004 | Ga0207681_1000000417 | 211 |
| 198 | 3300025925 | Ga0207650_10001277 | Ga0207650_100012772 | 211 |
| 199 | 3300025941 | Ga0207711_10114774 | Ga0207711_101147744 | 211 |
| 200 | 3300025961 | Ga0207712_10012624 | Ga0207712_100126242 | 211 |
| 201 | 3300025972 | Ga0207668_10000370 | Ga0207668_1000037012 | 211 |
| 202 | 3300025986 | Ga0207658_10001947 | Ga0207658_1000194722 | 211 |
| 203 | 3300026035 | Ga0207703_10016115 | Ga0207703_100161157 | 211 |
| 204 | 3300026078 | Ga0207702_10197059 | Ga0207702_101970591 | 211 |
| 205 | 3300026118 | Ga0207675_100024746 | Ga0207675_1000247466 | 211 |
| 206 | 3300028379 | Ga0268266_10269080 | Ga0268266_102690802 | 211 |
| 207 | 3300028380 | Ga0268265_10000046 | Ga0268265_1000004617 | 211 |
| 208 | 3300028381 | Ga0268264_10561010 | Ga0268264_105610102 | 211 |
| 209 | 3300031730 | Ga0307516_10515392 | Ga0307516_105153922 | 211 |
| 210 | 3300050496 | nmdc:mga07m45_1802_c1 | nmdc:mga07m45_1802_c1_1367_2002 | 211 |
| 211 | 3300050496 | nmdc:mga07m45_56788_c1 | nmdc:mga07m45_56788_c1_196_831 | 211 |
| 212 | iso_pu_bacteria | 2851153111 | 2851157520 | 211 |
| 213 | 3300049570 | Ga0501033_0505936 | Ga0501033_0505936_24_683 | 212 |
| 214 | 3300049823 | Ga0501044_0068122 | Ga0501044_0068122_467_1123 | 212 |
| 215 | 3300005327 | Ga0070658_10000081 | Ga0070658_1000008137 | 213 |
| 216 | 3300005539 | Ga0068853_100000140 | Ga0068853_10000014016 | 213 |
| 217 | 3300005563 | Ga0068855_100000313 | Ga0068855_10000031333 | 213 |
| 218 | 3300005578 | Ga0068854_100001416 | Ga0068854_10000141612 | 213 |
| 219 | 3300005616 | Ga0068852_100000112 | Ga0068852_10000011250 | 213 |
| 220 | 3300009093 | Ga0105240_10000156 | Ga0105240_1000015653 | 213 |
| 221 | 3300009545 | Ga0105237_10000325 | Ga0105237_1000032548 | 213 |
| 222 | 3300010375 | Ga0105239_10000118 | Ga0105239_1000011873 | 213 |
| 223 | 3300025909 | Ga0207705_10000193 | Ga0207705_1000019320 | 213 |
| 224 | 3300025913 | Ga0207695_10000250 | Ga0207695_1000025051 | 213 |
| 225 | 3300025914 | Ga0207671_10000100 | Ga0207671_1000010074 | 213 |
| 226 | 3300025949 | Ga0207667_10000006 | Ga0207667_10000006370 | 213 |
| 227 | 3300025949 | Ga0207667_10000091 | Ga0207667_1000009164 | 213 |
| 228 | 3300025981 | Ga0207640_10000160 | Ga0207640_1000016011 | 213 |
| 229 | 3300026041 | Ga0207639_10000038 | Ga0207639_1000003890 | 213 |
| 230 | 3300026142 | Ga0207698_10000081 | Ga0207698_1000008117 | 213 |
| 231 | 3300031824 | Ga0307413_10010049 | Ga0307413_100100492 | 213 |
| 232 | 3300031852 | Ga0307410_10029449 | Ga0307410_100294497 | 213 |
| 233 | 3300031903 | Ga0307407_10276381 | Ga0307407_102763812 | 213 |
| 234 | 3300031911 | Ga0307412_10201295 | Ga0307412_102012952 | 213 |
| 235 | 3300032002 | Ga0307416_100110446 | Ga0307416_1001104462 | 213 |
| 236 | 3300032004 | Ga0307414_10008349 | Ga0307414_100083493 | 213 |
| 237 | 3300032005 | Ga0307411_10000546 | Ga0307411_1000054612 | 213 |
| 238 | 3300046522 | Ga0495643_0002134 | Ga0495643_0002134_13308_13964 | 213 |
| 239 | 3300046522 | Ga0495643_0019509 | Ga0495643_0019509_2226_2882 | 213 |
| 240 | 3300048090 | Ga0495615_0000033 | Ga0495615_0000033_42507_43169 | 213 |
| 241 | 3300048927 | Ga0496124_0058391 | Ga0496124_0058391_774_1442 | 213 |
| 242 | 3300048928 | Ga0496125_0002524 | Ga0496125_0002524_18223_18891 | 213 |
| 243 | 3300049572 | Ga0501036_0552631 | Ga0501036_0552631_26_667 | 213 |
| 244 | 3300049581 | Ga0501047_0001707 | Ga0501047_0001707_5492_6133 | 213 |
| 245 | 3300049822 | Ga0501035_0297184 | Ga0501035_0297184_624_1265 | 213 |
| 246 | 3300049823 | Ga0501044_0044143 | Ga0501044_0044143_1928_2569 | 213 |
| 247 | 3300053077 | Ga0495601_0001128 | Ga0495601_0001128_7119_7781 | 213 |
| 248 | 3300053078 | Ga0495612_0010554 | Ga0495612_0010554_2890_3552 | 213 |
| 249 | 3300053085 | Ga0495619_0033200 | Ga0495619_0033200_303_965 | 213 |
| 250 | iso_pu_bacteria | 2751185897 | 2753763147 | 213 |
| 251 | iso_pu_bacteria | 2808606401 | 2809064585 | 213 |
| 252 | iso_pu_bacteria | 2808606404 | 2809080504 | 213 |
| 253 | iso_pu_bacteria | 2808606405 | 2809084868 | 213 |
| 254 | 3300049571 | Ga0501034_0283213 | Ga0501034_0283213_24_680 | 214 |
| 255 | 3300050493 | nmdc:mga0k408_7379_c1 | nmdc:mga0k408_7379_c1_4518_5174 | 214 |
| 256 | 3300005543 | Ga0070672_100173904 | Ga0070672_1001739041 | 215 |
| 257 | 3300025940 | Ga0207691_10503783 | Ga0207691_105037831 | 215 |
| 258 | 3300046539 | Ga0495621_0090028 | Ga0495621_0090028_360_1022 | 216 |
| 259 | 3300049823 | Ga0501044_0699376 | Ga0501044_0699376_46_711 | 216 |
| 260 | 3300013102 | Ga0157371_10015758 | Ga0157371_100157584 | 217 |
| 261 | 3300031911 | Ga0307412_10000159 | Ga0307412_1000015943 | 217 |
| 262 | 3300046522 | Ga0495643_0059525 | Ga0495643_0059525_671_1333 | 217 |
| 263 | 3300053156 | Ga0500622_0006837 | Ga0500622_0006837_2066_2761 | 217 |
| 264 | 3300001989 | JGI24739J22299_10002530 | JGI24739J22299_100025302 | 218 |
| 265 | 3300005457 | Ga0070662_100052313 | Ga0070662_1000523132 | 218 |
| 266 | 3300005564 | Ga0070664_100154970 | Ga0070664_1001549702 | 218 |
| 267 | 3300013307 | Ga0157372_10000722 | Ga0157372_1000072234 | 218 |
| 268 | 3300025904 | Ga0207647_10012703 | Ga0207647_100127033 | 218 |
| 269 | 3300025933 | Ga0207706_10020134 | Ga0207706_100201343 | 218 |
| 270 | 3300025945 | Ga0207679_10670661 | Ga0207679_106706611 | 218 |
| 271 | 3300049779 | Ga0501283_000570 | Ga0501283_000570_1854_2543 | 218 |
| 272 | 3300053156 | Ga0500622_0000188 | Ga0500622_0000188_25913_26587 | 223 |
| 273 | 3300005353 | Ga0070669_100000030 | Ga0070669_10000003087 | 225 |
| 274 | 3300025923 | Ga0207681_10000036 | Ga0207681_1000003683 | 225 |
| 275 | 3300006051 | Ga0075364_10002610 | Ga0075364_100026104 | 226 |
| 276 | 3300006177 | Ga0075362_10057120 | Ga0075362_100571202 | 226 |
| 277 | 3300006186 | Ga0075369_10073034 | Ga0075369_100730343 | 226 |
| 278 | 3300050489 | nmdc:mga03683_16551_c1 | nmdc:mga03683_16551_c1_1850_2569 | 226 |
| 279 | 3300050491 | nmdc:mga00v17_1563_c1 | nmdc:mga00v17_1563_c1_4498_5217 | 226 |
| 280 | 3300050516 | nmdc:mga0sz30_36256_c1 | nmdc:mga0sz30_36256_c1_231_950 | 226 |
| 281 | 2162886006 | SwRhRL3b_contig_3173165 | SwRhRL3b_0446.00001170 | 228 |
| 282 | 3300005295 | Ga0065707_10000679 | Ga0065707_100006793 | 228 |
| 283 | 3300005331 | Ga0070670_100000053 | Ga0070670_10000005372 | 228 |
| 284 | 3300005618 | Ga0068864_100000055 | Ga0068864_10000005543 | 228 |
| 285 | 3300025924 | Ga0207694_10022609 | Ga0207694_100226095 | 228 |
| 286 | 3300025925 | Ga0207650_10000075 | Ga0207650_1000007574 | 228 |
| 287 | 3300026095 | Ga0207676_10000041 | Ga0207676_1000004145 | 228 |
| 288 | 3300053735 | Ga0500596_001463 | Ga0500596_001463_1847_2542 | 228 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8f6h-assembly1.cif.gz_B | cryo-em structure of a zinc-loaded asymmetrical tmd d70a mutant of the yiip-fab complex | 0.8659 | 22 | 201 |
| 5vrf-assembly1.cif.gz_A | cryoem structure of the zinc transporter yiip from helical crystals | 0.852 | 21 | 199 |
| 8f6h-assembly1.cif.gz_A | cryo-em structure of a zinc-loaded asymmetrical tmd d70a mutant of the yiip-fab complex | 0.799 | 21 | 198 |
| 8j80-assembly1.cif.gz_B | cryo-em structure of hznt7-fab complex in zinc state 1, determined in heterogeneous conformations- one subunit in an inward-facing zinc-bound and the other in an outward-facing zinc-unbound conformation | 0.7774 | 16 | 201 |
| 8j7w-assembly1.cif.gz_B | cryo-em structure of hznt7-fab complex in zinc state 2, determined in heterogeneous conformations- one subunit in an inward-facing zinc-bound and the other in an outward-facing zinc-bound conformation | 0.7606 | 23 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P96876_30_219_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.9007 | 22 | 198 | 1.20.1510.10 |
| af_P75757_17_213_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.8964 | 22 | 203 | 1.20.1510.10 |
| af_Q9M271_29_255_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.8937 | 23 | 201 | 1.20.1510.10 |
| af_O35149_110_332_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.8692 | 23 | 200 | 1.20.1510.10 |
| af_Q5A0W4_303_536_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.8403 | 23 | 200 | 1.20.1510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849P7M8-F1-model_v4 | Cation transporter | 0.9909 | 20 | 205 |
GO:0005385
GO:0005886 |
| AF-A0A7U8GRG4-F1-model_v4 | Cation transporter | 0.9894 | 20 | 208 |
GO:0005385
GO:0005886 |
| AF-A0A1V4CIQ9-F1-model_v4 | Cation transporter | 0.989 | 17 | 204 |
GO:0005385
GO:0005886 |
| AF-A0A6L6JIN2-F1-model_v4 | Cation transporter | 0.9835 | 20 | 196 |
GO:0005385
GO:0005886 GO:0046872 |
| AF-A0A0A0BGM7-F1-model_v4 | Cobalt-zinc-cadmium resistance protein CzcD | 0.982 | 20 | 196 |
GO:0005385
GO:0005886 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar