F388379

General Info

Members Datasets Scaffolds Average Seq Length
288 183 278 266

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10001446|Ga0065707_100014467
Length 291
Sequence MRSRSCAHLAGASEFVIHSPAKGINRSVKKTPALELRDVSYVANGKKILDSINWTVQYGEHWAILGPNGSGKTTLLKLASGYLWPNAGGVVLRKGEELTHLPELRKSIGWVTAQLASEIPPQEKALNTVVSGKFAQIGYLGGFWGQASRSDYARARGYLKELGCDQLREQEFGTLSQGEQQKVLIARARMTRPYLIILDEPCAGMDPGARENFLAALNKIGKQKKLPALIFVTHHIEEILPLFRNTLVLRDGKVVHAGPTHRVLKRDVLKKLYGISLAIMKRKGRYWPTTQ

Samples

Sample ID Description Type Environment
1 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
2 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
3 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
4 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
5 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
6 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
7 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
8 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
164 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
182 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
183 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.53
Metatranscriptomes 0
Isolates 3.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.35
Rhizoplane 1.39
Rhizosphere 96.18
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10003844 3300003911 Bacteria 2659
2 Ga0065712_10002188 3300005290 Bacteria 8529
3 Ga0065712_10068530 3300005290 Bacteria 10025
4 Ga0065715_10000481 3300005293 Bacteria 11006
5 Ga0065707_10001446 3300005295 Bacteria 6865
6 Ga0065707_10127615 3300005295 Unclassified 1980
7 Ga0065707_10148445 3300005295 Bacteria 1686
8 Ga0070658_10290261 3300005327 Unclassified 1393
9 Ga0070676_10011962 3300005328 Bacteria 4730
10 Ga0070690_100020995 3300005330 Bacteria 3984
11 Ga0070670_100007256 3300005331 Bacteria 9396
12 Ga0070666_10063509 3300005335 Bacteria 2503
13 Ga0070680_100120831 3300005336 Unclassified 2187
14 Ga0070680_100187528 3300005336 Bacteria 1742
15 Ga0070680_100406877 3300005336 Unclassified 1160
16 Ga0068868_100048062 3300005338 Bacteria 3346
17 Ga0070660_100187175 3300005339 Unclassified 1676
18 Ga0070661_100099653 3300005344 Bacteria 2159
19 Ga0070668_100100376 3300005347 Bacteria 2293
20 Ga0070669_100100845 3300005353 Bacteria 2177
21 Ga0070671_100092370 3300005355 Bacteria 2535
22 Ga0070674_100022452 3300005356 Bacteria 4070
23 Ga0070659_100143514 3300005366 Unclassified 1944
24 Ga0070667_100022129 3300005367 Bacteria 5273
25 Ga0070703_10135115 3300005406 Unclassified 910
26 Ga0070705_100009261 3300005440 Bacteria 4891
27 Ga0070678_100149751 3300005456 Bacteria 1878
28 Ga0070662_100055868 3300005457 Bacteria 2865
29 Ga0070662_100290541 3300005457 Bacteria 1325
30 Ga0070681_10138164 3300005458 Bacteria 2366
31 Ga0070706_100245411 3300005467 Bacteria 1672
32 Ga0070707_100248026 3300005468 Unclassified 1733
33 Ga0070707_100284715 3300005468 Bacteria 1606
34 Ga0070699_100304964 3300005518 Bacteria 1429
35 Ga0070697_100210049 3300005536 Bacteria 1657
36 Ga0070697_100232409 3300005536 Unclassified 1573
37 Ga0068853_100087025 3300005539 Unclassified 2741
38 Ga0070686_100023721 3300005544 Bacteria 3670
39 Ga0070695_100028166 3300005545 Bacteria 3485
40 Ga0070695_100139358 3300005545 Bacteria 1680
41 Ga0070693_100131546 3300005547 Bacteria 1565
42 Ga0070704_100080406 3300005549 Bacteria 2397
43 Ga0070704_100204079 3300005549 Bacteria 1598
44 Ga0070664_100059705 3300005564 Bacteria 3245
45 Ga0068854_100028648 3300005578 Bacteria 3850
46 Ga0068856_100553612 3300005614 Bacteria 1171
47 Ga0068859_100063048 3300005617 Bacteria 3737
48 Ga0068859_100589488 3300005617 Bacteria 1205
49 Ga0068861_100594855 3300005719 Unclassified 1014
50 Ga0068870_10134379 3300005840 Bacteria 1440
51 Ga0068860_100625754 3300005843 Unclassified 1083
52 Ga0068862_100261045 3300005844 Bacteria 1581
53 Ga0081455_10005623 3300005937 Bacteria 13694
54 Ga0081455_10042664 3300005937 Unclassified 3976
55 Ga0081538_10009269 3300005981 Bacteria 8239
56 Ga0075432_10017699 3300006058 Bacteria 2429
57 Ga0097621_100315672 3300006237 Bacteria 1383
58 Ga0068871_100138718 3300006358 Bacteria 2066
59 Ga0075428_100085690 3300006844 Bacteria 3436
60 Ga0075428_100138170 3300006844 Unclassified 2649
61 Ga0075430_100028622 3300006846 Bacteria 4732
62 Ga0075430_100058120 3300006846 Unclassified 3251
63 Ga0075430_100410682 3300006846 Bacteria 1117
64 Ga0075431_100023300 3300006847 Bacteria 6334
65 Ga0075433_10005747 3300006852 Bacteria 9756
66 Ga0075433_10007706 3300006852 Bacteria 8554
67 Ga0075433_10029340 3300006852 Bacteria 4685
68 Ga0075434_100000772 3300006871 Bacteria 25325
69 Ga0075434_100020157 3300006871 Bacteria 6463
70 Ga0075434_100023298 3300006871 Bacteria 6031
71 Ga0075434_100245972 3300006871 Unclassified 1808
72 Ga0075429_100156653 3300006880 Bacteria 1994
73 Ga0075436_100001539 3300006914 Bacteria 15751
74 Ga0075436_100012811 3300006914 Bacteria 5749
75 Ga0075436_100178844 3300006914 Bacteria 1499
76 Ga0097620_100063048 3300006931 Bacteria 3737
77 Ga0097620_100589535 3300006931 Bacteria 1205
78 Ga0075435_100017021 3300007076 Bacteria 5492
79 Ga0075435_100071606 3300007076 Unclassified 2831
80 Ga0075435_100126858 3300007076 Bacteria 2133
81 Ga0075435_100168256 3300007076 Unclassified 1849
82 Ga0105240_10090049 3300009093 Bacteria 3751
83 Ga0111539_10030704 3300009094 Bacteria 6533
84 Ga0111539_10125743 3300009094 Bacteria 3004
85 Ga0105245_10072780 3300009098 Bacteria 3123
86 Ga0114129_10007323 3300009147 Bacteria 15705
87 Ga0114129_10073800 3300009147 Unclassified 4753
88 Ga0114129_10078033 3300009147 Bacteria 4606
89 Ga0114129_10081384 3300009147 Unclassified 4501
90 Ga0114129_10134296 3300009147 Unclassified 3396
91 Ga0114129_10382497 3300009147 Unclassified 1858
92 Ga0114129_10427199 3300009147 Bacteria 1741
93 Ga0114129_10506735 3300009147 Bacteria 1575
94 Ga0114129_10710866 3300009147 Unclassified 1290
95 Ga0114129_10834780 3300009147 Bacteria 1173
96 Ga0114129_10985777 3300009147 Bacteria 1062
97 Ga0105243_10334957 3300009148 Bacteria 1384
98 Ga0105241_10129570 3300009174 Bacteria 2041
99 Ga0105242_10120365 3300009176 Bacteria 2252
100 Ga0105242_10432156 3300009176 Bacteria 1236
101 Ga0105237_10546463 3300009545 Bacteria 1165
102 Ga0105249_10229293 3300009553 Bacteria 1831
103 Ga0105239_10019107 3300010375 Bacteria 7574
104 Ga0105246_10041185 3300011119 Bacteria 3120
105 Ga0105246_10260070 3300011119 Bacteria 1382
106 Ga0157370_10201119 3300013104 Bacteria 1848
107 Ga0157374_10038215 3300013296 Unclassified 4411
108 Ga0157378_10174951 3300013297 Bacteria 2015
109 Ga0157378_10249249 3300013297 Bacteria 1699
110 Ga0163162_11052772 3300013306 Archaea 921
111 Ga0157372_10078695 3300013307 Bacteria 3726
112 Ga0157377_10072677 3300014745 Bacteria 1991
113 Ga0157376_10021282 3300014969 Bacteria 5037
114 Ga0207697_10006061 3300025315 Bacteria 5526
115 Ga0207697_10039858 3300025315 Unclassified 1927
116 Ga0207682_10014571 3300025893 Bacteria 3064
117 Ga0207688_10029647 3300025901 Bacteria 3013
118 Ga0207647_10167386 3300025904 Unclassified 1281
119 Ga0207645_10007413 3300025907 Bacteria 7752
120 Ga0207643_10139880 3300025908 Bacteria 1445
121 Ga0207643_10212801 3300025908 Unclassified 1180
122 Ga0207707_10167504 3300025912 Bacteria 1920
123 Ga0207707_10182758 3300025912 Unclassified 1830
124 Ga0207695_10265953 3300025913 Bacteria 1611
125 Ga0207660_10044269 3300025917 Bacteria 3131
126 Ga0207660_10280908 3300025917 Bacteria 1321
127 Ga0207657_10005121 3300025919 Bacteria 13733
128 Ga0207652_10010632 3300025921 Bacteria 7410
129 Ga0207646_10239444 3300025922 Unclassified 1639
130 Ga0207687_10235682 3300025927 Bacteria 1448
131 Ga0207644_10338601 3300025931 Bacteria 1219
132 Ga0207706_10003315 3300025933 Bacteria 15413
133 Ga0207706_10076531 3300025933 Unclassified 2943
134 Ga0207686_10228301 3300025934 Bacteria 1348
135 Ga0207709_10399728 3300025935 Unclassified 1050
136 Ga0207704_10150896 3300025938 Bacteria 1639
137 Ga0207691_10019662 3300025940 Bacteria 6388
138 Ga0207679_10175234 3300025945 Bacteria 1770
139 Ga0207651_10233255 3300025960 Unclassified 1495
140 Ga0207668_10335957 3300025972 Unclassified 1259
141 Ga0207678_10068499 3300026067 Bacteria 3044
142 Ga0207676_10451941 3300026095 Bacteria 1211
143 Ga0207675_100648423 3300026118 Unclassified 1062
144 Ga0207683_10022903 3300026121 Bacteria 5368
145 Ga0209996_1014746 3300027395 Bacteria 1063
146 Ga0209999_1021263 3300027543 Bacteria 1191
147 Ga0209982_1002051 3300027552 Bacteria 2792
148 Ga0209970_1010536 3300027614 Bacteria 1513
149 Ga0210002_1005982 3300027617 Bacteria 1828
150 Ga0209971_1002296 3300027682 Bacteria 4628
151 Ga0209971_1046869 3300027682 Bacteria 1043
152 Ga0209998_10023889 3300027717 Bacteria 1324
153 Ga0209974_10005107 3300027876 Bacteria 4633
154 Ga0209974_10005308 3300027876 Bacteria 4543
155 Ga0207428_10259361 3300027907 Archaea 1295
156 Ga0307408_100330513 3300031548 Bacteria 1287
157 Ga0307410_10087842 3300031852 Bacteria 2200
158 Ga0307406_10147946 3300031901 Bacteria 1672
159 Ga0307407_10122539 3300031903 Bacteria 1651
160 Ga0307416_100225417 3300032002 Bacteria 1802
161 Ga0307414_10022497 3300032004 Bacteria 3977
162 Ga0307414_10076764 3300032004 Bacteria 2429
163 Ga0373945_0049552 3300035116 Unclassified 1541
164 Ga0373943_0069945 3300035170 Bacteria 1775
165 Ga0373947_0021370 3300035725 Bacteria 3745
166 Ga0373937_0228588 3300036401 Unclassified 1752
167 Ga0373925_0067183 3300037068 Unclassified 2704
168 Ga0439435_0022665 3300042436 Bacteria 1642
169 Ga0453683_0000171 3300044673 Bacteria 89761
170 Ga0453684_0177538 3300044712 Bacteria 2503
171 Ga0451576_0306134 3300045051 Unclassified 1662
172 Ga0451576_0527550 3300045051 Bacteria 1240
173 Ga0495590_0041168 3300046457 Bacteria 1611
174 Ga0495580_0002009 3300046472 Bacteria 17901
175 Ga0495582_0171375 3300046473 Bacteria 1236
176 Ga0495598_0024778 3300046537 Bacteria 1630
177 Ga0496104_0126164 3300048907 Bacteria 2458
178 Ga0496106_0226632 3300048909 Bacteria 1491
179 Ga0496111_0204864 3300048914 Bacteria 1466
180 Ga0496112_0075801 3300048915 Bacteria 3326
181 Ga0496116_0052063 3300048919 Bacteria 2715
182 Ga0501031_0015985 3300049568 Bacteria 4872
183 Ga0501032_0028409 3300049569 Bacteria 3843
184 Ga0501033_0016819 3300049570 Bacteria 5529
185 Ga0501033_0105784 3300049570 Unclassified 2050
186 Ga0501036_0011521 3300049572 Bacteria 7326
187 Ga0501037_0008424 3300049573 Bacteria 7561
188 Ga0501038_0002952 3300049574 Bacteria 15864
189 Ga0501038_0481082 3300049574 Bacteria 951
190 Ga0501039_0009103 3300049575 Bacteria 7566
191 Ga0501040_0001185 3300049576 Bacteria 16570
192 Ga0501040_0019670 3300049576 Bacteria 4493
193 Ga0501041_0000019 3300049577 Bacteria 54757
194 Ga0501041_0093231 3300049577 Bacteria 1860
195 Ga0501042_0009848 3300049578 Bacteria 6384
196 Ga0501042_0154967 3300049578 Bacteria 1652
197 Ga0501043_0033260 3300049579 Bacteria 4056
198 Ga0501046_0001816 3300049580 Bacteria 20327
199 Ga0501046_0092266 3300049580 Bacteria 2328
200 Ga0501046_0285875 3300049580 Bacteria 1207
201 Ga0501048_0005670 3300049582 Bacteria 9497
202 Ga0501048_0320853 3300049582 Bacteria 1103
203 Ga0501068_0032903 3300049584 Unclassified 3085
204 Ga0501068_0135653 3300049584 Bacteria 1541
205 Ga0501070_0019442 3300049586 Bacteria 5696
206 Ga0501071_0001052 3300049587 Bacteria 15287
207 Ga0501071_0077489 3300049587 Bacteria 2428
208 Ga0501071_0092220 3300049587 Bacteria 2226
209 Ga0501072_0000142 3300049588 Bacteria 53708
210 Ga0501072_0228771 3300049588 Bacteria 1481
211 Ga0501072_0282288 3300049588 Bacteria 1321
212 Ga0501073_0015779 3300049589 Bacteria 5474
213 Ga0501074_0009829 3300049590 Bacteria 6948
214 Ga0501074_0040481 3300049590 Bacteria 3375
215 Ga0501075_0000028 3300049591 Bacteria 58923
216 Ga0501075_0019073 3300049591 Bacteria 4974
217 Ga0501075_0245898 3300049591 Bacteria 1363
218 Ga0501076_0000069 3300049592 Bacteria 50973
219 Ga0501076_0012713 3300049592 Bacteria 6301
220 Ga0501076_0089720 3300049592 Bacteria 2471
221 Ga0501077_0000042 3300049593 Bacteria 65217
222 Ga0501077_0045317 3300049593 Bacteria 2794
223 Ga0501217_101350 3300049661 Bacteria 818
224 Ga0501233_056183 3300049668 Bacteria 966
225 Ga0501079_0000343 3300049741 Bacteria 29538
226 Ga0501080_0006365 3300049742 Bacteria 10593
227 Ga0501080_0078757 3300049742 Bacteria 3064
228 Ga0501080_0504934 3300049742 Unclassified 1080
229 Ga0501081_0000056 3300049743 Bacteria 43207
230 Ga0501081_0018595 3300049743 Bacteria 4617
231 Ga0501081_0322529 3300049743 Bacteria 1135
232 Ga0501083_0005670 3300049744 Bacteria 8839
233 Ga0501083_0050872 3300049744 Bacteria 2787
234 Ga0501045_0000636 3300049824 Bacteria 22186
235 Ga0501045_0136789 3300049824 Bacteria 1821
236 Ga0501045_0400109 3300049824 Bacteria 1022
237 nmdc:mga05p37_13428_c1 3300050507 Bacteria 9815
238 nmdc:mga05p37_2960_c1 3300050507 Bacteria 19723
239 nmdc:mga05p37_417085_c1 3300050507 Bacteria 1563
240 nmdc:mga05p37_58322_c1 3300050507 Bacteria 4755
241 nmdc:mga05p37_73632_c1 3300050507 Bacteria 4204
242 nmdc:mga09592_660037_c1 3300050508 Bacteria 892
243 nmdc:mga09592_66560_c1 3300050508 Unclassified 3054
244 nmdc:mga0qj67_163631_c1 3300050509 Bacteria 1806
245 nmdc:mga0qj67_50495_c1 3300050509 Unclassified 3289
246 nmdc:mga06r32_276311_c1 3300050510 Bacteria 1667
247 nmdc:mga06r32_611856_c1 3300050510 Bacteria 1060
248 nmdc:mga08y16_167407_c1 3300050511 Unclassified 2283
249 nmdc:mga08y16_82352_c1 3300050511 Unclassified 3354
250 nmdc:mga0n895_14155_c1 3300050512 Bacteria 7234
251 nmdc:mga0n895_148873_c1 3300050512 Unclassified 2370
252 nmdc:mga0n895_274466_c1 3300050512 Bacteria 1710
253 nmdc:mga0n895_290_c1 3300050512 Bacteria 33057
254 nmdc:mga0n895_349539_c1 3300050512 Bacteria 1497
255 nmdc:mga0n895_3747_c1 3300050512 Bacteria 12304
256 nmdc:mga0n895_46568_c1 3300050512 Bacteria 4237
257 nmdc:mga0n895_593501_c1 3300050512 Unclassified 1110
258 nmdc:mga0rr50_22172_c1 3300050513 Bacteria 4353
259 nmdc:mga0rr50_33068_c1 3300050513 Unclassified 3692
260 nmdc:mga0rr50_421098_c1 3300050513 Bacteria 1130
261 nmdc:mga0rr50_83010_c1 3300050513 Bacteria 2476
262 nmdc:mga08x19_107153_c1 3300050514 Bacteria 1860
263 nmdc:mga08x19_312981_c1 3300050514 Unclassified 1092
264 nmdc:mga08x19_31645_c1 3300050514 Unclassified 3330
265 nmdc:mga08x19_3680_c1 3300050514 Bacteria 4971
266 nmdc:mga08x19_47479_c1 3300050514 Unclassified 2748
267 nmdc:mga0a205_1404_c2 3300050515 Bacteria 18420
268 nmdc:mga0a205_37593_c1 3300050515 Bacteria 4655
269 nmdc:mga0a205_503448_c1 3300050515 Bacteria 1068
270 nmdc:mga0a205_518_c1 3300050515 Bacteria 30296
271 Ga0501084_0000316 3300054114 Bacteria 36744
272 Ga0501084_0229333 3300054114 Bacteria 1567
273 Ga0501082_0011162 3300060353 Bacteria 7722
274 Ga0501082_0023262 3300060353 Bacteria 5345
275 Ga0501082_0103883 3300060353 Unclassified 2458
276 Ga0530510_0000906 3300061734 Bacteria 19557
277 Ga0530510_0024495 3300061734 Bacteria 4307
278 Ga0530510_0451921 3300061734 Bacteria 971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049661 Ga0501217_101350 Ga0501217_101350_39_779 237
2 iso_pu_bacteria 8055632911 8055634787 248
3 iso_pu_bacteria 2907202186 2907202473 249
4 iso_pu_bacteria 2980182181 2980189457 249
5 3300048919 Ga0496116_0052063 Ga0496116_0052063_1052_1816 250
6 iso_pu_bacteria 2821111986 2821112093 251
7 iso_pu_bacteria 2889042446 2889046158 251
8 iso_pu_bacteria 2904490793 2904493049 251
9 iso_pu_bacteria 2919160200 2919162344 251
10 iso_pu_bacteria 2931384279 2931389601 251
11 iso_pu_bacteria 2946053406 2946054424 251
12 iso_pu_bacteria 8054795415 8054798876 252
13 3300046457 Ga0495590_0041168 Ga0495590_0041168_670_1452 253
14 3300049668 Ga0501233_056183 Ga0501233_056183_20_811 254
15 3300011119 Ga0105246_10260070 Ga0105246_102600702 255
16 3300006847 Ga0075431_100023300 Ga0075431_1000233008 263
17 3300006880 Ga0075429_100156653 Ga0075429_1001566531 263
18 3300049577 Ga0501041_0093231 Ga0501041_0093231_1009_1800 263
19 3300049584 Ga0501068_0135653 Ga0501068_0135653_215_1006 263
20 3300049587 Ga0501071_0077489 Ga0501071_0077489_847_1638 263
21 3300049587 Ga0501071_0092220 Ga0501071_0092220_1168_1959 263
22 3300049591 Ga0501075_0019073 Ga0501075_0019073_3992_4783 263
23 3300049592 Ga0501076_0012713 Ga0501076_0012713_4753_5544 263
24 3300049742 Ga0501080_0504934 Ga0501080_0504934_115_906 263
25 3300049743 Ga0501081_0018595 Ga0501081_0018595_1536_2327 263
26 3300049824 Ga0501045_0400109 Ga0501045_0400109_117_908 263
27 3300060353 Ga0501082_0103883 Ga0501082_0103883_129_920 263
28 3300061734 Ga0530510_0451921 Ga0530510_0451921_163_954 263
29 3300005290 Ga0065712_10002188 Ga0065712_100021885 264
30 3300005290 Ga0065712_10068530 Ga0065712_100685305 264
31 3300005293 Ga0065715_10000481 Ga0065715_100004816 264
32 3300005295 Ga0065707_10127615 Ga0065707_101276151 264
33 3300005295 Ga0065707_10148445 Ga0065707_101484452 264
34 3300005327 Ga0070658_10290261 Ga0070658_102902612 264
35 3300005328 Ga0070676_10011962 Ga0070676_100119623 264
36 3300005330 Ga0070690_100020995 Ga0070690_1000209952 264
37 3300005331 Ga0070670_100007256 Ga0070670_1000072565 264
38 3300005335 Ga0070666_10063509 Ga0070666_100635092 264
39 3300005336 Ga0070680_100120831 Ga0070680_1001208311 264
40 3300005336 Ga0070680_100187528 Ga0070680_1001875282 264
41 3300005336 Ga0070680_100406877 Ga0070680_1004068771 264
42 3300005338 Ga0068868_100048062 Ga0068868_1000480622 264
43 3300005339 Ga0070660_100187175 Ga0070660_1001871751 264
44 3300005344 Ga0070661_100099653 Ga0070661_1000996532 264
45 3300005347 Ga0070668_100100376 Ga0070668_1001003761 264
46 3300005353 Ga0070669_100100845 Ga0070669_1001008452 264
47 3300005355 Ga0070671_100092370 Ga0070671_1000923702 264
48 3300005356 Ga0070674_100022452 Ga0070674_1000224523 264
49 3300005366 Ga0070659_100143514 Ga0070659_1001435141 264
50 3300005367 Ga0070667_100022129 Ga0070667_1000221295 264
51 3300005406 Ga0070703_10135115 Ga0070703_101351151 264
52 3300005440 Ga0070705_100009261 Ga0070705_1000092614 264
53 3300005456 Ga0070678_100149751 Ga0070678_1001497512 264
54 3300005457 Ga0070662_100055868 Ga0070662_1000558682 264
55 3300005457 Ga0070662_100290541 Ga0070662_1002905412 264
56 3300005458 Ga0070681_10138164 Ga0070681_101381642 264
57 3300005467 Ga0070706_100245411 Ga0070706_1002454112 264
58 3300005536 Ga0070697_100210049 Ga0070697_1002100491 264
59 3300005536 Ga0070697_100232409 Ga0070697_1002324092 264
60 3300005539 Ga0068853_100087025 Ga0068853_1000870252 264
61 3300005544 Ga0070686_100023721 Ga0070686_1000237213 264
62 3300005545 Ga0070695_100028166 Ga0070695_1000281661 264
63 3300005545 Ga0070695_100139358 Ga0070695_1001393581 264
64 3300005547 Ga0070693_100131546 Ga0070693_1001315462 264
65 3300005549 Ga0070704_100080406 Ga0070704_1000804062 264
66 3300005549 Ga0070704_100204079 Ga0070704_1002040793 264
67 3300005564 Ga0070664_100059705 Ga0070664_1000597052 264
68 3300005578 Ga0068854_100028648 Ga0068854_1000286482 264
69 3300005614 Ga0068856_100553612 Ga0068856_1005536122 264
70 3300005617 Ga0068859_100063048 Ga0068859_1000630482 264
71 3300005617 Ga0068859_100589488 Ga0068859_1005894881 264
72 3300005719 Ga0068861_100594855 Ga0068861_1005948551 264
73 3300005840 Ga0068870_10134379 Ga0068870_101343792 264
74 3300005843 Ga0068860_100625754 Ga0068860_1006257541 264
75 3300005844 Ga0068862_100261045 Ga0068862_1002610452 264
76 3300005937 Ga0081455_10042664 Ga0081455_100426642 264
77 3300005981 Ga0081538_10009269 Ga0081538_100092692 264
78 3300006237 Ga0097621_100315672 Ga0097621_1003156722 264
79 3300006358 Ga0068871_100138718 Ga0068871_1001387182 264
80 3300006844 Ga0075428_100085690 Ga0075428_1000856903 264
81 3300006846 Ga0075430_100028622 Ga0075430_1000286223 264
82 3300006846 Ga0075430_100410682 Ga0075430_1004106822 264
83 3300006852 Ga0075433_10005747 Ga0075433_100057476 264
84 3300006852 Ga0075433_10007706 Ga0075433_100077065 264
85 3300006871 Ga0075434_100000772 Ga0075434_10000077217 264
86 3300006871 Ga0075434_100023298 Ga0075434_1000232986 264
87 3300006871 Ga0075434_100245972 Ga0075434_1002459722 264
88 3300006914 Ga0075436_100001539 Ga0075436_1000015398 264
89 3300006914 Ga0075436_100012811 Ga0075436_1000128115 264
90 3300006914 Ga0075436_100178844 Ga0075436_1001788442 264
91 3300006931 Ga0097620_100063048 Ga0097620_1000630482 264
92 3300006931 Ga0097620_100589535 Ga0097620_1005895351 264
93 3300007076 Ga0075435_100071606 Ga0075435_1000716062 264
94 3300007076 Ga0075435_100126858 Ga0075435_1001268582 264
95 3300007076 Ga0075435_100168256 Ga0075435_1001682562 264
96 3300009093 Ga0105240_10090049 Ga0105240_100900493 264
97 3300009094 Ga0111539_10030704 Ga0111539_100307041 264
98 3300009098 Ga0105245_10072780 Ga0105245_100727802 264
99 3300009147 Ga0114129_10007323 Ga0114129_1000732316 264
100 3300009147 Ga0114129_10078033 Ga0114129_100780332 264
101 3300009147 Ga0114129_10081384 Ga0114129_100813842 264
102 3300009147 Ga0114129_10134296 Ga0114129_101342963 264
103 3300009147 Ga0114129_10382497 Ga0114129_103824972 264
104 3300009147 Ga0114129_10427199 Ga0114129_104271992 264
105 3300009147 Ga0114129_10506735 Ga0114129_105067352 264
106 3300009147 Ga0114129_10710866 Ga0114129_107108661 264
107 3300009147 Ga0114129_10834780 Ga0114129_108347802 264
108 3300009147 Ga0114129_10985777 Ga0114129_109857772 264
109 3300009148 Ga0105243_10334957 Ga0105243_103349572 264
110 3300009174 Ga0105241_10129570 Ga0105241_101295703 264
111 3300009176 Ga0105242_10120365 Ga0105242_101203652 264
112 3300009176 Ga0105242_10432156 Ga0105242_104321562 264
113 3300009545 Ga0105237_10546463 Ga0105237_105464632 264
114 3300009553 Ga0105249_10229293 Ga0105249_102292931 264
115 3300010375 Ga0105239_10019107 Ga0105239_100191078 264
116 3300011119 Ga0105246_10041185 Ga0105246_100411852 264
117 3300013104 Ga0157370_10201119 Ga0157370_102011193 264
118 3300013296 Ga0157374_10038215 Ga0157374_100382153 264
119 3300013297 Ga0157378_10174951 Ga0157378_101749512 264
120 3300013307 Ga0157372_10078695 Ga0157372_100786953 264
121 3300014745 Ga0157377_10072677 Ga0157377_100726772 264
122 3300014969 Ga0157376_10021282 Ga0157376_100212823 264
123 3300025315 Ga0207697_10006061 Ga0207697_100060612 264
124 3300025315 Ga0207697_10039858 Ga0207697_100398582 264
125 3300025893 Ga0207682_10014571 Ga0207682_100145712 264
126 3300025901 Ga0207688_10029647 Ga0207688_100296473 264
127 3300025904 Ga0207647_10167386 Ga0207647_101673861 264
128 3300025907 Ga0207645_10007413 Ga0207645_100074133 264
129 3300025908 Ga0207643_10139880 Ga0207643_101398802 264
130 3300025908 Ga0207643_10212801 Ga0207643_102128011 264
131 3300025912 Ga0207707_10167504 Ga0207707_101675042 264
132 3300025912 Ga0207707_10182758 Ga0207707_101827582 264
133 3300025913 Ga0207695_10265953 Ga0207695_102659531 264
134 3300025917 Ga0207660_10044269 Ga0207660_100442692 264
135 3300025917 Ga0207660_10280908 Ga0207660_102809082 264
136 3300025919 Ga0207657_10005121 Ga0207657_100051214 264
137 3300025921 Ga0207652_10010632 Ga0207652_100106326 264
138 3300025927 Ga0207687_10235682 Ga0207687_102356822 264
139 3300025931 Ga0207644_10338601 Ga0207644_103386011 264
140 3300025933 Ga0207706_10003315 Ga0207706_100033157 264
141 3300025933 Ga0207706_10076531 Ga0207706_100765312 264
142 3300025934 Ga0207686_10228301 Ga0207686_102283012 264
143 3300025935 Ga0207709_10399728 Ga0207709_103997281 264
144 3300025938 Ga0207704_10150896 Ga0207704_101508962 264
145 3300025940 Ga0207691_10019662 Ga0207691_100196623 264
146 3300025945 Ga0207679_10175234 Ga0207679_101752342 264
147 3300025960 Ga0207651_10233255 Ga0207651_102332552 264
148 3300025972 Ga0207668_10335957 Ga0207668_103359571 264
149 3300026067 Ga0207678_10068499 Ga0207678_100684991 264
150 3300026095 Ga0207676_10451941 Ga0207676_104519412 264
151 3300026118 Ga0207675_100648423 Ga0207675_1006484231 264
152 3300026121 Ga0207683_10022903 Ga0207683_100229033 264
153 3300027395 Ga0209996_1014746 Ga0209996_10147461 264
154 3300027543 Ga0209999_1021263 Ga0209999_10212631 264
155 3300027552 Ga0209982_1002051 Ga0209982_10020512 264
156 3300027614 Ga0209970_1010536 Ga0209970_10105362 264
157 3300027617 Ga0210002_1005982 Ga0210002_10059822 264
158 3300027682 Ga0209971_1002296 Ga0209971_10022963 264
159 3300027682 Ga0209971_1046869 Ga0209971_10468691 264
160 3300027717 Ga0209998_10023889 Ga0209998_100238891 264
161 3300027876 Ga0209974_10005107 Ga0209974_100051072 264
162 3300027876 Ga0209974_10005308 Ga0209974_100053081 264
163 3300027907 Ga0207428_10259361 Ga0207428_102593612 264
164 3300031548 Ga0307408_100330513 Ga0307408_1003305132 264
165 3300031852 Ga0307410_10087842 Ga0307410_100878422 264
166 3300031901 Ga0307406_10147946 Ga0307406_101479461 264
167 3300031903 Ga0307407_10122539 Ga0307407_101225392 264
168 3300032002 Ga0307416_100225417 Ga0307416_1002254172 264
169 3300032004 Ga0307414_10022497 Ga0307414_100224974 264
170 3300032004 Ga0307414_10076764 Ga0307414_100767642 264
171 3300035116 Ga0373945_0049552 Ga0373945_0049552_332_1126 264
172 3300035170 Ga0373943_0069945 Ga0373943_0069945_606_1400 264
173 3300035725 Ga0373947_0021370 Ga0373947_0021370_1569_2363 264
174 3300036401 Ga0373937_0228588 Ga0373937_0228588_20_817 264
175 3300037068 Ga0373925_0067183 Ga0373925_0067183_747_1541 264
176 3300044673 Ga0453683_0000171 Ga0453683_0000171_37025_37819 264
177 3300045051 Ga0451576_0306134 Ga0451576_0306134_150_944 264
178 3300048907 Ga0496104_0126164 Ga0496104_0126164_570_1364 264
179 3300048909 Ga0496106_0226632 Ga0496106_0226632_204_998 264
180 3300048915 Ga0496112_0075801 Ga0496112_0075801_2004_2798 264
181 3300049568 Ga0501031_0015985 Ga0501031_0015985_3095_3889 264
182 3300049569 Ga0501032_0028409 Ga0501032_0028409_1620_2414 264
183 3300049570 Ga0501033_0016819 Ga0501033_0016819_4024_4818 264
184 3300049573 Ga0501037_0008424 Ga0501037_0008424_6569_7363 264
185 3300049574 Ga0501038_0481082 Ga0501038_0481082_50_844 264
186 3300049576 Ga0501040_0019670 Ga0501040_0019670_3175_3969 264
187 3300049578 Ga0501042_0154967 Ga0501042_0154967_397_1191 264
188 3300049580 Ga0501046_0092266 Ga0501046_0092266_256_1050 264
189 3300049580 Ga0501046_0285875 Ga0501046_0285875_67_861 264
190 3300049582 Ga0501048_0320853 Ga0501048_0320853_72_866 264
191 3300049586 Ga0501070_0019442 Ga0501070_0019442_821_1615 264
192 3300049588 Ga0501072_0228771 Ga0501072_0228771_525_1319 264
193 3300049588 Ga0501072_0282288 Ga0501072_0282288_149_943 264
194 3300049589 Ga0501073_0015779 Ga0501073_0015779_635_1429 264
195 3300049590 Ga0501074_0009829 Ga0501074_0009829_5137_5931 264
196 3300049591 Ga0501075_0245898 Ga0501075_0245898_108_902 264
197 3300049592 Ga0501076_0089720 Ga0501076_0089720_462_1256 264
198 3300049742 Ga0501080_0078757 Ga0501080_0078757_803_1597 264
199 3300049743 Ga0501081_0322529 Ga0501081_0322529_108_902 264
200 3300049744 Ga0501083_0050872 Ga0501083_0050872_1532_2326 264
201 3300049824 Ga0501045_0136789 Ga0501045_0136789_397_1191 264
202 3300050507 nmdc:mga05p37_13428_c1 nmdc:mga05p37_13428_c1_710_1504 264
203 3300050507 nmdc:mga05p37_2960_c1 nmdc:mga05p37_2960_c1_6101_6895 264
204 3300050507 nmdc:mga05p37_417085_c1 nmdc:mga05p37_417085_c1_426_1220 264
205 3300050507 nmdc:mga05p37_58322_c1 nmdc:mga05p37_58322_c1_657_1451 264
206 3300050507 nmdc:mga05p37_73632_c1 nmdc:mga05p37_73632_c1_358_1152 264
207 3300050508 nmdc:mga09592_660037_c1 nmdc:mga09592_660037_c1_81_875 264
208 3300050509 nmdc:mga0qj67_163631_c1 nmdc:mga0qj67_163631_c1_435_1229 264
209 3300050510 nmdc:mga06r32_276311_c1 nmdc:mga06r32_276311_c1_726_1520 264
210 3300050510 nmdc:mga06r32_611856_c1 nmdc:mga06r32_611856_c1_218_1012 264
211 3300050511 nmdc:mga08y16_167407_c1 nmdc:mga08y16_167407_c1_1450_2244 264
212 3300050511 nmdc:mga08y16_82352_c1 nmdc:mga08y16_82352_c1_655_1449 264
213 3300050512 nmdc:mga0n895_148873_c1 nmdc:mga0n895_148873_c1_427_1224 264
214 3300050512 nmdc:mga0n895_274466_c1 nmdc:mga0n895_274466_c1_784_1578 264
215 3300050512 nmdc:mga0n895_290_c1 nmdc:mga0n895_290_c1_13899_14693 264
216 3300050512 nmdc:mga0n895_349539_c1 nmdc:mga0n895_349539_c1_577_1371 264
217 3300050512 nmdc:mga0n895_46568_c1 nmdc:mga0n895_46568_c1_2027_2821 264
218 3300050512 nmdc:mga0n895_593501_c1 nmdc:mga0n895_593501_c1_16_810 264
219 3300050513 nmdc:mga0rr50_22172_c1 nmdc:mga0rr50_22172_c1_3204_3998 264
220 3300050513 nmdc:mga0rr50_83010_c1 nmdc:mga0rr50_83010_c1_936_1730 264
221 3300050514 nmdc:mga08x19_312981_c1 nmdc:mga08x19_312981_c1_221_1015 264
222 3300050514 nmdc:mga08x19_31645_c1 nmdc:mga08x19_31645_c1_1653_2447 264
223 3300050514 nmdc:mga08x19_3680_c1 nmdc:mga08x19_3680_c1_2834_3628 264
224 3300050515 nmdc:mga0a205_1404_c2 nmdc:mga0a205_1404_c2_4426_5220 264
225 3300050515 nmdc:mga0a205_37593_c1 nmdc:mga0a205_37593_c1_1240_2034 264
226 3300050515 nmdc:mga0a205_503448_c1 nmdc:mga0a205_503448_c1_155_949 264
227 3300054114 Ga0501084_0229333 Ga0501084_0229333_166_960 264
228 3300060353 Ga0501082_0023262 Ga0501082_0023262_3532_4326 264
229 3300005468 Ga0070707_100284715 Ga0070707_1002847152 265
230 3300005518 Ga0070699_100304964 Ga0070699_1003049641 265
231 3300005937 Ga0081455_10005623 Ga0081455_100056236 265
232 3300006846 Ga0075430_100058120 Ga0075430_1000581202 265
233 3300006852 Ga0075433_10029340 Ga0075433_100293403 265
234 3300006871 Ga0075434_100020157 Ga0075434_1000201573 265
235 3300007076 Ga0075435_100017021 Ga0075435_1000170213 265
236 3300046472 Ga0495580_0002009 Ga0495580_0002009_7755_8552 265
237 3300046473 Ga0495582_0171375 Ga0495582_0171375_412_1209 265
238 3300049593 Ga0501077_0045317 Ga0501077_0045317_380_1177 265
239 3300050512 nmdc:mga0n895_14155_c1 nmdc:mga0n895_14155_c1_5048_5845 265
240 3300050513 nmdc:mga0rr50_421098_c1 nmdc:mga0rr50_421098_c1_13_810 265
241 3300050514 nmdc:mga08x19_107153_c1 nmdc:mga08x19_107153_c1_68_865 265
242 3300050515 nmdc:mga0a205_518_c1 nmdc:mga0a205_518_c1_23820_24617 265
243 3300061734 Ga0530510_0024495 Ga0530510_0024495_23_820 265
244 3300009147 Ga0114129_10073800 Ga0114129_100738004 266
245 3300013297 Ga0157378_10249249 Ga0157378_102492492 266
246 3300013306 Ga0163162_11052772 Ga0163162_110527721 266
247 3300044712 Ga0453684_0177538 Ga0453684_0177538_1154_1954 266
248 3300045051 Ga0451576_0527550 Ga0451576_0527550_55_855 266
249 3300048914 Ga0496111_0204864 Ga0496111_0204864_179_979 266
250 3300050512 nmdc:mga0n895_3747_c1 nmdc:mga0n895_3747_c1_8884_9684 266
251 3300050513 nmdc:mga0rr50_33068_c1 nmdc:mga0rr50_33068_c1_2540_3340 266
252 3300050514 nmdc:mga08x19_47479_c1 nmdc:mga08x19_47479_c1_58_858 266
253 3300006058 Ga0075432_10017699 Ga0075432_100176993 276
254 3300009094 Ga0111539_10125743 Ga0111539_101257434 276
255 3300049570 Ga0501033_0105784 Ga0501033_0105784_336_1172 276
256 3300049572 Ga0501036_0011521 Ga0501036_0011521_4106_4942 276
257 3300049574 Ga0501038_0002952 Ga0501038_0002952_13399_14235 276
258 3300049575 Ga0501039_0009103 Ga0501039_0009103_5596_6432 276
259 3300049576 Ga0501040_0001185 Ga0501040_0001185_15366_16202 276
260 3300049577 Ga0501041_0000019 Ga0501041_0000019_20964_21800 276
261 3300049578 Ga0501042_0009848 Ga0501042_0009848_2925_3761 276
262 3300049579 Ga0501043_0033260 Ga0501043_0033260_867_1703 276
263 3300049580 Ga0501046_0001816 Ga0501046_0001816_14766_15602 276
264 3300049582 Ga0501048_0005670 Ga0501048_0005670_2705_3541 276
265 3300049584 Ga0501068_0032903 Ga0501068_0032903_34_870 276
266 3300049587 Ga0501071_0001052 Ga0501071_0001052_3758_4594 276
267 3300049588 Ga0501072_0000142 Ga0501072_0000142_44106_44942 276
268 3300049590 Ga0501074_0040481 Ga0501074_0040481_368_1204 276
269 3300049591 Ga0501075_0000028 Ga0501075_0000028_31123_31959 276
270 3300049592 Ga0501076_0000069 Ga0501076_0000069_12532_13368 276
271 3300049593 Ga0501077_0000042 Ga0501077_0000042_37251_38087 276
272 3300049741 Ga0501079_0000343 Ga0501079_0000343_19983_20819 276
273 3300049742 Ga0501080_0006365 Ga0501080_0006365_6167_7003 276
274 3300049743 Ga0501081_0000056 Ga0501081_0000056_13127_13963 276
275 3300049744 Ga0501083_0005670 Ga0501083_0005670_1868_2704 276
276 3300049824 Ga0501045_0000636 Ga0501045_0000636_20862_21698 276
277 3300054114 Ga0501084_0000316 Ga0501084_0000316_3626_4462 276
278 3300060353 Ga0501082_0011162 Ga0501082_0011162_5569_6405 276
279 3300061734 Ga0530510_0000906 Ga0530510_0000906_4273_5109 276
280 3300006844 Ga0075428_100138170 Ga0075428_1001381701 277
281 3300042436 Ga0439435_0022665 Ga0439435_0022665_593_1447 278
282 3300050509 nmdc:mga0qj67_50495_c1 nmdc:mga0qj67_50495_c1_1797_2651 278
283 3300005468 Ga0070707_100248026 Ga0070707_1002480261 280
284 3300025922 Ga0207646_10239444 Ga0207646_102394441 280
285 3300003911 JGI25405J52794_10003844 JGI25405J52794_100038442 282
286 3300005295 Ga0065707_10001446 Ga0065707_100014467 282
287 3300046537 Ga0495598_0024778 Ga0495598_0024778_737_1591 282
288 3300050508 nmdc:mga09592_66560_c1 nmdc:mga09592_66560_c1_1197_2081 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

49

203

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ihy-assembly1.cif.gz_A structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.9431 23 282
2ihy-assembly1.cif.gz_A structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.9358 23 282
4hzi-assembly1.cif.gz_B crystal structure of the leptospira interrogans atpase subunit of an orphan abc transporter 0.9175 23 282
2ihy-assembly1.cif.gz_B structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.9154 22 282
4hzi-assembly1.cif.gz_A crystal structure of the leptospira interrogans atpase subunit of an orphan abc transporter 0.9105 23 282
ID Description Score Start End Superfamily
af_Q2FWA1_1_260_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9364 25 281 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9334 23 250 3.40.50.300
af_I6YF11_12_276_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9229 19 280 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9212 23 250 3.40.50.300
af_Q2FWA1_1_260_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9191 25 281 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5E4HLC7-F1-model_v4 Putative branched-chain amino acid transport ATP-binding protein LivG 0.9521 18 282 GO:0005524
GO:0016887
AF-A0A0C1UA48-F1-model_v4 ABC transporter domain-containing protein 0.9437 18 282 GO:0005524
GO:0016887
AF-A0A5E4HLC7-F1-model_v4 Putative branched-chain amino acid transport ATP-binding protein LivG 0.9382 18 282 GO:0005524
GO:0016887
AF-A0A1E3L1L0-F1-model_v4 Iron-chelate-transporting ATPase (EC 3.6.3.34) 0.9361 25 282 GO:0005524
GO:0016887
AF-A0A0C1UA48-F1-model_v4 ABC transporter domain-containing protein 0.9334 18 282 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
83.62 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map