F388240

General Info

Members Datasets Scaffolds Average Seq Length
287 143 574 390

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0041189|Ga0501037_0041189_226_1557
Length 443
Sequence VPDDAAGHRAGRGATRPGAGGDRDLDGACSVPGAGREPDPCDEEYDVTQTKPPSPPQAVDETQFAALKAEVAAYVAGPAERWAERIERDGDVPDEVFAQLRDRGYLSLAAPVEYGGRGVPFSRYLELMELFSMSHASIRMIVHVVNGIWRAIDQFATDEQRKRFVLPVIAGERKAAFTLTEPTAGTGADLRCSVTREGDTYVLSGEKHLITFGVTCDWWLLFARLAGTTGKDGTVALMVDRDAAGVTVEEMAETMGVHGTDHAHLTFDRTPVPVGNRLGEEGRGLEVALGGFLQPSRISVAMSCVGLARRAHELAMAHALRRETFGKKLVQRQAISFAIAENAADIEAARALTLHAAREWEAGSPASAVLSSASKLTAVDMLTRVTDRALQIHGGIGYWSTSPIERVYRDARAQRFEEGTNEIQKTVIAREVLREFAAREERP

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
11 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
15 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
16 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
17 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
20 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
21 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
22 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
23 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
24 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
25 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
26 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
45 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
50 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
53 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
54 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
62 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
63 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
64 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
65 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
66 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
72 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
79 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
82 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
83 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
84 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
85 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
86 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
87 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
88 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
89 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
90 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
91 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
92 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
93 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
94 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
124 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
125 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
126 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
127 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
128 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
129 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
130 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
131 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
132 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
133 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
134 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
135 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
136 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
137 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
138 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
139 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
140 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
141 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
142 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
143 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.33
Metatranscriptomes 1.05
Isolates 6.62

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 2.09
Rhizosphere 77.35
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0041189 3300049573 Bacteria 3397
2 Ga0055541_1006157 3300003841 Bacteria 2054
3 Ga0070658_10013820 3300005327 Bacteria 6477
4 Ga0070667_100001178 3300005367 Bacteria 23784
5 Ga0070663_100001326 3300005455 Bacteria 13540
6 Ga0070681_10033228 3300005458 Bacteria 5179
7 Ga0070679_100001725 3300005530 Bacteria 19711
8 Ga0070679_100019199 3300005530 Bacteria 6644
9 Ga0070665_100019460 3300005548 Bacteria 6813
10 Ga0070665_100252389 3300005548 Bacteria 1765
11 Ga0068855_100084901 3300005563 Bacteria 3664
12 Ga0068854_100169886 3300005578 Bacteria 1696
13 Ga0068862_100000590 3300005844 Bacteria 37737
14 Ga0081455_10009592 3300005937 Bacteria 9942
15 Ga0081455_10024322 3300005937 Bacteria 5610
16 Ga0105240_10188222 3300009093 Bacteria 2429
17 Ga0105241_10003439 3300009174 Bacteria 11780
18 Ga0105237_10072660 3300009545 Bacteria 3433
19 Ga0105237_10406722 3300009545 Bacteria 1366
20 Ga0105238_10003527 3300009551 Bacteria 15590
21 Ga0105249_10003156 3300009553 Bacteria 14256
22 Ga0157369_10070294 3300013105 Bacteria 3761
23 Ga0157374_10293462 3300013296 Bacteria 1608
24 Ga0157372_10073655 3300013307 Bacteria 3850
25 Ga0157372_10215426 3300013307 Bacteria 2226
26 Ga0157379_10031735 3300014968 Bacteria 4706
27 Ga0157376_10008158 3300014969 Bacteria 7533
28 Ga0213874_10000027 3300021377 Bacteria 18931
29 Ga0213876_10000709 3300021384 Bacteria 23391
30 Ga0213876_10008047 3300021384 Bacteria 5714
31 Ga0213876_10043270 3300021384 Bacteria 2380
32 Ga0213875_10000001 3300021388 Bacteria 2793540
33 Ga0213875_10000131 3300021388 Bacteria 83001
34 Ga0213875_10014975 3300021388 Bacteria 3777
35 Ga0224712_10000410 3300022467 Bacteria 8451
36 Ga0209566_100135 3300025225 Bacteria 91038
37 Ga0209566_101576 3300025225 Bacteria 6089
38 Ga0207647_10009129 3300025904 Bacteria 7056
39 Ga0207654_10080670 3300025911 Bacteria 1957
40 Ga0207707_10041071 3300025912 Bacteria 4039
41 Ga0207695_10146620 3300025913 Bacteria 2304
42 Ga0207671_10002442 3300025914 Bacteria 19886
43 Ga0207693_10071933 3300025915 Bacteria 2707
44 Ga0207652_10006113 3300025921 Bacteria 9736
45 Ga0207652_10030486 3300025921 Bacteria 4517
46 Ga0207694_10044985 3300025924 Bacteria 3409
47 Ga0207679_10187424 3300025945 Bacteria 1717
48 Ga0207712_10005664 3300025961 Bacteria 7880
49 Ga0207668_10014017 3300025972 Bacteria 4955
50 Ga0207640_10027247 3300025981 Bacteria 3480
51 Ga0207658_10000891 3300025986 Bacteria 24842
52 Ga0207703_10043630 3300026035 Bacteria 3600
53 Ga0207678_10003832 3300026067 Bacteria 13529
54 Ga0207678_10098402 3300026067 Bacteria 2499
55 Ga0207698_10241487 3300026142 Bacteria 1647
56 Ga0265356_1000275 3300028017 Bacteria 9613
57 Ga0268266_10094575 3300028379 Bacteria 2623
58 Ga0268266_10119851 3300028379 Bacteria 2340
59 Ga0268266_10200943 3300028379 Bacteria 1824
60 Ga0268265_10002597 3300028380 Bacteria 13464
61 Ga0307515_10017452 3300028794 Bacteria 13068
62 Ga0265338_10000157 3300028800 Bacteria 124607
63 Ga0307511_10000395 3300030521 Bacteria 46479
64 Ga0265762_1005665 3300030760 Bacteria 2242
65 Ga0265760_10008386 3300031090 Bacteria 2956
66 Ga0265329_10019816 3300031242 Bacteria 2279
67 Ga0265339_10031607 3300031249 Bacteria 2990
68 Ga0265327_10028700 3300031251 Bacteria 3176
69 Ga0265316_10010126 3300031344 Bacteria 8608
70 Ga0307513_10009151 3300031456 Bacteria 12547
71 Ga0265313_10002168 3300031595 Bacteria 17422
72 Ga0395900_0004533 3300037418 Bacteria 14700
73 Ga0395900_0016830 3300037418 Bacteria 7460
74 Ga0395900_0216816 3300037418 Bacteria 1931
75 Ga0395898_0000954 3300037466 Bacteria 46097
76 Ga0436364_0215960 3300037853 Bacteria 11975
77 Ga0436364_0273345 3300037853 Bacteria 2794207
78 Ga0436364_0279393 3300037853 Bacteria 4397
79 Ga0436364_0385398 3300037853 Bacteria 10919
80 Ga0436364_0692400 3300037853 Bacteria 3155
81 Ga0436364_0746030 3300037853 Bacteria 86955
82 Ga0436364_1181412 3300037853 Bacteria 2989
83 Ga0436364_1251705 3300037853 Bacteria 7423
84 Ga0436364_1339555 3300037853 Bacteria 2818
85 Ga0436364_1506729 3300037853 Bacteria 1303
86 Ga0436365_0077622 3300039437 Bacteria 1563
87 Ga0436365_0233978 3300039437 Bacteria 10809
88 Ga0436365_0246939 3300039437 Bacteria 31160
89 Ga0436365_0413562 3300039437 Bacteria 11578
90 Ga0436365_0419811 3300039437 Bacteria 53262
91 Ga0436365_1314777 3300039437 Bacteria 6294
92 Ga0436365_1686713 3300039437 Bacteria 7949
93 Ga0436360_1074242 3300039438 Unclassified 1381
94 Ga0436361_0586454 3300039447 Bacteria 1584
95 Ga0436363_0032621 3300039450 Bacteria 48468
96 Ga0436363_0552147 3300039450 Bacteria 30451
97 Ga0436363_1586986 3300039450 Bacteria 7076
98 Ga0436362_0294786 3300039453 Bacteria 2598
99 Ga0436362_0322319 3300039453 Bacteria 1861
100 Ga0436362_0354154 3300039453 Bacteria 2321
101 Ga0436362_0451799 3300039453 Bacteria 1944
102 Ga0436362_0887572 3300039453 Bacteria 2499
103 Ga0436362_1061721 3300039453 Bacteria 17012
104 Ga0466969_0006703 3300044656 Bacteria 6124
105 Ga0466969_0015633 3300044656 Bacteria 3975
106 Ga0466969_0052579 3300044656 Bacteria 2001
107 Ga0466972_0031570 3300044658 Bacteria 2604
108 Ga0466966_0006685 3300044684 Bacteria 7637
109 Ga0466966_0022308 3300044684 Bacteria 4155
110 Ga0466966_0048055 3300044684 Bacteria 2719
111 Ga0466961_0028848 3300044693 Bacteria 3568
112 Ga0466963_0012509 3300044694 Bacteria 5197
113 Ga0466963_0016848 3300044694 Bacteria 4549
114 Ga0466963_0023119 3300044694 Bacteria 3942
115 Ga0466971_0020596 3300044719 Bacteria 2933
116 Ga0466970_0017642 3300044765 Bacteria 3689
117 Ga0466970_0019282 3300044765 Bacteria 3536
118 Ga0466957_0015655 3300044842 Bacteria 4430
119 Ga0466960_0095029 3300044901 Bacteria 1526
120 Ga0466959_0000495 3300045049 Bacteria 22922
121 Ga0466959_0031522 3300045049 Bacteria 3921
122 Ga0466959_0045755 3300045049 Bacteria 3222
123 Ga0466959_0053968 3300045049 Bacteria 2937
124 Ga0466959_0160281 3300045049 Bacteria 1582
125 Ga0466958_0007208 3300045836 Bacteria 6097
126 Ga0466958_0012910 3300045836 Bacteria 4744
127 Ga0466958_0014649 3300045836 Bacteria 4477
128 Ga0466958_0030961 3300045836 Bacteria 3180
129 Ga0466958_0083108 3300045836 Bacteria 1973
130 Ga0466967_0006344 3300045976 Bacteria 8352
131 Ga0466967_0030434 3300045976 Bacteria 4530
132 Ga0466967_0032481 3300045976 Bacteria 4408
133 Ga0466967_0091866 3300045976 Bacteria 2759
134 Ga0496102_0114792 3300048905 Bacteria 2513
135 Ga0496103_0139615 3300048906 Bacteria 1549
136 Ga0496104_0044958 3300048907 Bacteria 4151
137 Ga0496105_0003886 3300048908 Bacteria 11167
138 Ga0496106_0179752 3300048909 Bacteria 1679
139 Ga0496109_0228356 3300048912 Bacteria 1751
140 Ga0496116_0001142 3300048919 Bacteria 31554
141 Ga0496117_0000620 3300048920 Bacteria 57459
142 Ga0496117_0001198 3300048920 Bacteria 39019
143 Ga0496117_0001728 3300048920 Bacteria 30208
144 Ga0496118_0001224 3300048921 Bacteria 39523
145 Ga0496118_0001317 3300048921 Bacteria 37671
146 Ga0496119_0004390 3300048922 Bacteria 14074
147 Ga0496119_0050998 3300048922 Bacteria 2546
148 Ga0496119_0075349 3300048922 Bacteria 1961
149 Ga0496120_0003987 3300048923 Bacteria 12829
150 Ga0496121_0000528 3300048924 Bacteria 72606
151 Ga0496121_0005236 3300048924 Bacteria 16782
152 Ga0496121_0076702 3300048924 Bacteria 2664
153 Ga0496121_0099453 3300048924 Bacteria 2248
154 Ga0496121_0106901 3300048924 Bacteria 2144
155 Ga0496122_0023860 3300048925 Bacteria 5372
156 Ga0496123_0061542 3300048926 Bacteria 2411
157 Ga0496124_0000639 3300048927 Bacteria 57891
158 Ga0496126_0002977 3300048929 Bacteria 21990
159 Ga0496126_0022808 3300048929 Bacteria 6079
160 Ga0496126_0162334 3300048929 Bacteria 1908
161 Ga0501031_0005147 3300049568 Bacteria 8519
162 Ga0501031_0005235 3300049568 Bacteria 8455
163 Ga0501031_0008764 3300049568 Bacteria 6579
164 Ga0501031_0071210 3300049568 Bacteria 2264
165 Ga0501032_0001495 3300049569 Bacteria 18670
166 Ga0501032_0003916 3300049569 Bacteria 11296
167 Ga0501032_0110145 3300049569 Bacteria 1822
168 Ga0501033_0000333 3300049570 Bacteria 44939
169 Ga0501033_0002122 3300049570 Bacteria 17142
170 Ga0501033_0004951 3300049570 Bacteria 10593
171 Ga0501033_0007184 3300049570 Bacteria 8691
172 Ga0501033_0045232 3300049570 Bacteria 3276
173 Ga0501033_0125900 3300049570 Bacteria 1858
174 Ga0501033_0153518 3300049570 Bacteria 1660
175 Ga0501033_0192389 3300049570 Bacteria 1459
176 Ga0501034_0006356 3300049571 Bacteria 12721
177 Ga0501034_0011016 3300049571 Bacteria 9388
178 Ga0501034_0030034 3300049571 Bacteria 5525
179 Ga0501036_0001368 3300049572 Bacteria 18700
180 Ga0501036_0013954 3300049572 Bacteria 6680
181 Ga0501037_0001738 3300049573 Bacteria 15807
182 Ga0501037_0001917 3300049573 Bacteria 15086
183 Ga0501037_0009838 3300049573 Bacteria 7018
184 Ga0501037_0048200 3300049573 Bacteria 3122
185 Ga0501037_0054739 3300049573 Bacteria 2917
186 Ga0501038_0002807 3300049574 Bacteria 16223
187 Ga0501038_0005912 3300049574 Bacteria 11309
188 Ga0501038_0022784 3300049574 Bacteria 5606
189 Ga0501039_0015233 3300049575 Bacteria 5884
190 Ga0501039_0019680 3300049575 Bacteria 5176
191 Ga0501039_0030314 3300049575 Bacteria 4170
192 Ga0501040_0140281 3300049576 Bacteria 1702
193 Ga0501042_0015121 3300049578 Bacteria 5276
194 Ga0501042_0086102 3300049578 Bacteria 2253
195 Ga0501043_0005953 3300049579 Bacteria 9807
196 Ga0501043_0007768 3300049579 Bacteria 8486
197 Ga0501043_0127171 3300049579 Bacteria 1998
198 Ga0501043_0150304 3300049579 Bacteria 1822
199 Ga0501046_0001940 3300049580 Bacteria 19632
200 Ga0501046_0008827 3300049580 Bacteria 8755
201 Ga0501046_0013426 3300049580 Bacteria 6934
202 Ga0501046_0014369 3300049580 Bacteria 6684
203 Ga0501046_0015416 3300049580 Bacteria 6421
204 Ga0501046_0016694 3300049580 Bacteria 6141
205 Ga0501047_0002125 3300049581 Bacteria 18972
206 Ga0501047_0003240 3300049581 Bacteria 15436
207 Ga0501047_0004179 3300049581 Bacteria 13588
208 Ga0501047_0080609 3300049581 Bacteria 3128
209 Ga0501047_0093530 3300049581 Bacteria 2885
210 Ga0501047_0104174 3300049581 Bacteria 2717
211 Ga0501047_0185814 3300049581 Bacteria 1943
212 Ga0501047_0231890 3300049581 Bacteria 1699
213 Ga0501048_0002347 3300049582 Bacteria 14452
214 Ga0501048_0006824 3300049582 Bacteria 8673
215 Ga0501048_0007172 3300049582 Bacteria 8465
216 Ga0501067_0003257 3300049583 Bacteria 8942
217 Ga0501067_0013495 3300049583 Bacteria 4527
218 Ga0501068_0015642 3300049584 Bacteria 4361
219 Ga0501068_0042136 3300049584 Bacteria 2745
220 Ga0501069_0004188 3300049585 Bacteria 7457
221 Ga0501069_0005899 3300049585 Bacteria 6381
222 Ga0501069_0006650 3300049585 Bacteria 6051
223 Ga0501069_0030111 3300049585 Bacteria 2980
224 Ga0501070_0000797 3300049586 Bacteria 28587
225 Ga0501070_0001792 3300049586 Bacteria 18953
226 Ga0501070_0010581 3300049586 Bacteria 7797
227 Ga0501070_0037614 3300049586 Bacteria 4040
228 Ga0501071_0135309 3300049587 Bacteria 1833
229 Ga0501072_0077062 3300049588 Bacteria 2639
230 Ga0501073_0004701 3300049589 Bacteria 10255
231 Ga0501073_0008618 3300049589 Bacteria 7556
232 Ga0501073_0038011 3300049589 Bacteria 3416
233 Ga0501073_0038336 3300049589 Bacteria 3400
234 Ga0501074_0025527 3300049590 Bacteria 4290
235 Ga0501074_0042652 3300049590 Bacteria 3282
236 Ga0501079_0017156 3300049741 Bacteria 5529
237 Ga0501080_0001617 3300049742 Bacteria 19146
238 Ga0501080_0097662 3300049742 Bacteria 2727
239 Ga0501080_0098504 3300049742 Bacteria 2713
240 Ga0501083_0000067 3300049744 Bacteria 71321
241 Ga0501083_0006197 3300049744 Bacteria 8485
242 Ga0501083_0018806 3300049744 Bacteria 4811
243 Ga0501083_0023033 3300049744 Bacteria 4322
244 Ga0501035_0000252 3300049822 Bacteria 64415
245 Ga0501035_0003447 3300049822 Bacteria 15136
246 Ga0501035_0042556 3300049822 Bacteria 4096
247 Ga0501035_0049811 3300049822 Bacteria 3754
248 Ga0501035_0101855 3300049822 Bacteria 2519
249 Ga0501035_0102019 3300049822 Bacteria 2517
250 Ga0501035_0236405 3300049822 Bacteria 1555
251 Ga0501044_0000168 3300049823 Bacteria 80703
252 Ga0501044_0004272 3300049823 Bacteria 16027
253 Ga0501044_0007098 3300049823 Bacteria 12326
254 Ga0501044_0038929 3300049823 Bacteria 4964
255 Ga0501044_0055674 3300049823 Bacteria 4061
256 Ga0501044_0068374 3300049823 Bacteria 3618
257 Ga0501044_0077164 3300049823 Bacteria 3379
258 Ga0501044_0105117 3300049823 Bacteria 2836
259 Ga0501044_0182492 3300049823 Bacteria 2064
260 Ga0501044_0273510 3300049823 Bacteria 1624
261 Ga0501045_0016395 3300049824 Bacteria 5260
262 Ga0501045_0017569 3300049824 Bacteria 5079
263 Ga0500616_0000968 3300053153 Bacteria 31105
264 Ga0501084_0010365 3300054114 Bacteria 7712
265 Ga0501082_0029845 3300060353 Bacteria 4697
266 Ga0501082_0064900 3300060353 Bacteria 3144
267 Ga0501082_0071977 3300060353 Bacteria 2978
268 Ga0466962_0018069 3300061719 Bacteria 3392
269 2644182169 2643221632 Bacteria 3406696
270 2753302434 2751185788 Bacteria 4541048
271 2786674825 2786546132 Bacteria 10419719
272 2883821907 2883821847 Bacteria 5121194
273 2919045587 2919042368 Bacteria 3905917
274 2928108241 2928104781 Bacteria 3877447
275 2954680577 2954673503 Bacteria 9685905
276 2954683576 2954682443 Bacteria 9862841
277 2954712976 2954711539 Bacteria 10867210
278 2954722935 2954721474 Bacteria 10456478
279 2954738895 2954731030 Bacteria 10243860
280 2954741844 2954740390 Bacteria 10229294
281 2954757752 2954749733 Bacteria 10366972
282 2954760823 2954759201 Bacteria 9358192
283 2984554599 2984551494 Bacteria 3877562
284 2997452115 2997451912 Bacteria 8492419
285 8004024513 8004021418 Bacteria 4313954
286 8004025993 8004025490 Bacteria 4327753
287 8057348102 8057345674 Bacteria 4160394
288 Ga0501037_0041189
289 Ga0055541_1006157
290 Ga0070658_10013820
291 Ga0070667_100001178
292 Ga0070663_100001326
293 Ga0070681_10033228
294 Ga0070679_100001725
295 Ga0070679_100019199
296 Ga0070665_100019460
297 Ga0070665_100252389
298 Ga0068855_100084901
299 Ga0068854_100169886
300 Ga0068862_100000590
301 Ga0081455_10009592
302 Ga0081455_10024322
303 Ga0105240_10188222
304 Ga0105241_10003439
305 Ga0105237_10072660
306 Ga0105237_10406722
307 Ga0105238_10003527
308 Ga0105249_10003156
309 Ga0157369_10070294
310 Ga0157374_10293462
311 Ga0157372_10073655
312 Ga0157372_10215426
313 Ga0157379_10031735
314 Ga0157376_10008158
315 Ga0213874_10000027
316 Ga0213876_10000709
317 Ga0213876_10008047
318 Ga0213876_10043270
319 Ga0213875_10000001
320 Ga0213875_10000131
321 Ga0213875_10014975
322 Ga0224712_10000410
323 Ga0209566_100135
324 Ga0209566_101576
325 Ga0207647_10009129
326 Ga0207654_10080670
327 Ga0207707_10041071
328 Ga0207695_10146620
329 Ga0207671_10002442
330 Ga0207693_10071933
331 Ga0207652_10006113
332 Ga0207652_10030486
333 Ga0207694_10044985
334 Ga0207679_10187424
335 Ga0207712_10005664
336 Ga0207668_10014017
337 Ga0207640_10027247
338 Ga0207658_10000891
339 Ga0207703_10043630
340 Ga0207678_10003832
341 Ga0207678_10098402
342 Ga0207698_10241487
343 Ga0265356_1000275
344 Ga0268266_10094575
345 Ga0268266_10119851
346 Ga0268266_10200943
347 Ga0268265_10002597
348 Ga0307515_10017452
349 Ga0265338_10000157
350 Ga0307511_10000395
351 Ga0265762_1005665
352 Ga0265760_10008386
353 Ga0265329_10019816
354 Ga0265339_10031607
355 Ga0265327_10028700
356 Ga0265316_10010126
357 Ga0307513_10009151
358 Ga0265313_10002168
359 Ga0395900_0004533
360 Ga0395900_0016830
361 Ga0395900_0216816
362 Ga0395898_0000954
363 Ga0436364_0215960
364 Ga0436364_0273345
365 Ga0436364_0279393
366 Ga0436364_0385398
367 Ga0436364_0692400
368 Ga0436364_0746030
369 Ga0436364_1181412
370 Ga0436364_1251705
371 Ga0436364_1339555
372 Ga0436364_1506729
373 Ga0436365_0077622
374 Ga0436365_0233978
375 Ga0436365_0246939
376 Ga0436365_0413562
377 Ga0436365_0419811
378 Ga0436365_1314777
379 Ga0436365_1686713
380 Ga0436360_1074242
381 Ga0436361_0586454
382 Ga0436363_0032621
383 Ga0436363_0552147
384 Ga0436363_1586986
385 Ga0436362_0294786
386 Ga0436362_0322319
387 Ga0436362_0354154
388 Ga0436362_0451799
389 Ga0436362_0887572
390 Ga0436362_1061721
391 Ga0466969_0006703
392 Ga0466969_0015633
393 Ga0466969_0052579
394 Ga0466972_0031570
395 Ga0466966_0006685
396 Ga0466966_0022308
397 Ga0466966_0048055
398 Ga0466961_0028848
399 Ga0466963_0012509
400 Ga0466963_0016848
401 Ga0466963_0023119
402 Ga0466971_0020596
403 Ga0466970_0017642
404 Ga0466970_0019282
405 Ga0466957_0015655
406 Ga0466960_0095029
407 Ga0466959_0000495
408 Ga0466959_0031522
409 Ga0466959_0045755
410 Ga0466959_0053968
411 Ga0466959_0160281
412 Ga0466958_0007208
413 Ga0466958_0012910
414 Ga0466958_0014649
415 Ga0466958_0030961
416 Ga0466958_0083108
417 Ga0466967_0006344
418 Ga0466967_0030434
419 Ga0466967_0032481
420 Ga0466967_0091866
421 Ga0496102_0114792
422 Ga0496103_0139615
423 Ga0496104_0044958
424 Ga0496105_0003886
425 Ga0496106_0179752
426 Ga0496109_0228356
427 Ga0496116_0001142
428 Ga0496117_0000620
429 Ga0496117_0001198
430 Ga0496117_0001728
431 Ga0496118_0001224
432 Ga0496118_0001317
433 Ga0496119_0004390
434 Ga0496119_0050998
435 Ga0496119_0075349
436 Ga0496120_0003987
437 Ga0496121_0000528
438 Ga0496121_0005236
439 Ga0496121_0076702
440 Ga0496121_0099453
441 Ga0496121_0106901
442 Ga0496122_0023860
443 Ga0496123_0061542
444 Ga0496124_0000639
445 Ga0496126_0002977
446 Ga0496126_0022808
447 Ga0496126_0162334
448 Ga0501031_0005147
449 Ga0501031_0005235
450 Ga0501031_0008764
451 Ga0501031_0071210
452 Ga0501032_0001495
453 Ga0501032_0003916
454 Ga0501032_0110145
455 Ga0501033_0000333
456 Ga0501033_0002122
457 Ga0501033_0004951
458 Ga0501033_0007184
459 Ga0501033_0045232
460 Ga0501033_0125900
461 Ga0501033_0153518
462 Ga0501033_0192389
463 Ga0501034_0006356
464 Ga0501034_0011016
465 Ga0501034_0030034
466 Ga0501036_0001368
467 Ga0501036_0013954
468 Ga0501037_0001738
469 Ga0501037_0001917
470 Ga0501037_0009838
471 Ga0501037_0048200
472 Ga0501037_0054739
473 Ga0501038_0002807
474 Ga0501038_0005912
475 Ga0501038_0022784
476 Ga0501039_0015233
477 Ga0501039_0019680
478 Ga0501039_0030314
479 Ga0501040_0140281
480 Ga0501042_0015121
481 Ga0501042_0086102
482 Ga0501043_0005953
483 Ga0501043_0007768
484 Ga0501043_0127171
485 Ga0501043_0150304
486 Ga0501046_0001940
487 Ga0501046_0008827
488 Ga0501046_0013426
489 Ga0501046_0014369
490 Ga0501046_0015416
491 Ga0501046_0016694
492 Ga0501047_0002125
493 Ga0501047_0003240
494 Ga0501047_0004179
495 Ga0501047_0080609
496 Ga0501047_0093530
497 Ga0501047_0104174
498 Ga0501047_0185814
499 Ga0501047_0231890
500 Ga0501048_0002347
501 Ga0501048_0006824
502 Ga0501048_0007172
503 Ga0501067_0003257
504 Ga0501067_0013495
505 Ga0501068_0015642
506 Ga0501068_0042136
507 Ga0501069_0004188
508 Ga0501069_0005899
509 Ga0501069_0006650
510 Ga0501069_0030111
511 Ga0501070_0000797
512 Ga0501070_0001792
513 Ga0501070_0010581
514 Ga0501070_0037614
515 Ga0501071_0135309
516 Ga0501072_0077062
517 Ga0501073_0004701
518 Ga0501073_0008618
519 Ga0501073_0038011
520 Ga0501073_0038336
521 Ga0501074_0025527
522 Ga0501074_0042652
523 Ga0501079_0017156
524 Ga0501080_0001617
525 Ga0501080_0097662
526 Ga0501080_0098504
527 Ga0501083_0000067
528 Ga0501083_0006197
529 Ga0501083_0018806
530 Ga0501083_0023033
531 Ga0501035_0000252
532 Ga0501035_0003447
533 Ga0501035_0042556
534 Ga0501035_0049811
535 Ga0501035_0101855
536 Ga0501035_0102019
537 Ga0501035_0236405
538 Ga0501044_0000168
539 Ga0501044_0004272
540 Ga0501044_0007098
541 Ga0501044_0038929
542 Ga0501044_0055674
543 Ga0501044_0068374
544 Ga0501044_0077164
545 Ga0501044_0105117
546 Ga0501044_0182492
547 Ga0501044_0273510
548 Ga0501045_0016395
549 Ga0501045_0017569
550 Ga0500616_0000968
551 Ga0501084_0010365
552 Ga0501082_0029845
553 Ga0501082_0064900
554 Ga0501082_0071977
555 Ga0466962_0018069
556 2644182169
557 2753302434
558 2786674825
559 2883821907
560 2919045587
561 2928108241
562 2954680577
563 2954683576
564 2954712976
565 2954722935
566 2954738895
567 2954741844
568 2954757752
569 2954760823
570 2984554599
571 2997452115
572 8004024513
573 8004025993
574 8057348102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

282

433

0.97

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

61

172

0.96

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

298

422

0.93

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

176

270

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fah-assembly1.cif.gz_C molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction 0.9559 1 373
2dvl-assembly1.cif.gz_A crystal structure of project tt0160 from thermus thermophilus hb8 0.9505 1 374
3nf4-assembly1.cif.gz_B-2 crystal structure of acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to flavin adenine dinucleotide 0.9505 1 373
5lnx-assembly2.cif.gz_G crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. 0.9501 10 374
4n5f-assembly1.cif.gz_A-2 crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315 0.9499 2 372
ID Description Score Start End Superfamily
af_A0A0K3AQR2_269_362_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9622 235 319 1.20.140.10
af_O86319_234_379_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9613 235 373 1.20.140.10
3r7kD03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9606 226 373 1.20.140.10
af_Q9VSL9_273_416_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9597 235 373 1.20.140.10
1ukwB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9597 224 375 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A0P9C636-F1-model_v4 Acyl-CoA dehydrogenase 0.9732 10 376 GO:0003995
GO:0050660
AF-A0A0S9NH92-F1-model_v4 Acyl-CoA dehydrogenase 0.9634 2 376 GO:0003995
GO:0050660
AF-A0A2R7SUN5-F1-model_v4 deleted 0.9614 134 371
AF-A0A349SIQ6-F1-model_v4 Acyl-CoA dehydrogenase 0.9614 187 376 GO:0003995
AF-A0A176QGM5-F1-model_v4 Acyl-CoA dehydrogenase 0.9609 1 376 GO:0003995
GO:0050660

Map