F388233

General Info

Members Datasets Scaffolds Average Seq Length
287 154 286 397

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0016594|Ga0501031_0016594_2397_3701
Length 434
Sequence MSYLTHLECSACCRRLDPDRPWQLCPDCEQPLLAHYDLDRLGRQASVDDLDRRPPGLWRYRDLLPLRAPDQAISLGEGATPLLQVPRLAERMGVPGLLVKDEGTLPTGTFKARGAAVGTSRAVELGVRTLALPTAGNAGAAWAAYGARAGLEVVVVMPETTPSVIRRATAACGADLYLVPGSIADAGAVVRDGCRRHGWYDASTLKEPYRVEGKKTMGFELVDQLGWRLPEVIVYPTGGGVGLIGMWKGFQELRALGWLPAGSPPPRFVAAQAAGCAPVVRAFAEGAERAAAWEEPVTFAAGLRVPKPLGDALILRALRETAGTAVAVPDETIAATMELAGAAEGMVVCPEGAAALAAAAELRREGWIGEDETVAVFNTGTGLLYEDSLPGRAPRRLRAGEPLPPPGALDDQPSGVGREEPGGSGTAGNQRAWA

Samples

Sample ID Description Type Environment
1 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
151 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.7
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 1.39
Rhizosphere 97.21
Stem 0
Stem Tuber 0.35
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100003655 3300005329 Bacteria 12534
2 Ga0070683_100023019 3300005329 Bacteria 5571
3 Ga0070683_100034238 3300005329 Bacteria 4638
4 Ga0070683_100083220 3300005329 Bacteria 2997
5 Ga0070683_100184666 3300005329 Bacteria 1979
6 Ga0070670_100039310 3300005331 Bacteria 4068
7 Ga0070670_100131502 3300005331 Bacteria 2161
8 Ga0070666_10006525 3300005335 Bacteria 7166
9 Ga0070680_100008115 3300005336 Bacteria 8017
10 Ga0070680_100009208 3300005336 Bacteria 7574
11 Ga0070680_100034520 3300005336 Bacteria 4078
12 Ga0070680_100168654 3300005336 Bacteria 1841
13 Ga0070682_100049078 3300005337 Bacteria 2631
14 Ga0070660_100023409 3300005339 Bacteria 4575
15 Ga0070660_100030548 3300005339 Bacteria 4042
16 Ga0070660_100089876 3300005339 Bacteria 2420
17 Ga0070660_100125850 3300005339 Bacteria 2048
18 Ga0070660_100289080 3300005339 Bacteria 1342
19 Ga0070661_100116971 3300005344 Bacteria 1994
20 Ga0070661_100196582 3300005344 Bacteria 1540
21 Ga0070661_100256270 3300005344 Bacteria 1351
22 Ga0070668_100035846 3300005347 Bacteria 3785
23 Ga0070669_100038149 3300005353 Bacteria 3487
24 Ga0070659_100003592 3300005366 Bacteria 11036
25 Ga0070659_100006577 3300005366 Bacteria 8394
26 Ga0070659_100017826 3300005366 Bacteria 5349
27 Ga0070659_100064984 3300005366 Bacteria 2889
28 Ga0070659_100176379 3300005366 Bacteria 1752
29 Ga0070667_100028758 3300005367 Bacteria 4628
30 Ga0070667_100121277 3300005367 Bacteria 2274
31 Ga0070714_100056770 3300005435 Bacteria 3349
32 Ga0070714_100243097 3300005435 Bacteria 1662
33 Ga0070694_100013248 3300005444 Bacteria 5148
34 Ga0070662_100001023 3300005457 Bacteria 17121
35 Ga0070681_10019232 3300005458 Bacteria 6834
36 Ga0070681_10056998 3300005458 Bacteria 3887
37 Ga0070706_100000881 3300005467 Bacteria 32916
38 Ga0070706_100113489 3300005467 Bacteria 2523
39 Ga0070706_100214435 3300005467 Bacteria 1797
40 Ga0070698_100004172 3300005471 Bacteria 15875
41 Ga0070698_100059429 3300005471 Bacteria 3861
42 Ga0070699_100128953 3300005518 Bacteria 2229
43 Ga0070684_100002373 3300005535 Bacteria 13880
44 Ga0070684_100034616 3300005535 Bacteria 4319
45 Ga0068853_100002834 3300005539 Bacteria 13141
46 Ga0070696_100007519 3300005546 Bacteria 7287
47 Ga0070704_100011006 3300005549 Bacteria 5520
48 Ga0068855_100122698 3300005563 Bacteria 2973
49 Ga0068857_100005235 3300005577 Bacteria 11044
50 Ga0068857_100123294 3300005577 Bacteria 2334
51 Ga0068854_100005034 3300005578 Bacteria 8326
52 Ga0068856_100016677 3300005614 Bacteria 7114
53 Ga0068856_100024850 3300005614 Bacteria 5835
54 Ga0068856_100289966 3300005614 Bacteria 1653
55 Ga0068852_100000691 3300005616 Bacteria 22066
56 Ga0068859_100038372 3300005617 Bacteria 4806
57 Ga0068859_100119463 3300005617 Bacteria 2702
58 Ga0068858_100066237 3300005842 Bacteria 3343
59 Ga0068860_100070567 3300005843 Bacteria 3321
60 Ga0081455_10072617 3300005937 Bacteria 2848
61 Ga0097621_100245337 3300006237 Bacteria 1567
62 Ga0068871_100054175 3300006358 Bacteria 3253
63 Ga0075428_100000724 3300006844 Bacteria 34214
64 Ga0075428_100015080 3300006844 Bacteria 8584
65 Ga0075428_100020889 3300006844 Bacteria 7250
66 Ga0075428_100244538 3300006844 Unclassified 1935
67 Ga0075430_100000005 3300006846 Bacteria 108528
68 Ga0075430_100050368 3300006846 Bacteria 3512
69 Ga0075431_100000188 3300006847 Bacteria 44797
70 Ga0075431_100083321 3300006847 Bacteria 3301
71 Ga0075431_100097697 3300006847 Bacteria 3033
72 Ga0075433_10086072 3300006852 Bacteria 2775
73 Ga0075429_100000077 3300006880 Bacteria 49812
74 Ga0097620_100038372 3300006931 Bacteria 4806
75 Ga0097620_100119476 3300006931 Bacteria 2702
76 Ga0105240_10005422 3300009093 Bacteria 19012
77 Ga0105240_10023780 3300009093 Bacteria 8094
78 Ga0111539_10000225 3300009094 Bacteria 67615
79 Ga0114129_10009728 3300009147 Bacteria 13713
80 Ga0114129_10044233 3300009147 Bacteria 6264
81 Ga0114129_10126213 3300009147 Bacteria 3518
82 Ga0114129_10557069 3300009147 Unclassified 1490
83 Ga0105241_10155644 3300009174 Bacteria 1874
84 Ga0105248_10150174 3300009177 Bacteria 2628
85 Ga0105237_10056543 3300009545 Bacteria 3927
86 Ga0105246_10081810 3300011119 Bacteria 2303
87 Ga0157373_10003366 3300013100 Bacteria 12088
88 Ga0157371_10015947 3300013102 Bacteria 5621
89 Ga0157371_10085341 3300013102 Bacteria 2236
90 Ga0157370_10001129 3300013104 Bacteria 33355
91 Ga0157370_10008585 3300013104 Bacteria 11003
92 Ga0157370_10044231 3300013104 Bacteria 4281
93 Ga0157369_10079562 3300013105 Bacteria 3510
94 Ga0157369_10422810 3300013105 Bacteria 1381
95 Ga0157372_10038097 3300013307 Bacteria 5305
96 Ga0157375_10002721 3300013308 Bacteria 15280
97 Ga0163161_10041965 3300017792 Bacteria 3289
98 Ga0206356_10069298 3300020070 Bacteria 1716
99 Ga0206354_10827474 3300020081 Bacteria 1439
100 Ga0213876_10008014 3300021384 Bacteria 5727
101 Ga0207697_10049499 3300025315 Bacteria 1735
102 Ga0207642_10015354 3300025899 Bacteria 2851
103 Ga0207647_10000429 3300025904 Bacteria 34410
104 Ga0207647_10000595 3300025904 Bacteria 28150
105 Ga0207647_10081077 3300025904 Bacteria 1945
106 Ga0207645_10139022 3300025907 Bacteria 1582
107 Ga0207705_10094242 3300025909 Bacteria 2195
108 Ga0207684_10129067 3300025910 Bacteria 2170
109 Ga0207707_10060394 3300025912 Bacteria 3298
110 Ga0207695_10105972 3300025913 Bacteria 2798
111 Ga0207660_10002244 3300025917 Bacteria 12764
112 Ga0207660_10037172 3300025917 Bacteria 3391
113 Ga0207660_10113249 3300025917 Bacteria 2045
114 Ga0207657_10001587 3300025919 Bacteria 24451
115 Ga0207657_10007286 3300025919 Bacteria 11349
116 Ga0207657_10007347 3300025919 Bacteria 11302
117 Ga0207657_10010348 3300025919 Bacteria 9310
118 Ga0207657_10011885 3300025919 Bacteria 8617
119 Ga0207657_10075755 3300025919 Bacteria 2839
120 Ga0207657_10139508 3300025919 Bacteria 1981
121 Ga0207649_10003670 3300025920 Bacteria 8380
122 Ga0207649_10124071 3300025920 Bacteria 1745
123 Ga0207652_10041511 3300025921 Bacteria 3911
124 Ga0207652_10117782 3300025921 Bacteria 2360
125 Ga0207681_10061757 3300025923 Bacteria 2577
126 Ga0207650_10049142 3300025925 Bacteria 3113
127 Ga0207664_10039514 3300025929 Bacteria 3664
128 Ga0207664_10179914 3300025929 Bacteria 1815
129 Ga0207690_10002257 3300025932 Bacteria 11751
130 Ga0207690_10002893 3300025932 Bacteria 10344
131 Ga0207690_10024292 3300025932 Bacteria 3795
132 Ga0207690_10044670 3300025932 Bacteria 2922
133 Ga0207690_10090572 3300025932 Bacteria 2159
134 Ga0207690_10176425 3300025932 Bacteria 1605
135 Ga0207690_10227643 3300025932 Bacteria 1430
136 Ga0207706_10000378 3300025933 Bacteria 48430
137 Ga0207706_10006666 3300025933 Bacteria 10676
138 Ga0207706_10113371 3300025933 Bacteria 2385
139 Ga0207689_10049451 3300025942 Bacteria 3468
140 Ga0207661_10015747 3300025944 Bacteria 5571
141 Ga0207661_10018654 3300025944 Bacteria 5156
142 Ga0207679_10058191 3300025945 Bacteria 2862
143 Ga0207679_10280517 3300025945 Bacteria 1429
144 Ga0207667_10023306 3300025949 Bacteria 6817
145 Ga0207667_10027008 3300025949 Bacteria 6261
146 Ga0207667_10058558 3300025949 Bacteria 4039
147 Ga0207667_10179097 3300025949 Bacteria 2177
148 Ga0207667_10367205 3300025949 Bacteria 1467
149 Ga0207651_10208127 3300025960 Bacteria 1572
150 Ga0207658_10015867 3300025986 Bacteria 5172
151 Ga0207658_10138430 3300025986 Bacteria 1966
152 Ga0207658_10210635 3300025986 Bacteria 1628
153 Ga0207677_10051820 3300026023 Bacteria 2784
154 Ga0207703_10005590 3300026035 Bacteria 10093
155 Ga0207639_10087528 3300026041 Bacteria 2483
156 Ga0207639_10132623 3300026041 Bacteria 2064
157 Ga0207678_10018512 3300026067 Bacteria 6117
158 Ga0207678_10021168 3300026067 Bacteria 5700
159 Ga0207678_10103166 3300026067 Bacteria 2435
160 Ga0207702_10031062 3300026078 Bacteria 4452
161 Ga0207702_10130718 3300026078 Bacteria 2259
162 Ga0207648_10017487 3300026089 Bacteria 6522
163 Ga0207648_10076916 3300026089 Bacteria 2909
164 Ga0207674_10001045 3300026116 Bacteria 36002
165 Ga0207674_10010980 3300026116 Bacteria 10192
166 Ga0207674_10032615 3300026116 Bacteria 5461
167 Ga0207674_10178364 3300026116 Bacteria 2076
168 Ga0207675_100082288 3300026118 Bacteria 3019
169 Ga0207683_10008132 3300026121 Bacteria 8971
170 Ga0207698_10002094 3300026142 Bacteria 11774
171 Ga0209974_10000170 3300027876 Bacteria 20007
172 Ga0207428_10076539 3300027907 Bacteria 2620
173 Ga0268265_10125170 3300028380 Bacteria 2125
174 Ga0268265_10204538 3300028380 Bacteria 1715
175 Ga0268264_10031955 3300028381 Bacteria 4318
176 Ga0307408_100034094 3300031548 Bacteria 3562
177 Ga0307408_100044302 3300031548 Bacteria 3170
178 Ga0307405_10109071 3300031731 Bacteria 1871
179 Ga0307413_10070897 3300031824 Bacteria 2193
180 Ga0307410_10059611 3300031852 Bacteria 2606
181 Ga0307407_10023434 3300031903 Bacteria 3221
182 Ga0307407_10052269 3300031903 Bacteria 2346
183 Ga0307412_10006861 3300031911 Bacteria 6462
184 Ga0307412_10034250 3300031911 Bacteria 3235
185 Ga0307409_100059520 3300031995 Bacteria 2973
186 Ga0307409_100076538 3300031995 Bacteria 2683
187 Ga0307409_100096147 3300031995 Bacteria 2442
188 Ga0307416_100004257 3300032002 Bacteria 8595
189 Ga0307416_100086249 3300032002 Bacteria 2675
190 Ga0307416_100223917 3300032002 Bacteria 1807
191 Ga0307414_10160710 3300032004 Bacteria 1784
192 Ga0307411_10010870 3300032005 Bacteria 4878
193 Ga0307411_10167161 3300032005 Bacteria 1654
194 Ga0307415_100089401 3300032126 Bacteria 2224
195 Ga0307415_100100813 3300032126 Bacteria 2117
196 Ga0373943_0003479 3300035170 Bacteria 7167
197 Ga0373931_0004693 3300035691 Bacteria 6257
198 Ga0373935_0048770 3300035692 Bacteria 2682
199 Ga0373925_0009605 3300037068 Bacteria 7049
200 Ga0395899_0004663 3300037312 Bacteria 10698
201 Ga0395899_0024337 3300037312 Bacteria 4578
202 Ga0395899_0028259 3300037312 Bacteria 4223
203 Ga0395899_0097689 3300037312 Bacteria 2122
204 Ga0395900_0007276 3300037418 Bacteria 11458
205 Ga0395900_0013525 3300037418 Bacteria 8338
206 Ga0395900_0013743 3300037418 Bacteria 8264
207 Ga0395900_0013981 3300037418 Bacteria 8192
208 Ga0395900_0031245 3300037418 Bacteria 5469
209 Ga0395900_0227401 3300037418 Bacteria 1878
210 Ga0395900_0309104 3300037418 Bacteria 1564
211 Ga0395900_0368048 3300037418 Bacteria 1408
212 Ga0395898_0036094 3300037466 Bacteria 4910
213 Ga0395898_0058842 3300037466 Bacteria 3740
214 Ga0395898_0257610 3300037466 Bacteria 1664
215 Ga0395905_0003412 3300037471 Bacteria 16996
216 Ga0395905_0005762 3300037471 Bacteria 12590
217 Ga0395905_0013020 3300037471 Bacteria 7991
218 Ga0395905_0018147 3300037471 Bacteria 6677
219 Ga0395905_0037710 3300037471 Bacteria 4536
220 Ga0395905_0067490 3300037471 Bacteria 3350
221 Ga0395905_0076046 3300037471 Bacteria 3146
222 Ga0395905_0115055 3300037471 Bacteria 2527
223 Ga0395905_0131321 3300037471 Bacteria 2355
224 Ga0395905_0197523 3300037471 Bacteria 1886
225 Ga0395905_0231520 3300037471 Bacteria 1728
226 Ga0395901_0010989 3300038443 Bacteria 9174
227 Ga0395901_0039131 3300038443 Bacteria 4906
228 Ga0395901_0072747 3300038443 Bacteria 3584
229 Ga0395901_0101227 3300038443 Bacteria 3023
230 Ga0395901_0178289 3300038443 Bacteria 2228
231 Ga0395901_0239792 3300038443 Bacteria 1891
232 Ga0395901_0241866 3300038443 Bacteria 1882
233 Ga0395901_0298810 3300038443 Bacteria 1669
234 Ga0395901_0451530 3300038443 Bacteria 1314
235 Ga0436365_0503355 3300039437 Bacteria 23814
236 Ga0436362_1094259 3300039453 Bacteria 1296
237 Ga0466961_0029639 3300044693 Bacteria 3516
238 Ga0466961_0044822 3300044693 Bacteria 2830
239 Ga0466963_0002442 3300044694 Bacteria 10388
240 Ga0466963_0004930 3300044694 Bacteria 7785
241 Ga0466963_0042376 3300044694 Bacteria 2989
242 Ga0466957_0014614 3300044842 Bacteria 4573
243 Ga0466957_0026925 3300044842 Bacteria 3414
244 Ga0466959_0028108 3300045049 Bacteria 4171
245 Ga0466958_0052622 3300045836 Bacteria 2468
246 Ga0466967_0003430 3300045976 Bacteria 10341
247 Ga0466967_0032441 3300045976 Bacteria 4411
248 Ga0466967_0061765 3300045976 Bacteria 3325
249 Ga0466967_0310805 3300045976 Bacteria 1518
250 Ga0466967_0338743 3300045976 Bacteria 1454
251 Ga0495668_0072611 3300046616 Bacteria 1890
252 Ga0495669_0008239 3300046684 Bacteria 4376
253 Ga0495669_0077513 3300046684 Bacteria 1522
254 Ga0496102_0008643 3300048905 Bacteria 8740
255 Ga0496107_0033421 3300048910 Bacteria 3680
256 Ga0496111_0062983 3300048914 Bacteria 2690
257 Ga0496112_0071028 3300048915 Bacteria 3441
258 Ga0501031_0016594 3300049568 Bacteria 4782
259 Ga0501033_0199479 3300049570 Bacteria 1430
260 Ga0501036_0080249 3300049572 Bacteria 2758
261 Ga0501038_0009368 3300049574 Bacteria 8984
262 Ga0501042_0049001 3300049578 Bacteria 3012
263 Ga0501070_0196117 3300049586 Bacteria 1658
264 Ga0501071_0025574 3300049587 Bacteria 4137
265 Ga0501074_0019876 3300049590 Bacteria 4878
266 Ga0501075_0037842 3300049591 Bacteria 3606
267 Ga0501075_0052403 3300049591 Bacteria 3068
268 Ga0501075_0104207 3300049591 Bacteria 2156
269 Ga0501076_0085588 3300049592 Bacteria 2533
270 Ga0501079_0035723 3300049741 Bacteria 3826
271 Ga0501079_0135078 3300049741 Bacteria 1920
272 Ga0501080_0234937 3300049742 Bacteria 1675
273 Ga0501035_0061402 3300049822 Bacteria 3345
274 Ga0501045_0000568 3300049824 Bacteria 23176
275 nmdc:mga05p37_6423_c1 3300050507 Bacteria 13861
276 nmdc:mga09592_375_c1 3300050508 Bacteria 32667
277 nmdc:mga0qj67_379_c1 3300050509 Bacteria 30645
278 nmdc:mga06r32_1305_c1 3300050510 Bacteria 22500
279 nmdc:mga08y16_15825_c1 3300050511 Bacteria 7930
280 nmdc:mga0n895_113381_c1 3300050512 Bacteria 2728
281 nmdc:mga0a205_1107_c1 3300050515 Bacteria 22328
282 Ga0495612_0035178 3300053078 Bacteria 2030
283 Ga0500658_0000081 3300053134 Bacteria 43923
284 Ga0501084_0042216 3300054114 Bacteria 3814
285 Ga0501082_0003861 3300060353 Bacteria 13092
286 Ga0466962_0106678 3300061719 Bacteria 1347

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100113489 Ga0070706_1001134892 317
2 3300025910 Ga0207684_10129067 Ga0207684_101290672 317
3 3300037466 Ga0395898_0257610 Ga0395898_0257610_535_1623 328
4 3300037312 Ga0395899_0024337 Ga0395899_0024337_45_1079 340
5 3300038443 Ga0395901_0298810 Ga0395901_0298810_45_1079 340
6 3300048915 Ga0496112_0071028 Ga0496112_0071028_107_1231 351
7 3300013104 Ga0157370_10008585 Ga0157370_100085857 354
8 3300009093 Ga0105240_10023780 Ga0105240_100237806 355
9 3300005546 Ga0070696_100007519 Ga0070696_1000075193 360
10 3300046684 Ga0495669_0077513 Ga0495669_0077513_268_1494 361
11 3300005471 Ga0070698_100059429 Ga0070698_1000594292 366
12 3300005467 Ga0070706_100000881 Ga0070706_10000088121 369
13 3300053078 Ga0495612_0035178 Ga0495612_0035178_533_1678 369
14 3300006844 Ga0075428_100000724 Ga0075428_10000072413 370
15 3300006846 Ga0075430_100000005 Ga0075430_10000000553 370
16 3300006847 Ga0075431_100000188 Ga0075431_10000018826 370
17 3300006880 Ga0075429_100000077 Ga0075429_10000007717 370
18 3300009147 Ga0114129_10009728 Ga0114129_100097281 370
19 3300050507 nmdc:mga05p37_6423_c1 nmdc:mga05p37_6423_c1_12581_13816 370
20 3300050508 nmdc:mga09592_375_c1 nmdc:mga09592_375_c1_17152_18387 370
21 3300050509 nmdc:mga0qj67_379_c1 nmdc:mga0qj67_379_c1_15267_16502 370
22 3300050510 nmdc:mga06r32_1305_c1 nmdc:mga06r32_1305_c1_8555_9790 370
23 3300039453 Ga0436362_1094259 Ga0436362_1094259_92_1237 372
24 3300005467 Ga0070706_100214435 Ga0070706_1002144351 377
25 3300005518 Ga0070699_100128953 Ga0070699_1001289532 377
26 3300006844 Ga0075428_100015080 Ga0075428_1000150808 377
27 3300006844 Ga0075428_100244538 Ga0075428_1002445381 377
28 3300006846 Ga0075430_100050368 Ga0075430_1000503683 377
29 3300006847 Ga0075431_100083321 Ga0075431_1000833215 377
30 3300009147 Ga0114129_10126213 Ga0114129_101262132 377
31 3300009147 Ga0114129_10557069 Ga0114129_105570691 377
32 3300049586 Ga0501070_0196117 Ga0501070_0196117_386_1606 384
33 3300049741 Ga0501079_0135078 Ga0501079_0135078_92_1312 384
34 3300005444 Ga0070694_100013248 Ga0070694_1000132486 387
35 3300005549 Ga0070704_100011006 Ga0070704_1000110062 387
36 3300006844 Ga0075428_100020889 Ga0075428_1000208892 387
37 3300009094 Ga0111539_10000225 Ga0111539_1000022544 387
38 3300026118 Ga0207675_100082288 Ga0207675_1000822883 387
39 3300027907 Ga0207428_10076539 Ga0207428_100765393 387
40 3300031548 Ga0307408_100034094 Ga0307408_1000340942 387
41 3300031548 Ga0307408_100044302 Ga0307408_1000443023 387
42 3300032002 Ga0307416_100004257 Ga0307416_1000042579 387
43 3300035691 Ga0373931_0004693 Ga0373931_0004693_788_2014 387
44 3300048905 Ga0496102_0008643 Ga0496102_0008643_2386_3612 387
45 3300049591 Ga0501075_0052403 Ga0501075_0052403_917_2140 387
46 3300049591 Ga0501075_0104207 Ga0501075_0104207_412_1638 387
47 3300049592 Ga0501076_0085588 Ga0501076_0085588_864_2090 387
48 3300049742 Ga0501080_0234937 Ga0501080_0234937_402_1625 387
49 3300050511 nmdc:mga08y16_15825_c1 nmdc:mga08y16_15825_c1_3197_4423 387
50 iso_pu_bacteria 2885427238 2885428852 388
51 3300009093 Ga0105240_10005422 Ga0105240_1000542215 389
52 3300009545 Ga0105237_10056543 Ga0105237_100565432 389
53 3300013104 Ga0157370_10044231 Ga0157370_100442311 389
54 3300037471 Ga0395905_0231520 Ga0395905_0231520_214_1395 389
55 3300006847 Ga0075431_100097697 Ga0075431_1000976973 390
56 3300009147 Ga0114129_10044233 Ga0114129_100442335 390
57 3300005471 Ga0070698_100004172 Ga0070698_10000417216 391
58 3300038443 Ga0395901_0239792 Ga0395901_0239792_305_1492 391
59 3300045976 Ga0466967_0061765 Ga0466967_0061765_1050_2237 391
60 3300049568 Ga0501031_0016594 Ga0501031_0016594_2397_3701 391
61 3300049570 Ga0501033_0199479 Ga0501033_0199479_85_1389 391
62 3300049572 Ga0501036_0080249 Ga0501036_0080249_73_1377 391
63 3300049574 Ga0501038_0009368 Ga0501038_0009368_6243_7547 391
64 3300049578 Ga0501042_0049001 Ga0501042_0049001_1336_2640 391
65 3300049587 Ga0501071_0025574 Ga0501071_0025574_939_2243 391
66 3300049590 Ga0501074_0019876 Ga0501074_0019876_3090_4394 391
67 3300049591 Ga0501075_0037842 Ga0501075_0037842_113_1417 391
68 3300049741 Ga0501079_0035723 Ga0501079_0035723_1333_2637 391
69 3300049822 Ga0501035_0061402 Ga0501035_0061402_813_2117 391
70 3300049824 Ga0501045_0000568 Ga0501045_0000568_8520_9824 391
71 3300054114 Ga0501084_0042216 Ga0501084_0042216_108_1412 391
72 3300060353 Ga0501082_0003861 Ga0501082_0003861_3773_5077 391
73 3300005937 Ga0081455_10072617 Ga0081455_100726173 393
74 3300005329 Ga0070683_100003655 Ga0070683_1000036557 394
75 3300005329 Ga0070683_100023019 Ga0070683_1000230192 394
76 3300005329 Ga0070683_100034238 Ga0070683_1000342383 394
77 3300005329 Ga0070683_100083220 Ga0070683_1000832202 394
78 3300005329 Ga0070683_100184666 Ga0070683_1001846661 394
79 3300005331 Ga0070670_100039310 Ga0070670_1000393103 394
80 3300005331 Ga0070670_100131502 Ga0070670_1001315021 394
81 3300005335 Ga0070666_10006525 Ga0070666_100065256 394
82 3300005336 Ga0070680_100008115 Ga0070680_1000081152 394
83 3300005336 Ga0070680_100009208 Ga0070680_1000092084 394
84 3300005336 Ga0070680_100034520 Ga0070680_1000345205 394
85 3300005336 Ga0070680_100168654 Ga0070680_1001686542 394
86 3300005337 Ga0070682_100049078 Ga0070682_1000490781 394
87 3300005339 Ga0070660_100023409 Ga0070660_1000234094 394
88 3300005339 Ga0070660_100030548 Ga0070660_1000305481 394
89 3300005339 Ga0070660_100089876 Ga0070660_1000898762 394
90 3300005339 Ga0070660_100125850 Ga0070660_1001258502 394
91 3300005339 Ga0070660_100289080 Ga0070660_1002890801 394
92 3300005344 Ga0070661_100116971 Ga0070661_1001169712 394
93 3300005344 Ga0070661_100196582 Ga0070661_1001965822 394
94 3300005344 Ga0070661_100256270 Ga0070661_1002562702 394
95 3300005347 Ga0070668_100035846 Ga0070668_1000358465 394
96 3300005353 Ga0070669_100038149 Ga0070669_1000381493 394
97 3300005366 Ga0070659_100003592 Ga0070659_1000035924 394
98 3300005366 Ga0070659_100006577 Ga0070659_1000065779 394
99 3300005366 Ga0070659_100017826 Ga0070659_1000178262 394
100 3300005366 Ga0070659_100064984 Ga0070659_1000649841 394
101 3300005366 Ga0070659_100176379 Ga0070659_1001763792 394
102 3300005367 Ga0070667_100028758 Ga0070667_1000287582 394
103 3300005367 Ga0070667_100121277 Ga0070667_1001212772 394
104 3300005435 Ga0070714_100056770 Ga0070714_1000567703 394
105 3300005435 Ga0070714_100243097 Ga0070714_1002430971 394
106 3300005457 Ga0070662_100001023 Ga0070662_1000010236 394
107 3300005458 Ga0070681_10019232 Ga0070681_100192324 394
108 3300005458 Ga0070681_10056998 Ga0070681_100569983 394
109 3300005535 Ga0070684_100002373 Ga0070684_1000023733 394
110 3300005535 Ga0070684_100034616 Ga0070684_1000346161 394
111 3300005539 Ga0068853_100002834 Ga0068853_10000283411 394
112 3300005563 Ga0068855_100122698 Ga0068855_1001226983 394
113 3300005577 Ga0068857_100005235 Ga0068857_10000523511 394
114 3300005577 Ga0068857_100123294 Ga0068857_1001232942 394
115 3300005578 Ga0068854_100005034 Ga0068854_10000503411 394
116 3300005614 Ga0068856_100016677 Ga0068856_1000166772 394
117 3300005614 Ga0068856_100024850 Ga0068856_1000248501 394
118 3300005614 Ga0068856_100289966 Ga0068856_1002899661 394
119 3300005616 Ga0068852_100000691 Ga0068852_10000069114 394
120 3300005617 Ga0068859_100038372 Ga0068859_1000383723 394
121 3300005617 Ga0068859_100119463 Ga0068859_1001194633 394
122 3300005842 Ga0068858_100066237 Ga0068858_1000662373 394
123 3300005843 Ga0068860_100070567 Ga0068860_1000705672 394
124 3300006237 Ga0097621_100245337 Ga0097621_1002453372 394
125 3300006358 Ga0068871_100054175 Ga0068871_1000541752 394
126 3300006852 Ga0075433_10086072 Ga0075433_100860723 394
127 3300006931 Ga0097620_100038372 Ga0097620_1000383722 394
128 3300006931 Ga0097620_100119476 Ga0097620_1001194763 394
129 3300009174 Ga0105241_10155644 Ga0105241_101556442 394
130 3300009177 Ga0105248_10150174 Ga0105248_101501742 394
131 3300011119 Ga0105246_10081810 Ga0105246_100818101 394
132 3300013100 Ga0157373_10003366 Ga0157373_1000336613 394
133 3300013102 Ga0157371_10015947 Ga0157371_100159474 394
134 3300013102 Ga0157371_10085341 Ga0157371_100853412 394
135 3300013104 Ga0157370_10001129 Ga0157370_1000112919 394
136 3300013105 Ga0157369_10079562 Ga0157369_100795622 394
137 3300013105 Ga0157369_10422810 Ga0157369_104228102 394
138 3300013307 Ga0157372_10038097 Ga0157372_100380978 394
139 3300013308 Ga0157375_10002721 Ga0157375_100027214 394
140 3300017792 Ga0163161_10041965 Ga0163161_100419653 394
141 3300020070 Ga0206356_10069298 Ga0206356_100692981 394
142 3300020081 Ga0206354_10827474 Ga0206354_108274741 394
143 3300021384 Ga0213876_10008014 Ga0213876_100080141 394
144 3300025315 Ga0207697_10049499 Ga0207697_100494992 394
145 3300025899 Ga0207642_10015354 Ga0207642_100153541 394
146 3300025904 Ga0207647_10000429 Ga0207647_1000042932 394
147 3300025904 Ga0207647_10000595 Ga0207647_1000059525 394
148 3300025904 Ga0207647_10081077 Ga0207647_100810772 394
149 3300025907 Ga0207645_10139022 Ga0207645_101390222 394
150 3300025909 Ga0207705_10094242 Ga0207705_100942422 394
151 3300025912 Ga0207707_10060394 Ga0207707_100603943 394
152 3300025913 Ga0207695_10105972 Ga0207695_101059721 394
153 3300025917 Ga0207660_10002244 Ga0207660_100022443 394
154 3300025917 Ga0207660_10037172 Ga0207660_100371722 394
155 3300025917 Ga0207660_10113249 Ga0207660_101132492 394
156 3300025919 Ga0207657_10001587 Ga0207657_1000158712 394
157 3300025919 Ga0207657_10007286 Ga0207657_1000728610 394
158 3300025919 Ga0207657_10007347 Ga0207657_1000734715 394
159 3300025919 Ga0207657_10010348 Ga0207657_1001034812 394
160 3300025919 Ga0207657_10011885 Ga0207657_1001188511 394
161 3300025919 Ga0207657_10075755 Ga0207657_100757552 394
162 3300025919 Ga0207657_10139508 Ga0207657_101395082 394
163 3300025920 Ga0207649_10003670 Ga0207649_100036701 394
164 3300025920 Ga0207649_10124071 Ga0207649_101240712 394
165 3300025921 Ga0207652_10041511 Ga0207652_100415113 394
166 3300025921 Ga0207652_10117782 Ga0207652_101177822 394
167 3300025923 Ga0207681_10061757 Ga0207681_100617573 394
168 3300025925 Ga0207650_10049142 Ga0207650_100491422 394
169 3300025929 Ga0207664_10039514 Ga0207664_100395145 394
170 3300025929 Ga0207664_10179914 Ga0207664_101799142 394
171 3300025932 Ga0207690_10002257 Ga0207690_100022577 394
172 3300025932 Ga0207690_10002893 Ga0207690_1000289312 394
173 3300025932 Ga0207690_10024292 Ga0207690_100242922 394
174 3300025932 Ga0207690_10044670 Ga0207690_100446703 394
175 3300025932 Ga0207690_10090572 Ga0207690_100905721 394
176 3300025932 Ga0207690_10176425 Ga0207690_101764251 394
177 3300025932 Ga0207690_10227643 Ga0207690_102276431 394
178 3300025933 Ga0207706_10000378 Ga0207706_1000037843 394
179 3300025933 Ga0207706_10006666 Ga0207706_100066667 394
180 3300025933 Ga0207706_10113371 Ga0207706_101133712 394
181 3300025942 Ga0207689_10049451 Ga0207689_100494514 394
182 3300025944 Ga0207661_10015747 Ga0207661_100157472 394
183 3300025944 Ga0207661_10018654 Ga0207661_100186543 394
184 3300025945 Ga0207679_10058191 Ga0207679_100581912 394
185 3300025945 Ga0207679_10280517 Ga0207679_102805172 394
186 3300025949 Ga0207667_10023306 Ga0207667_1002330610 394
187 3300025949 Ga0207667_10027008 Ga0207667_100270083 394
188 3300025949 Ga0207667_10058558 Ga0207667_100585583 394
189 3300025949 Ga0207667_10179097 Ga0207667_101790971 394
190 3300025949 Ga0207667_10367205 Ga0207667_103672051 394
191 3300025960 Ga0207651_10208127 Ga0207651_102081272 394
192 3300025986 Ga0207658_10015867 Ga0207658_100158671 394
193 3300025986 Ga0207658_10138430 Ga0207658_101384302 394
194 3300025986 Ga0207658_10210635 Ga0207658_102106352 394
195 3300026023 Ga0207677_10051820 Ga0207677_100518201 394
196 3300026035 Ga0207703_10005590 Ga0207703_100055909 394
197 3300026041 Ga0207639_10087528 Ga0207639_100875282 394
198 3300026041 Ga0207639_10132623 Ga0207639_101326232 394
199 3300026067 Ga0207678_10018512 Ga0207678_100185129 394
200 3300026067 Ga0207678_10021168 Ga0207678_100211683 394
201 3300026067 Ga0207678_10103166 Ga0207678_101031662 394
202 3300026078 Ga0207702_10031062 Ga0207702_100310621 394
203 3300026078 Ga0207702_10130718 Ga0207702_101307181 394
204 3300026089 Ga0207648_10017487 Ga0207648_100174877 394
205 3300026089 Ga0207648_10076916 Ga0207648_100769163 394
206 3300026116 Ga0207674_10001045 Ga0207674_1000104544 394
207 3300026116 Ga0207674_10010980 Ga0207674_1001098012 394
208 3300026116 Ga0207674_10032615 Ga0207674_100326153 394
209 3300026116 Ga0207674_10178364 Ga0207674_101783641 394
210 3300026121 Ga0207683_10008132 Ga0207683_100081324 394
211 3300026142 Ga0207698_10002094 Ga0207698_100020941 394
212 3300027876 Ga0209974_10000170 Ga0209974_1000017019 394
213 3300028380 Ga0268265_10125170 Ga0268265_101251701 394
214 3300028380 Ga0268265_10204538 Ga0268265_102045382 394
215 3300028381 Ga0268264_10031955 Ga0268264_100319553 394
216 3300031731 Ga0307405_10109071 Ga0307405_101090711 394
217 3300031824 Ga0307413_10070897 Ga0307413_100708971 394
218 3300031852 Ga0307410_10059611 Ga0307410_100596113 394
219 3300031903 Ga0307407_10023434 Ga0307407_100234342 394
220 3300031903 Ga0307407_10052269 Ga0307407_100522692 394
221 3300031911 Ga0307412_10006861 Ga0307412_100068612 394
222 3300031911 Ga0307412_10034250 Ga0307412_100342502 394
223 3300031995 Ga0307409_100059520 Ga0307409_1000595202 394
224 3300031995 Ga0307409_100076538 Ga0307409_1000765382 394
225 3300031995 Ga0307409_100096147 Ga0307409_1000961471 394
226 3300032002 Ga0307416_100086249 Ga0307416_1000862491 394
227 3300032002 Ga0307416_100223917 Ga0307416_1002239171 394
228 3300032004 Ga0307414_10160710 Ga0307414_101607102 394
229 3300032005 Ga0307411_10010870 Ga0307411_100108702 394
230 3300032005 Ga0307411_10167161 Ga0307411_101671611 394
231 3300032126 Ga0307415_100089401 Ga0307415_1000894012 394
232 3300032126 Ga0307415_100100813 Ga0307415_1001008132 394
233 3300035170 Ga0373943_0003479 Ga0373943_0003479_4167_5351 394
234 3300035692 Ga0373935_0048770 Ga0373935_0048770_1236_2420 394
235 3300037068 Ga0373925_0009605 Ga0373925_0009605_88_1272 394
236 3300037312 Ga0395899_0004663 Ga0395899_0004663_3268_4452 394
237 3300037312 Ga0395899_0028259 Ga0395899_0028259_814_2010 394
238 3300037312 Ga0395899_0097689 Ga0395899_0097689_232_1428 394
239 3300037418 Ga0395900_0007276 Ga0395900_0007276_2006_3190 394
240 3300037418 Ga0395900_0013525 Ga0395900_0013525_6834_8030 394
241 3300037418 Ga0395900_0013743 Ga0395900_0013743_6481_7677 394
242 3300037418 Ga0395900_0013981 Ga0395900_0013981_1292_2476 394
243 3300037418 Ga0395900_0031245 Ga0395900_0031245_978_2174 394
244 3300037418 Ga0395900_0227401 Ga0395900_0227401_429_1613 394
245 3300037418 Ga0395900_0309104 Ga0395900_0309104_88_1272 394
246 3300037418 Ga0395900_0368048 Ga0395900_0368048_166_1362 394
247 3300037466 Ga0395898_0036094 Ga0395898_0036094_2841_4037 394
248 3300037466 Ga0395898_0058842 Ga0395898_0058842_323_1519 394
249 3300037471 Ga0395905_0003412 Ga0395905_0003412_8381_9565 394
250 3300037471 Ga0395905_0005762 Ga0395905_0005762_5647_6831 394
251 3300037471 Ga0395905_0013020 Ga0395905_0013020_2300_3496 394
252 3300037471 Ga0395905_0018147 Ga0395905_0018147_4438_5622 394
253 3300037471 Ga0395905_0037710 Ga0395905_0037710_2536_3732 394
254 3300037471 Ga0395905_0067490 Ga0395905_0067490_1520_2704 394
255 3300037471 Ga0395905_0076046 Ga0395905_0076046_1859_3055 394
256 3300037471 Ga0395905_0115055 Ga0395905_0115055_588_1784 394
257 3300037471 Ga0395905_0131321 Ga0395905_0131321_1041_2240 394
258 3300037471 Ga0395905_0197523 Ga0395905_0197523_33_1229 394
259 3300038443 Ga0395901_0010989 Ga0395901_0010989_4761_5945 394
260 3300038443 Ga0395901_0039131 Ga0395901_0039131_1423_2619 394
261 3300038443 Ga0395901_0072747 Ga0395901_0072747_1943_3139 394
262 3300038443 Ga0395901_0101227 Ga0395901_0101227_606_1802 394
263 3300038443 Ga0395901_0178289 Ga0395901_0178289_788_1984 394
264 3300038443 Ga0395901_0241866 Ga0395901_0241866_448_1632 394
265 3300038443 Ga0395901_0451530 Ga0395901_0451530_96_1292 394
266 3300039437 Ga0436365_0503355 Ga0436365_0503355_2373_3569 394
267 3300044693 Ga0466961_0029639 Ga0466961_0029639_1275_2459 394
268 3300044693 Ga0466961_0044822 Ga0466961_0044822_472_1668 394
269 3300044694 Ga0466963_0002442 Ga0466963_0002442_2288_3484 394
270 3300044694 Ga0466963_0004930 Ga0466963_0004930_1585_2769 394
271 3300044694 Ga0466963_0042376 Ga0466963_0042376_350_1570 394
272 3300044842 Ga0466957_0014614 Ga0466957_0014614_1687_2871 394
273 3300044842 Ga0466957_0026925 Ga0466957_0026925_2112_3308 394
274 3300045049 Ga0466959_0028108 Ga0466959_0028108_1910_3106 394
275 3300045836 Ga0466958_0052622 Ga0466958_0052622_1227_2423 394
276 3300045976 Ga0466967_0003430 Ga0466967_0003430_8190_9386 394
277 3300045976 Ga0466967_0032441 Ga0466967_0032441_685_1869 394
278 3300045976 Ga0466967_0310805 Ga0466967_0310805_288_1490 394
279 3300045976 Ga0466967_0338743 Ga0466967_0338743_170_1366 394
280 3300046616 Ga0495668_0072611 Ga0495668_0072611_481_1674 394
281 3300046684 Ga0495669_0008239 Ga0495669_0008239_2988_4181 394
282 3300048910 Ga0496107_0033421 Ga0496107_0033421_1390_2580 394
283 3300048914 Ga0496111_0062983 Ga0496111_0062983_455_1645 394
284 3300050512 nmdc:mga0n895_113381_c1 nmdc:mga0n895_113381_c1_184_1371 394
285 3300050515 nmdc:mga0a205_1107_c1 nmdc:mga0a205_1107_c1_20081_21268 394
286 3300053134 Ga0500658_0000081 Ga0500658_0000081_6380_7573 394
287 3300061719 Ga0466962_0106678 Ga0466962_0106678_132_1316 394

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

73

380

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cgq-assembly1.cif.gz_B-2 threonine synthase from bacillus subtilis atcc 6633 with plp and plp-ala 0.9208 51 374
2c2b-assembly2.cif.gz_C crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine 0.887 1 374
1o58-assembly1.cif.gz_B crystal structure of o-acetylserine sulfhydrylase (tm0665) from thermotoga maritima at 1.80 a resolution 0.8817 76 375
2zsj-assembly2.cif.gz_D crystal structure of threonine synthase from aquifex aeolicus vf5 0.8785 51 374
6cgq-assembly1.cif.gz_A threonine synthase from bacillus subtilis atcc 6633 with plp and plp-ala 0.8752 54 386
ID Description Score Start End Superfamily
af_A0A1D6M0B0_306_515_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9529 210 372 3.40.50.1100
4d9gB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9194 120 193 3.40.50.1100
af_Q9SSP5_269_516_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9051 172 366 3.40.50.1100
3x44B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9003 103 194 3.40.50.1100
2jc3H02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9003 103 196 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A535BMY9-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9931 211 318
AF-A0A535BMY9-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9841 211 318
AF-A0A7G9KZE0-F1-model_v4 Threonine synthase (EC 4.2.3.1) 0.9838 1 393 GO:0003941
GO:0004794
GO:0004795
GO:0006565
GO:0006567
GO:0009097
GO:0030170
AF-A0A1F4XAE0-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.9835 266 368
AF-A0A7G9KZE0-F1-model_v4 Threonine synthase (EC 4.2.3.1) 0.9789 1 393 GO:0003941
GO:0004794
GO:0004795
GO:0006565
GO:0006567
GO:0009097
GO:0030170

Feature Viewer

pLDDT pTM Quality
93.87 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map