F388233
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 287 | 154 | 286 | 397 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0016594|Ga0501031_0016594_2397_3701 |
| Length | 434 |
| Sequence | MSYLTHLECSACCRRLDPDRPWQLCPDCEQPLLAHYDLDRLGRQASVDDLDRRPPGLWRYRDLLPLRAPDQAISLGEGATPLLQVPRLAERMGVPGLLVKDEGTLPTGTFKARGAAVGTSRAVELGVRTLALPTAGNAGAAWAAYGARAGLEVVVVMPETTPSVIRRATAACGADLYLVPGSIADAGAVVRDGCRRHGWYDASTLKEPYRVEGKKTMGFELVDQLGWRLPEVIVYPTGGGVGLIGMWKGFQELRALGWLPAGSPPPRFVAAQAAGCAPVVRAFAEGAERAAAWEEPVTFAAGLRVPKPLGDALILRALRETAGTAVAVPDETIAATMELAGAAEGMVVCPEGAAALAAAAELRREGWIGEDETVAVFNTGTGLLYEDSLPGRAPRRLRAGEPLPPPGALDDQPSGVGREEPGGSGTAGNQRAWA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 33 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 35 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 36 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 37 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 38 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 39 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 56 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 57 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 58 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 93 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 96 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 97 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 98 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 99 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 100 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 101 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 102 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 103 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 104 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 105 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 106 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 107 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 108 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 109 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 111 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 112 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 113 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 114 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 115 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 116 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 117 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 118 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 119 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 120 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 121 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 122 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 123 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 126 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 127 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 128 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 129 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 131 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 152 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.95 |
| Metatranscriptomes | 0.7 |
| Isolates | 0.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.35 |
| Nodule | 0 |
| Rhizoplane | 1.39 |
| Rhizosphere | 97.21 |
| Stem | 0 |
| Stem Tuber | 0.35 |
| Unclassified | 0.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100003655 | 3300005329 | Bacteria | 12534 |
| 2 | Ga0070683_100023019 | 3300005329 | Bacteria | 5571 |
| 3 | Ga0070683_100034238 | 3300005329 | Bacteria | 4638 |
| 4 | Ga0070683_100083220 | 3300005329 | Bacteria | 2997 |
| 5 | Ga0070683_100184666 | 3300005329 | Bacteria | 1979 |
| 6 | Ga0070670_100039310 | 3300005331 | Bacteria | 4068 |
| 7 | Ga0070670_100131502 | 3300005331 | Bacteria | 2161 |
| 8 | Ga0070666_10006525 | 3300005335 | Bacteria | 7166 |
| 9 | Ga0070680_100008115 | 3300005336 | Bacteria | 8017 |
| 10 | Ga0070680_100009208 | 3300005336 | Bacteria | 7574 |
| 11 | Ga0070680_100034520 | 3300005336 | Bacteria | 4078 |
| 12 | Ga0070680_100168654 | 3300005336 | Bacteria | 1841 |
| 13 | Ga0070682_100049078 | 3300005337 | Bacteria | 2631 |
| 14 | Ga0070660_100023409 | 3300005339 | Bacteria | 4575 |
| 15 | Ga0070660_100030548 | 3300005339 | Bacteria | 4042 |
| 16 | Ga0070660_100089876 | 3300005339 | Bacteria | 2420 |
| 17 | Ga0070660_100125850 | 3300005339 | Bacteria | 2048 |
| 18 | Ga0070660_100289080 | 3300005339 | Bacteria | 1342 |
| 19 | Ga0070661_100116971 | 3300005344 | Bacteria | 1994 |
| 20 | Ga0070661_100196582 | 3300005344 | Bacteria | 1540 |
| 21 | Ga0070661_100256270 | 3300005344 | Bacteria | 1351 |
| 22 | Ga0070668_100035846 | 3300005347 | Bacteria | 3785 |
| 23 | Ga0070669_100038149 | 3300005353 | Bacteria | 3487 |
| 24 | Ga0070659_100003592 | 3300005366 | Bacteria | 11036 |
| 25 | Ga0070659_100006577 | 3300005366 | Bacteria | 8394 |
| 26 | Ga0070659_100017826 | 3300005366 | Bacteria | 5349 |
| 27 | Ga0070659_100064984 | 3300005366 | Bacteria | 2889 |
| 28 | Ga0070659_100176379 | 3300005366 | Bacteria | 1752 |
| 29 | Ga0070667_100028758 | 3300005367 | Bacteria | 4628 |
| 30 | Ga0070667_100121277 | 3300005367 | Bacteria | 2274 |
| 31 | Ga0070714_100056770 | 3300005435 | Bacteria | 3349 |
| 32 | Ga0070714_100243097 | 3300005435 | Bacteria | 1662 |
| 33 | Ga0070694_100013248 | 3300005444 | Bacteria | 5148 |
| 34 | Ga0070662_100001023 | 3300005457 | Bacteria | 17121 |
| 35 | Ga0070681_10019232 | 3300005458 | Bacteria | 6834 |
| 36 | Ga0070681_10056998 | 3300005458 | Bacteria | 3887 |
| 37 | Ga0070706_100000881 | 3300005467 | Bacteria | 32916 |
| 38 | Ga0070706_100113489 | 3300005467 | Bacteria | 2523 |
| 39 | Ga0070706_100214435 | 3300005467 | Bacteria | 1797 |
| 40 | Ga0070698_100004172 | 3300005471 | Bacteria | 15875 |
| 41 | Ga0070698_100059429 | 3300005471 | Bacteria | 3861 |
| 42 | Ga0070699_100128953 | 3300005518 | Bacteria | 2229 |
| 43 | Ga0070684_100002373 | 3300005535 | Bacteria | 13880 |
| 44 | Ga0070684_100034616 | 3300005535 | Bacteria | 4319 |
| 45 | Ga0068853_100002834 | 3300005539 | Bacteria | 13141 |
| 46 | Ga0070696_100007519 | 3300005546 | Bacteria | 7287 |
| 47 | Ga0070704_100011006 | 3300005549 | Bacteria | 5520 |
| 48 | Ga0068855_100122698 | 3300005563 | Bacteria | 2973 |
| 49 | Ga0068857_100005235 | 3300005577 | Bacteria | 11044 |
| 50 | Ga0068857_100123294 | 3300005577 | Bacteria | 2334 |
| 51 | Ga0068854_100005034 | 3300005578 | Bacteria | 8326 |
| 52 | Ga0068856_100016677 | 3300005614 | Bacteria | 7114 |
| 53 | Ga0068856_100024850 | 3300005614 | Bacteria | 5835 |
| 54 | Ga0068856_100289966 | 3300005614 | Bacteria | 1653 |
| 55 | Ga0068852_100000691 | 3300005616 | Bacteria | 22066 |
| 56 | Ga0068859_100038372 | 3300005617 | Bacteria | 4806 |
| 57 | Ga0068859_100119463 | 3300005617 | Bacteria | 2702 |
| 58 | Ga0068858_100066237 | 3300005842 | Bacteria | 3343 |
| 59 | Ga0068860_100070567 | 3300005843 | Bacteria | 3321 |
| 60 | Ga0081455_10072617 | 3300005937 | Bacteria | 2848 |
| 61 | Ga0097621_100245337 | 3300006237 | Bacteria | 1567 |
| 62 | Ga0068871_100054175 | 3300006358 | Bacteria | 3253 |
| 63 | Ga0075428_100000724 | 3300006844 | Bacteria | 34214 |
| 64 | Ga0075428_100015080 | 3300006844 | Bacteria | 8584 |
| 65 | Ga0075428_100020889 | 3300006844 | Bacteria | 7250 |
| 66 | Ga0075428_100244538 | 3300006844 | Unclassified | 1935 |
| 67 | Ga0075430_100000005 | 3300006846 | Bacteria | 108528 |
| 68 | Ga0075430_100050368 | 3300006846 | Bacteria | 3512 |
| 69 | Ga0075431_100000188 | 3300006847 | Bacteria | 44797 |
| 70 | Ga0075431_100083321 | 3300006847 | Bacteria | 3301 |
| 71 | Ga0075431_100097697 | 3300006847 | Bacteria | 3033 |
| 72 | Ga0075433_10086072 | 3300006852 | Bacteria | 2775 |
| 73 | Ga0075429_100000077 | 3300006880 | Bacteria | 49812 |
| 74 | Ga0097620_100038372 | 3300006931 | Bacteria | 4806 |
| 75 | Ga0097620_100119476 | 3300006931 | Bacteria | 2702 |
| 76 | Ga0105240_10005422 | 3300009093 | Bacteria | 19012 |
| 77 | Ga0105240_10023780 | 3300009093 | Bacteria | 8094 |
| 78 | Ga0111539_10000225 | 3300009094 | Bacteria | 67615 |
| 79 | Ga0114129_10009728 | 3300009147 | Bacteria | 13713 |
| 80 | Ga0114129_10044233 | 3300009147 | Bacteria | 6264 |
| 81 | Ga0114129_10126213 | 3300009147 | Bacteria | 3518 |
| 82 | Ga0114129_10557069 | 3300009147 | Unclassified | 1490 |
| 83 | Ga0105241_10155644 | 3300009174 | Bacteria | 1874 |
| 84 | Ga0105248_10150174 | 3300009177 | Bacteria | 2628 |
| 85 | Ga0105237_10056543 | 3300009545 | Bacteria | 3927 |
| 86 | Ga0105246_10081810 | 3300011119 | Bacteria | 2303 |
| 87 | Ga0157373_10003366 | 3300013100 | Bacteria | 12088 |
| 88 | Ga0157371_10015947 | 3300013102 | Bacteria | 5621 |
| 89 | Ga0157371_10085341 | 3300013102 | Bacteria | 2236 |
| 90 | Ga0157370_10001129 | 3300013104 | Bacteria | 33355 |
| 91 | Ga0157370_10008585 | 3300013104 | Bacteria | 11003 |
| 92 | Ga0157370_10044231 | 3300013104 | Bacteria | 4281 |
| 93 | Ga0157369_10079562 | 3300013105 | Bacteria | 3510 |
| 94 | Ga0157369_10422810 | 3300013105 | Bacteria | 1381 |
| 95 | Ga0157372_10038097 | 3300013307 | Bacteria | 5305 |
| 96 | Ga0157375_10002721 | 3300013308 | Bacteria | 15280 |
| 97 | Ga0163161_10041965 | 3300017792 | Bacteria | 3289 |
| 98 | Ga0206356_10069298 | 3300020070 | Bacteria | 1716 |
| 99 | Ga0206354_10827474 | 3300020081 | Bacteria | 1439 |
| 100 | Ga0213876_10008014 | 3300021384 | Bacteria | 5727 |
| 101 | Ga0207697_10049499 | 3300025315 | Bacteria | 1735 |
| 102 | Ga0207642_10015354 | 3300025899 | Bacteria | 2851 |
| 103 | Ga0207647_10000429 | 3300025904 | Bacteria | 34410 |
| 104 | Ga0207647_10000595 | 3300025904 | Bacteria | 28150 |
| 105 | Ga0207647_10081077 | 3300025904 | Bacteria | 1945 |
| 106 | Ga0207645_10139022 | 3300025907 | Bacteria | 1582 |
| 107 | Ga0207705_10094242 | 3300025909 | Bacteria | 2195 |
| 108 | Ga0207684_10129067 | 3300025910 | Bacteria | 2170 |
| 109 | Ga0207707_10060394 | 3300025912 | Bacteria | 3298 |
| 110 | Ga0207695_10105972 | 3300025913 | Bacteria | 2798 |
| 111 | Ga0207660_10002244 | 3300025917 | Bacteria | 12764 |
| 112 | Ga0207660_10037172 | 3300025917 | Bacteria | 3391 |
| 113 | Ga0207660_10113249 | 3300025917 | Bacteria | 2045 |
| 114 | Ga0207657_10001587 | 3300025919 | Bacteria | 24451 |
| 115 | Ga0207657_10007286 | 3300025919 | Bacteria | 11349 |
| 116 | Ga0207657_10007347 | 3300025919 | Bacteria | 11302 |
| 117 | Ga0207657_10010348 | 3300025919 | Bacteria | 9310 |
| 118 | Ga0207657_10011885 | 3300025919 | Bacteria | 8617 |
| 119 | Ga0207657_10075755 | 3300025919 | Bacteria | 2839 |
| 120 | Ga0207657_10139508 | 3300025919 | Bacteria | 1981 |
| 121 | Ga0207649_10003670 | 3300025920 | Bacteria | 8380 |
| 122 | Ga0207649_10124071 | 3300025920 | Bacteria | 1745 |
| 123 | Ga0207652_10041511 | 3300025921 | Bacteria | 3911 |
| 124 | Ga0207652_10117782 | 3300025921 | Bacteria | 2360 |
| 125 | Ga0207681_10061757 | 3300025923 | Bacteria | 2577 |
| 126 | Ga0207650_10049142 | 3300025925 | Bacteria | 3113 |
| 127 | Ga0207664_10039514 | 3300025929 | Bacteria | 3664 |
| 128 | Ga0207664_10179914 | 3300025929 | Bacteria | 1815 |
| 129 | Ga0207690_10002257 | 3300025932 | Bacteria | 11751 |
| 130 | Ga0207690_10002893 | 3300025932 | Bacteria | 10344 |
| 131 | Ga0207690_10024292 | 3300025932 | Bacteria | 3795 |
| 132 | Ga0207690_10044670 | 3300025932 | Bacteria | 2922 |
| 133 | Ga0207690_10090572 | 3300025932 | Bacteria | 2159 |
| 134 | Ga0207690_10176425 | 3300025932 | Bacteria | 1605 |
| 135 | Ga0207690_10227643 | 3300025932 | Bacteria | 1430 |
| 136 | Ga0207706_10000378 | 3300025933 | Bacteria | 48430 |
| 137 | Ga0207706_10006666 | 3300025933 | Bacteria | 10676 |
| 138 | Ga0207706_10113371 | 3300025933 | Bacteria | 2385 |
| 139 | Ga0207689_10049451 | 3300025942 | Bacteria | 3468 |
| 140 | Ga0207661_10015747 | 3300025944 | Bacteria | 5571 |
| 141 | Ga0207661_10018654 | 3300025944 | Bacteria | 5156 |
| 142 | Ga0207679_10058191 | 3300025945 | Bacteria | 2862 |
| 143 | Ga0207679_10280517 | 3300025945 | Bacteria | 1429 |
| 144 | Ga0207667_10023306 | 3300025949 | Bacteria | 6817 |
| 145 | Ga0207667_10027008 | 3300025949 | Bacteria | 6261 |
| 146 | Ga0207667_10058558 | 3300025949 | Bacteria | 4039 |
| 147 | Ga0207667_10179097 | 3300025949 | Bacteria | 2177 |
| 148 | Ga0207667_10367205 | 3300025949 | Bacteria | 1467 |
| 149 | Ga0207651_10208127 | 3300025960 | Bacteria | 1572 |
| 150 | Ga0207658_10015867 | 3300025986 | Bacteria | 5172 |
| 151 | Ga0207658_10138430 | 3300025986 | Bacteria | 1966 |
| 152 | Ga0207658_10210635 | 3300025986 | Bacteria | 1628 |
| 153 | Ga0207677_10051820 | 3300026023 | Bacteria | 2784 |
| 154 | Ga0207703_10005590 | 3300026035 | Bacteria | 10093 |
| 155 | Ga0207639_10087528 | 3300026041 | Bacteria | 2483 |
| 156 | Ga0207639_10132623 | 3300026041 | Bacteria | 2064 |
| 157 | Ga0207678_10018512 | 3300026067 | Bacteria | 6117 |
| 158 | Ga0207678_10021168 | 3300026067 | Bacteria | 5700 |
| 159 | Ga0207678_10103166 | 3300026067 | Bacteria | 2435 |
| 160 | Ga0207702_10031062 | 3300026078 | Bacteria | 4452 |
| 161 | Ga0207702_10130718 | 3300026078 | Bacteria | 2259 |
| 162 | Ga0207648_10017487 | 3300026089 | Bacteria | 6522 |
| 163 | Ga0207648_10076916 | 3300026089 | Bacteria | 2909 |
| 164 | Ga0207674_10001045 | 3300026116 | Bacteria | 36002 |
| 165 | Ga0207674_10010980 | 3300026116 | Bacteria | 10192 |
| 166 | Ga0207674_10032615 | 3300026116 | Bacteria | 5461 |
| 167 | Ga0207674_10178364 | 3300026116 | Bacteria | 2076 |
| 168 | Ga0207675_100082288 | 3300026118 | Bacteria | 3019 |
| 169 | Ga0207683_10008132 | 3300026121 | Bacteria | 8971 |
| 170 | Ga0207698_10002094 | 3300026142 | Bacteria | 11774 |
| 171 | Ga0209974_10000170 | 3300027876 | Bacteria | 20007 |
| 172 | Ga0207428_10076539 | 3300027907 | Bacteria | 2620 |
| 173 | Ga0268265_10125170 | 3300028380 | Bacteria | 2125 |
| 174 | Ga0268265_10204538 | 3300028380 | Bacteria | 1715 |
| 175 | Ga0268264_10031955 | 3300028381 | Bacteria | 4318 |
| 176 | Ga0307408_100034094 | 3300031548 | Bacteria | 3562 |
| 177 | Ga0307408_100044302 | 3300031548 | Bacteria | 3170 |
| 178 | Ga0307405_10109071 | 3300031731 | Bacteria | 1871 |
| 179 | Ga0307413_10070897 | 3300031824 | Bacteria | 2193 |
| 180 | Ga0307410_10059611 | 3300031852 | Bacteria | 2606 |
| 181 | Ga0307407_10023434 | 3300031903 | Bacteria | 3221 |
| 182 | Ga0307407_10052269 | 3300031903 | Bacteria | 2346 |
| 183 | Ga0307412_10006861 | 3300031911 | Bacteria | 6462 |
| 184 | Ga0307412_10034250 | 3300031911 | Bacteria | 3235 |
| 185 | Ga0307409_100059520 | 3300031995 | Bacteria | 2973 |
| 186 | Ga0307409_100076538 | 3300031995 | Bacteria | 2683 |
| 187 | Ga0307409_100096147 | 3300031995 | Bacteria | 2442 |
| 188 | Ga0307416_100004257 | 3300032002 | Bacteria | 8595 |
| 189 | Ga0307416_100086249 | 3300032002 | Bacteria | 2675 |
| 190 | Ga0307416_100223917 | 3300032002 | Bacteria | 1807 |
| 191 | Ga0307414_10160710 | 3300032004 | Bacteria | 1784 |
| 192 | Ga0307411_10010870 | 3300032005 | Bacteria | 4878 |
| 193 | Ga0307411_10167161 | 3300032005 | Bacteria | 1654 |
| 194 | Ga0307415_100089401 | 3300032126 | Bacteria | 2224 |
| 195 | Ga0307415_100100813 | 3300032126 | Bacteria | 2117 |
| 196 | Ga0373943_0003479 | 3300035170 | Bacteria | 7167 |
| 197 | Ga0373931_0004693 | 3300035691 | Bacteria | 6257 |
| 198 | Ga0373935_0048770 | 3300035692 | Bacteria | 2682 |
| 199 | Ga0373925_0009605 | 3300037068 | Bacteria | 7049 |
| 200 | Ga0395899_0004663 | 3300037312 | Bacteria | 10698 |
| 201 | Ga0395899_0024337 | 3300037312 | Bacteria | 4578 |
| 202 | Ga0395899_0028259 | 3300037312 | Bacteria | 4223 |
| 203 | Ga0395899_0097689 | 3300037312 | Bacteria | 2122 |
| 204 | Ga0395900_0007276 | 3300037418 | Bacteria | 11458 |
| 205 | Ga0395900_0013525 | 3300037418 | Bacteria | 8338 |
| 206 | Ga0395900_0013743 | 3300037418 | Bacteria | 8264 |
| 207 | Ga0395900_0013981 | 3300037418 | Bacteria | 8192 |
| 208 | Ga0395900_0031245 | 3300037418 | Bacteria | 5469 |
| 209 | Ga0395900_0227401 | 3300037418 | Bacteria | 1878 |
| 210 | Ga0395900_0309104 | 3300037418 | Bacteria | 1564 |
| 211 | Ga0395900_0368048 | 3300037418 | Bacteria | 1408 |
| 212 | Ga0395898_0036094 | 3300037466 | Bacteria | 4910 |
| 213 | Ga0395898_0058842 | 3300037466 | Bacteria | 3740 |
| 214 | Ga0395898_0257610 | 3300037466 | Bacteria | 1664 |
| 215 | Ga0395905_0003412 | 3300037471 | Bacteria | 16996 |
| 216 | Ga0395905_0005762 | 3300037471 | Bacteria | 12590 |
| 217 | Ga0395905_0013020 | 3300037471 | Bacteria | 7991 |
| 218 | Ga0395905_0018147 | 3300037471 | Bacteria | 6677 |
| 219 | Ga0395905_0037710 | 3300037471 | Bacteria | 4536 |
| 220 | Ga0395905_0067490 | 3300037471 | Bacteria | 3350 |
| 221 | Ga0395905_0076046 | 3300037471 | Bacteria | 3146 |
| 222 | Ga0395905_0115055 | 3300037471 | Bacteria | 2527 |
| 223 | Ga0395905_0131321 | 3300037471 | Bacteria | 2355 |
| 224 | Ga0395905_0197523 | 3300037471 | Bacteria | 1886 |
| 225 | Ga0395905_0231520 | 3300037471 | Bacteria | 1728 |
| 226 | Ga0395901_0010989 | 3300038443 | Bacteria | 9174 |
| 227 | Ga0395901_0039131 | 3300038443 | Bacteria | 4906 |
| 228 | Ga0395901_0072747 | 3300038443 | Bacteria | 3584 |
| 229 | Ga0395901_0101227 | 3300038443 | Bacteria | 3023 |
| 230 | Ga0395901_0178289 | 3300038443 | Bacteria | 2228 |
| 231 | Ga0395901_0239792 | 3300038443 | Bacteria | 1891 |
| 232 | Ga0395901_0241866 | 3300038443 | Bacteria | 1882 |
| 233 | Ga0395901_0298810 | 3300038443 | Bacteria | 1669 |
| 234 | Ga0395901_0451530 | 3300038443 | Bacteria | 1314 |
| 235 | Ga0436365_0503355 | 3300039437 | Bacteria | 23814 |
| 236 | Ga0436362_1094259 | 3300039453 | Bacteria | 1296 |
| 237 | Ga0466961_0029639 | 3300044693 | Bacteria | 3516 |
| 238 | Ga0466961_0044822 | 3300044693 | Bacteria | 2830 |
| 239 | Ga0466963_0002442 | 3300044694 | Bacteria | 10388 |
| 240 | Ga0466963_0004930 | 3300044694 | Bacteria | 7785 |
| 241 | Ga0466963_0042376 | 3300044694 | Bacteria | 2989 |
| 242 | Ga0466957_0014614 | 3300044842 | Bacteria | 4573 |
| 243 | Ga0466957_0026925 | 3300044842 | Bacteria | 3414 |
| 244 | Ga0466959_0028108 | 3300045049 | Bacteria | 4171 |
| 245 | Ga0466958_0052622 | 3300045836 | Bacteria | 2468 |
| 246 | Ga0466967_0003430 | 3300045976 | Bacteria | 10341 |
| 247 | Ga0466967_0032441 | 3300045976 | Bacteria | 4411 |
| 248 | Ga0466967_0061765 | 3300045976 | Bacteria | 3325 |
| 249 | Ga0466967_0310805 | 3300045976 | Bacteria | 1518 |
| 250 | Ga0466967_0338743 | 3300045976 | Bacteria | 1454 |
| 251 | Ga0495668_0072611 | 3300046616 | Bacteria | 1890 |
| 252 | Ga0495669_0008239 | 3300046684 | Bacteria | 4376 |
| 253 | Ga0495669_0077513 | 3300046684 | Bacteria | 1522 |
| 254 | Ga0496102_0008643 | 3300048905 | Bacteria | 8740 |
| 255 | Ga0496107_0033421 | 3300048910 | Bacteria | 3680 |
| 256 | Ga0496111_0062983 | 3300048914 | Bacteria | 2690 |
| 257 | Ga0496112_0071028 | 3300048915 | Bacteria | 3441 |
| 258 | Ga0501031_0016594 | 3300049568 | Bacteria | 4782 |
| 259 | Ga0501033_0199479 | 3300049570 | Bacteria | 1430 |
| 260 | Ga0501036_0080249 | 3300049572 | Bacteria | 2758 |
| 261 | Ga0501038_0009368 | 3300049574 | Bacteria | 8984 |
| 262 | Ga0501042_0049001 | 3300049578 | Bacteria | 3012 |
| 263 | Ga0501070_0196117 | 3300049586 | Bacteria | 1658 |
| 264 | Ga0501071_0025574 | 3300049587 | Bacteria | 4137 |
| 265 | Ga0501074_0019876 | 3300049590 | Bacteria | 4878 |
| 266 | Ga0501075_0037842 | 3300049591 | Bacteria | 3606 |
| 267 | Ga0501075_0052403 | 3300049591 | Bacteria | 3068 |
| 268 | Ga0501075_0104207 | 3300049591 | Bacteria | 2156 |
| 269 | Ga0501076_0085588 | 3300049592 | Bacteria | 2533 |
| 270 | Ga0501079_0035723 | 3300049741 | Bacteria | 3826 |
| 271 | Ga0501079_0135078 | 3300049741 | Bacteria | 1920 |
| 272 | Ga0501080_0234937 | 3300049742 | Bacteria | 1675 |
| 273 | Ga0501035_0061402 | 3300049822 | Bacteria | 3345 |
| 274 | Ga0501045_0000568 | 3300049824 | Bacteria | 23176 |
| 275 | nmdc:mga05p37_6423_c1 | 3300050507 | Bacteria | 13861 |
| 276 | nmdc:mga09592_375_c1 | 3300050508 | Bacteria | 32667 |
| 277 | nmdc:mga0qj67_379_c1 | 3300050509 | Bacteria | 30645 |
| 278 | nmdc:mga06r32_1305_c1 | 3300050510 | Bacteria | 22500 |
| 279 | nmdc:mga08y16_15825_c1 | 3300050511 | Bacteria | 7930 |
| 280 | nmdc:mga0n895_113381_c1 | 3300050512 | Bacteria | 2728 |
| 281 | nmdc:mga0a205_1107_c1 | 3300050515 | Bacteria | 22328 |
| 282 | Ga0495612_0035178 | 3300053078 | Bacteria | 2030 |
| 283 | Ga0500658_0000081 | 3300053134 | Bacteria | 43923 |
| 284 | Ga0501084_0042216 | 3300054114 | Bacteria | 3814 |
| 285 | Ga0501082_0003861 | 3300060353 | Bacteria | 13092 |
| 286 | Ga0466962_0106678 | 3300061719 | Bacteria | 1347 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005467 | Ga0070706_100113489 | Ga0070706_1001134892 | 317 |
| 2 | 3300025910 | Ga0207684_10129067 | Ga0207684_101290672 | 317 |
| 3 | 3300037466 | Ga0395898_0257610 | Ga0395898_0257610_535_1623 | 328 |
| 4 | 3300037312 | Ga0395899_0024337 | Ga0395899_0024337_45_1079 | 340 |
| 5 | 3300038443 | Ga0395901_0298810 | Ga0395901_0298810_45_1079 | 340 |
| 6 | 3300048915 | Ga0496112_0071028 | Ga0496112_0071028_107_1231 | 351 |
| 7 | 3300013104 | Ga0157370_10008585 | Ga0157370_100085857 | 354 |
| 8 | 3300009093 | Ga0105240_10023780 | Ga0105240_100237806 | 355 |
| 9 | 3300005546 | Ga0070696_100007519 | Ga0070696_1000075193 | 360 |
| 10 | 3300046684 | Ga0495669_0077513 | Ga0495669_0077513_268_1494 | 361 |
| 11 | 3300005471 | Ga0070698_100059429 | Ga0070698_1000594292 | 366 |
| 12 | 3300005467 | Ga0070706_100000881 | Ga0070706_10000088121 | 369 |
| 13 | 3300053078 | Ga0495612_0035178 | Ga0495612_0035178_533_1678 | 369 |
| 14 | 3300006844 | Ga0075428_100000724 | Ga0075428_10000072413 | 370 |
| 15 | 3300006846 | Ga0075430_100000005 | Ga0075430_10000000553 | 370 |
| 16 | 3300006847 | Ga0075431_100000188 | Ga0075431_10000018826 | 370 |
| 17 | 3300006880 | Ga0075429_100000077 | Ga0075429_10000007717 | 370 |
| 18 | 3300009147 | Ga0114129_10009728 | Ga0114129_100097281 | 370 |
| 19 | 3300050507 | nmdc:mga05p37_6423_c1 | nmdc:mga05p37_6423_c1_12581_13816 | 370 |
| 20 | 3300050508 | nmdc:mga09592_375_c1 | nmdc:mga09592_375_c1_17152_18387 | 370 |
| 21 | 3300050509 | nmdc:mga0qj67_379_c1 | nmdc:mga0qj67_379_c1_15267_16502 | 370 |
| 22 | 3300050510 | nmdc:mga06r32_1305_c1 | nmdc:mga06r32_1305_c1_8555_9790 | 370 |
| 23 | 3300039453 | Ga0436362_1094259 | Ga0436362_1094259_92_1237 | 372 |
| 24 | 3300005467 | Ga0070706_100214435 | Ga0070706_1002144351 | 377 |
| 25 | 3300005518 | Ga0070699_100128953 | Ga0070699_1001289532 | 377 |
| 26 | 3300006844 | Ga0075428_100015080 | Ga0075428_1000150808 | 377 |
| 27 | 3300006844 | Ga0075428_100244538 | Ga0075428_1002445381 | 377 |
| 28 | 3300006846 | Ga0075430_100050368 | Ga0075430_1000503683 | 377 |
| 29 | 3300006847 | Ga0075431_100083321 | Ga0075431_1000833215 | 377 |
| 30 | 3300009147 | Ga0114129_10126213 | Ga0114129_101262132 | 377 |
| 31 | 3300009147 | Ga0114129_10557069 | Ga0114129_105570691 | 377 |
| 32 | 3300049586 | Ga0501070_0196117 | Ga0501070_0196117_386_1606 | 384 |
| 33 | 3300049741 | Ga0501079_0135078 | Ga0501079_0135078_92_1312 | 384 |
| 34 | 3300005444 | Ga0070694_100013248 | Ga0070694_1000132486 | 387 |
| 35 | 3300005549 | Ga0070704_100011006 | Ga0070704_1000110062 | 387 |
| 36 | 3300006844 | Ga0075428_100020889 | Ga0075428_1000208892 | 387 |
| 37 | 3300009094 | Ga0111539_10000225 | Ga0111539_1000022544 | 387 |
| 38 | 3300026118 | Ga0207675_100082288 | Ga0207675_1000822883 | 387 |
| 39 | 3300027907 | Ga0207428_10076539 | Ga0207428_100765393 | 387 |
| 40 | 3300031548 | Ga0307408_100034094 | Ga0307408_1000340942 | 387 |
| 41 | 3300031548 | Ga0307408_100044302 | Ga0307408_1000443023 | 387 |
| 42 | 3300032002 | Ga0307416_100004257 | Ga0307416_1000042579 | 387 |
| 43 | 3300035691 | Ga0373931_0004693 | Ga0373931_0004693_788_2014 | 387 |
| 44 | 3300048905 | Ga0496102_0008643 | Ga0496102_0008643_2386_3612 | 387 |
| 45 | 3300049591 | Ga0501075_0052403 | Ga0501075_0052403_917_2140 | 387 |
| 46 | 3300049591 | Ga0501075_0104207 | Ga0501075_0104207_412_1638 | 387 |
| 47 | 3300049592 | Ga0501076_0085588 | Ga0501076_0085588_864_2090 | 387 |
| 48 | 3300049742 | Ga0501080_0234937 | Ga0501080_0234937_402_1625 | 387 |
| 49 | 3300050511 | nmdc:mga08y16_15825_c1 | nmdc:mga08y16_15825_c1_3197_4423 | 387 |
| 50 | iso_pu_bacteria | 2885427238 | 2885428852 | 388 |
| 51 | 3300009093 | Ga0105240_10005422 | Ga0105240_1000542215 | 389 |
| 52 | 3300009545 | Ga0105237_10056543 | Ga0105237_100565432 | 389 |
| 53 | 3300013104 | Ga0157370_10044231 | Ga0157370_100442311 | 389 |
| 54 | 3300037471 | Ga0395905_0231520 | Ga0395905_0231520_214_1395 | 389 |
| 55 | 3300006847 | Ga0075431_100097697 | Ga0075431_1000976973 | 390 |
| 56 | 3300009147 | Ga0114129_10044233 | Ga0114129_100442335 | 390 |
| 57 | 3300005471 | Ga0070698_100004172 | Ga0070698_10000417216 | 391 |
| 58 | 3300038443 | Ga0395901_0239792 | Ga0395901_0239792_305_1492 | 391 |
| 59 | 3300045976 | Ga0466967_0061765 | Ga0466967_0061765_1050_2237 | 391 |
| 60 | 3300049568 | Ga0501031_0016594 | Ga0501031_0016594_2397_3701 | 391 |
| 61 | 3300049570 | Ga0501033_0199479 | Ga0501033_0199479_85_1389 | 391 |
| 62 | 3300049572 | Ga0501036_0080249 | Ga0501036_0080249_73_1377 | 391 |
| 63 | 3300049574 | Ga0501038_0009368 | Ga0501038_0009368_6243_7547 | 391 |
| 64 | 3300049578 | Ga0501042_0049001 | Ga0501042_0049001_1336_2640 | 391 |
| 65 | 3300049587 | Ga0501071_0025574 | Ga0501071_0025574_939_2243 | 391 |
| 66 | 3300049590 | Ga0501074_0019876 | Ga0501074_0019876_3090_4394 | 391 |
| 67 | 3300049591 | Ga0501075_0037842 | Ga0501075_0037842_113_1417 | 391 |
| 68 | 3300049741 | Ga0501079_0035723 | Ga0501079_0035723_1333_2637 | 391 |
| 69 | 3300049822 | Ga0501035_0061402 | Ga0501035_0061402_813_2117 | 391 |
| 70 | 3300049824 | Ga0501045_0000568 | Ga0501045_0000568_8520_9824 | 391 |
| 71 | 3300054114 | Ga0501084_0042216 | Ga0501084_0042216_108_1412 | 391 |
| 72 | 3300060353 | Ga0501082_0003861 | Ga0501082_0003861_3773_5077 | 391 |
| 73 | 3300005937 | Ga0081455_10072617 | Ga0081455_100726173 | 393 |
| 74 | 3300005329 | Ga0070683_100003655 | Ga0070683_1000036557 | 394 |
| 75 | 3300005329 | Ga0070683_100023019 | Ga0070683_1000230192 | 394 |
| 76 | 3300005329 | Ga0070683_100034238 | Ga0070683_1000342383 | 394 |
| 77 | 3300005329 | Ga0070683_100083220 | Ga0070683_1000832202 | 394 |
| 78 | 3300005329 | Ga0070683_100184666 | Ga0070683_1001846661 | 394 |
| 79 | 3300005331 | Ga0070670_100039310 | Ga0070670_1000393103 | 394 |
| 80 | 3300005331 | Ga0070670_100131502 | Ga0070670_1001315021 | 394 |
| 81 | 3300005335 | Ga0070666_10006525 | Ga0070666_100065256 | 394 |
| 82 | 3300005336 | Ga0070680_100008115 | Ga0070680_1000081152 | 394 |
| 83 | 3300005336 | Ga0070680_100009208 | Ga0070680_1000092084 | 394 |
| 84 | 3300005336 | Ga0070680_100034520 | Ga0070680_1000345205 | 394 |
| 85 | 3300005336 | Ga0070680_100168654 | Ga0070680_1001686542 | 394 |
| 86 | 3300005337 | Ga0070682_100049078 | Ga0070682_1000490781 | 394 |
| 87 | 3300005339 | Ga0070660_100023409 | Ga0070660_1000234094 | 394 |
| 88 | 3300005339 | Ga0070660_100030548 | Ga0070660_1000305481 | 394 |
| 89 | 3300005339 | Ga0070660_100089876 | Ga0070660_1000898762 | 394 |
| 90 | 3300005339 | Ga0070660_100125850 | Ga0070660_1001258502 | 394 |
| 91 | 3300005339 | Ga0070660_100289080 | Ga0070660_1002890801 | 394 |
| 92 | 3300005344 | Ga0070661_100116971 | Ga0070661_1001169712 | 394 |
| 93 | 3300005344 | Ga0070661_100196582 | Ga0070661_1001965822 | 394 |
| 94 | 3300005344 | Ga0070661_100256270 | Ga0070661_1002562702 | 394 |
| 95 | 3300005347 | Ga0070668_100035846 | Ga0070668_1000358465 | 394 |
| 96 | 3300005353 | Ga0070669_100038149 | Ga0070669_1000381493 | 394 |
| 97 | 3300005366 | Ga0070659_100003592 | Ga0070659_1000035924 | 394 |
| 98 | 3300005366 | Ga0070659_100006577 | Ga0070659_1000065779 | 394 |
| 99 | 3300005366 | Ga0070659_100017826 | Ga0070659_1000178262 | 394 |
| 100 | 3300005366 | Ga0070659_100064984 | Ga0070659_1000649841 | 394 |
| 101 | 3300005366 | Ga0070659_100176379 | Ga0070659_1001763792 | 394 |
| 102 | 3300005367 | Ga0070667_100028758 | Ga0070667_1000287582 | 394 |
| 103 | 3300005367 | Ga0070667_100121277 | Ga0070667_1001212772 | 394 |
| 104 | 3300005435 | Ga0070714_100056770 | Ga0070714_1000567703 | 394 |
| 105 | 3300005435 | Ga0070714_100243097 | Ga0070714_1002430971 | 394 |
| 106 | 3300005457 | Ga0070662_100001023 | Ga0070662_1000010236 | 394 |
| 107 | 3300005458 | Ga0070681_10019232 | Ga0070681_100192324 | 394 |
| 108 | 3300005458 | Ga0070681_10056998 | Ga0070681_100569983 | 394 |
| 109 | 3300005535 | Ga0070684_100002373 | Ga0070684_1000023733 | 394 |
| 110 | 3300005535 | Ga0070684_100034616 | Ga0070684_1000346161 | 394 |
| 111 | 3300005539 | Ga0068853_100002834 | Ga0068853_10000283411 | 394 |
| 112 | 3300005563 | Ga0068855_100122698 | Ga0068855_1001226983 | 394 |
| 113 | 3300005577 | Ga0068857_100005235 | Ga0068857_10000523511 | 394 |
| 114 | 3300005577 | Ga0068857_100123294 | Ga0068857_1001232942 | 394 |
| 115 | 3300005578 | Ga0068854_100005034 | Ga0068854_10000503411 | 394 |
| 116 | 3300005614 | Ga0068856_100016677 | Ga0068856_1000166772 | 394 |
| 117 | 3300005614 | Ga0068856_100024850 | Ga0068856_1000248501 | 394 |
| 118 | 3300005614 | Ga0068856_100289966 | Ga0068856_1002899661 | 394 |
| 119 | 3300005616 | Ga0068852_100000691 | Ga0068852_10000069114 | 394 |
| 120 | 3300005617 | Ga0068859_100038372 | Ga0068859_1000383723 | 394 |
| 121 | 3300005617 | Ga0068859_100119463 | Ga0068859_1001194633 | 394 |
| 122 | 3300005842 | Ga0068858_100066237 | Ga0068858_1000662373 | 394 |
| 123 | 3300005843 | Ga0068860_100070567 | Ga0068860_1000705672 | 394 |
| 124 | 3300006237 | Ga0097621_100245337 | Ga0097621_1002453372 | 394 |
| 125 | 3300006358 | Ga0068871_100054175 | Ga0068871_1000541752 | 394 |
| 126 | 3300006852 | Ga0075433_10086072 | Ga0075433_100860723 | 394 |
| 127 | 3300006931 | Ga0097620_100038372 | Ga0097620_1000383722 | 394 |
| 128 | 3300006931 | Ga0097620_100119476 | Ga0097620_1001194763 | 394 |
| 129 | 3300009174 | Ga0105241_10155644 | Ga0105241_101556442 | 394 |
| 130 | 3300009177 | Ga0105248_10150174 | Ga0105248_101501742 | 394 |
| 131 | 3300011119 | Ga0105246_10081810 | Ga0105246_100818101 | 394 |
| 132 | 3300013100 | Ga0157373_10003366 | Ga0157373_1000336613 | 394 |
| 133 | 3300013102 | Ga0157371_10015947 | Ga0157371_100159474 | 394 |
| 134 | 3300013102 | Ga0157371_10085341 | Ga0157371_100853412 | 394 |
| 135 | 3300013104 | Ga0157370_10001129 | Ga0157370_1000112919 | 394 |
| 136 | 3300013105 | Ga0157369_10079562 | Ga0157369_100795622 | 394 |
| 137 | 3300013105 | Ga0157369_10422810 | Ga0157369_104228102 | 394 |
| 138 | 3300013307 | Ga0157372_10038097 | Ga0157372_100380978 | 394 |
| 139 | 3300013308 | Ga0157375_10002721 | Ga0157375_100027214 | 394 |
| 140 | 3300017792 | Ga0163161_10041965 | Ga0163161_100419653 | 394 |
| 141 | 3300020070 | Ga0206356_10069298 | Ga0206356_100692981 | 394 |
| 142 | 3300020081 | Ga0206354_10827474 | Ga0206354_108274741 | 394 |
| 143 | 3300021384 | Ga0213876_10008014 | Ga0213876_100080141 | 394 |
| 144 | 3300025315 | Ga0207697_10049499 | Ga0207697_100494992 | 394 |
| 145 | 3300025899 | Ga0207642_10015354 | Ga0207642_100153541 | 394 |
| 146 | 3300025904 | Ga0207647_10000429 | Ga0207647_1000042932 | 394 |
| 147 | 3300025904 | Ga0207647_10000595 | Ga0207647_1000059525 | 394 |
| 148 | 3300025904 | Ga0207647_10081077 | Ga0207647_100810772 | 394 |
| 149 | 3300025907 | Ga0207645_10139022 | Ga0207645_101390222 | 394 |
| 150 | 3300025909 | Ga0207705_10094242 | Ga0207705_100942422 | 394 |
| 151 | 3300025912 | Ga0207707_10060394 | Ga0207707_100603943 | 394 |
| 152 | 3300025913 | Ga0207695_10105972 | Ga0207695_101059721 | 394 |
| 153 | 3300025917 | Ga0207660_10002244 | Ga0207660_100022443 | 394 |
| 154 | 3300025917 | Ga0207660_10037172 | Ga0207660_100371722 | 394 |
| 155 | 3300025917 | Ga0207660_10113249 | Ga0207660_101132492 | 394 |
| 156 | 3300025919 | Ga0207657_10001587 | Ga0207657_1000158712 | 394 |
| 157 | 3300025919 | Ga0207657_10007286 | Ga0207657_1000728610 | 394 |
| 158 | 3300025919 | Ga0207657_10007347 | Ga0207657_1000734715 | 394 |
| 159 | 3300025919 | Ga0207657_10010348 | Ga0207657_1001034812 | 394 |
| 160 | 3300025919 | Ga0207657_10011885 | Ga0207657_1001188511 | 394 |
| 161 | 3300025919 | Ga0207657_10075755 | Ga0207657_100757552 | 394 |
| 162 | 3300025919 | Ga0207657_10139508 | Ga0207657_101395082 | 394 |
| 163 | 3300025920 | Ga0207649_10003670 | Ga0207649_100036701 | 394 |
| 164 | 3300025920 | Ga0207649_10124071 | Ga0207649_101240712 | 394 |
| 165 | 3300025921 | Ga0207652_10041511 | Ga0207652_100415113 | 394 |
| 166 | 3300025921 | Ga0207652_10117782 | Ga0207652_101177822 | 394 |
| 167 | 3300025923 | Ga0207681_10061757 | Ga0207681_100617573 | 394 |
| 168 | 3300025925 | Ga0207650_10049142 | Ga0207650_100491422 | 394 |
| 169 | 3300025929 | Ga0207664_10039514 | Ga0207664_100395145 | 394 |
| 170 | 3300025929 | Ga0207664_10179914 | Ga0207664_101799142 | 394 |
| 171 | 3300025932 | Ga0207690_10002257 | Ga0207690_100022577 | 394 |
| 172 | 3300025932 | Ga0207690_10002893 | Ga0207690_1000289312 | 394 |
| 173 | 3300025932 | Ga0207690_10024292 | Ga0207690_100242922 | 394 |
| 174 | 3300025932 | Ga0207690_10044670 | Ga0207690_100446703 | 394 |
| 175 | 3300025932 | Ga0207690_10090572 | Ga0207690_100905721 | 394 |
| 176 | 3300025932 | Ga0207690_10176425 | Ga0207690_101764251 | 394 |
| 177 | 3300025932 | Ga0207690_10227643 | Ga0207690_102276431 | 394 |
| 178 | 3300025933 | Ga0207706_10000378 | Ga0207706_1000037843 | 394 |
| 179 | 3300025933 | Ga0207706_10006666 | Ga0207706_100066667 | 394 |
| 180 | 3300025933 | Ga0207706_10113371 | Ga0207706_101133712 | 394 |
| 181 | 3300025942 | Ga0207689_10049451 | Ga0207689_100494514 | 394 |
| 182 | 3300025944 | Ga0207661_10015747 | Ga0207661_100157472 | 394 |
| 183 | 3300025944 | Ga0207661_10018654 | Ga0207661_100186543 | 394 |
| 184 | 3300025945 | Ga0207679_10058191 | Ga0207679_100581912 | 394 |
| 185 | 3300025945 | Ga0207679_10280517 | Ga0207679_102805172 | 394 |
| 186 | 3300025949 | Ga0207667_10023306 | Ga0207667_1002330610 | 394 |
| 187 | 3300025949 | Ga0207667_10027008 | Ga0207667_100270083 | 394 |
| 188 | 3300025949 | Ga0207667_10058558 | Ga0207667_100585583 | 394 |
| 189 | 3300025949 | Ga0207667_10179097 | Ga0207667_101790971 | 394 |
| 190 | 3300025949 | Ga0207667_10367205 | Ga0207667_103672051 | 394 |
| 191 | 3300025960 | Ga0207651_10208127 | Ga0207651_102081272 | 394 |
| 192 | 3300025986 | Ga0207658_10015867 | Ga0207658_100158671 | 394 |
| 193 | 3300025986 | Ga0207658_10138430 | Ga0207658_101384302 | 394 |
| 194 | 3300025986 | Ga0207658_10210635 | Ga0207658_102106352 | 394 |
| 195 | 3300026023 | Ga0207677_10051820 | Ga0207677_100518201 | 394 |
| 196 | 3300026035 | Ga0207703_10005590 | Ga0207703_100055909 | 394 |
| 197 | 3300026041 | Ga0207639_10087528 | Ga0207639_100875282 | 394 |
| 198 | 3300026041 | Ga0207639_10132623 | Ga0207639_101326232 | 394 |
| 199 | 3300026067 | Ga0207678_10018512 | Ga0207678_100185129 | 394 |
| 200 | 3300026067 | Ga0207678_10021168 | Ga0207678_100211683 | 394 |
| 201 | 3300026067 | Ga0207678_10103166 | Ga0207678_101031662 | 394 |
| 202 | 3300026078 | Ga0207702_10031062 | Ga0207702_100310621 | 394 |
| 203 | 3300026078 | Ga0207702_10130718 | Ga0207702_101307181 | 394 |
| 204 | 3300026089 | Ga0207648_10017487 | Ga0207648_100174877 | 394 |
| 205 | 3300026089 | Ga0207648_10076916 | Ga0207648_100769163 | 394 |
| 206 | 3300026116 | Ga0207674_10001045 | Ga0207674_1000104544 | 394 |
| 207 | 3300026116 | Ga0207674_10010980 | Ga0207674_1001098012 | 394 |
| 208 | 3300026116 | Ga0207674_10032615 | Ga0207674_100326153 | 394 |
| 209 | 3300026116 | Ga0207674_10178364 | Ga0207674_101783641 | 394 |
| 210 | 3300026121 | Ga0207683_10008132 | Ga0207683_100081324 | 394 |
| 211 | 3300026142 | Ga0207698_10002094 | Ga0207698_100020941 | 394 |
| 212 | 3300027876 | Ga0209974_10000170 | Ga0209974_1000017019 | 394 |
| 213 | 3300028380 | Ga0268265_10125170 | Ga0268265_101251701 | 394 |
| 214 | 3300028380 | Ga0268265_10204538 | Ga0268265_102045382 | 394 |
| 215 | 3300028381 | Ga0268264_10031955 | Ga0268264_100319553 | 394 |
| 216 | 3300031731 | Ga0307405_10109071 | Ga0307405_101090711 | 394 |
| 217 | 3300031824 | Ga0307413_10070897 | Ga0307413_100708971 | 394 |
| 218 | 3300031852 | Ga0307410_10059611 | Ga0307410_100596113 | 394 |
| 219 | 3300031903 | Ga0307407_10023434 | Ga0307407_100234342 | 394 |
| 220 | 3300031903 | Ga0307407_10052269 | Ga0307407_100522692 | 394 |
| 221 | 3300031911 | Ga0307412_10006861 | Ga0307412_100068612 | 394 |
| 222 | 3300031911 | Ga0307412_10034250 | Ga0307412_100342502 | 394 |
| 223 | 3300031995 | Ga0307409_100059520 | Ga0307409_1000595202 | 394 |
| 224 | 3300031995 | Ga0307409_100076538 | Ga0307409_1000765382 | 394 |
| 225 | 3300031995 | Ga0307409_100096147 | Ga0307409_1000961471 | 394 |
| 226 | 3300032002 | Ga0307416_100086249 | Ga0307416_1000862491 | 394 |
| 227 | 3300032002 | Ga0307416_100223917 | Ga0307416_1002239171 | 394 |
| 228 | 3300032004 | Ga0307414_10160710 | Ga0307414_101607102 | 394 |
| 229 | 3300032005 | Ga0307411_10010870 | Ga0307411_100108702 | 394 |
| 230 | 3300032005 | Ga0307411_10167161 | Ga0307411_101671611 | 394 |
| 231 | 3300032126 | Ga0307415_100089401 | Ga0307415_1000894012 | 394 |
| 232 | 3300032126 | Ga0307415_100100813 | Ga0307415_1001008132 | 394 |
| 233 | 3300035170 | Ga0373943_0003479 | Ga0373943_0003479_4167_5351 | 394 |
| 234 | 3300035692 | Ga0373935_0048770 | Ga0373935_0048770_1236_2420 | 394 |
| 235 | 3300037068 | Ga0373925_0009605 | Ga0373925_0009605_88_1272 | 394 |
| 236 | 3300037312 | Ga0395899_0004663 | Ga0395899_0004663_3268_4452 | 394 |
| 237 | 3300037312 | Ga0395899_0028259 | Ga0395899_0028259_814_2010 | 394 |
| 238 | 3300037312 | Ga0395899_0097689 | Ga0395899_0097689_232_1428 | 394 |
| 239 | 3300037418 | Ga0395900_0007276 | Ga0395900_0007276_2006_3190 | 394 |
| 240 | 3300037418 | Ga0395900_0013525 | Ga0395900_0013525_6834_8030 | 394 |
| 241 | 3300037418 | Ga0395900_0013743 | Ga0395900_0013743_6481_7677 | 394 |
| 242 | 3300037418 | Ga0395900_0013981 | Ga0395900_0013981_1292_2476 | 394 |
| 243 | 3300037418 | Ga0395900_0031245 | Ga0395900_0031245_978_2174 | 394 |
| 244 | 3300037418 | Ga0395900_0227401 | Ga0395900_0227401_429_1613 | 394 |
| 245 | 3300037418 | Ga0395900_0309104 | Ga0395900_0309104_88_1272 | 394 |
| 246 | 3300037418 | Ga0395900_0368048 | Ga0395900_0368048_166_1362 | 394 |
| 247 | 3300037466 | Ga0395898_0036094 | Ga0395898_0036094_2841_4037 | 394 |
| 248 | 3300037466 | Ga0395898_0058842 | Ga0395898_0058842_323_1519 | 394 |
| 249 | 3300037471 | Ga0395905_0003412 | Ga0395905_0003412_8381_9565 | 394 |
| 250 | 3300037471 | Ga0395905_0005762 | Ga0395905_0005762_5647_6831 | 394 |
| 251 | 3300037471 | Ga0395905_0013020 | Ga0395905_0013020_2300_3496 | 394 |
| 252 | 3300037471 | Ga0395905_0018147 | Ga0395905_0018147_4438_5622 | 394 |
| 253 | 3300037471 | Ga0395905_0037710 | Ga0395905_0037710_2536_3732 | 394 |
| 254 | 3300037471 | Ga0395905_0067490 | Ga0395905_0067490_1520_2704 | 394 |
| 255 | 3300037471 | Ga0395905_0076046 | Ga0395905_0076046_1859_3055 | 394 |
| 256 | 3300037471 | Ga0395905_0115055 | Ga0395905_0115055_588_1784 | 394 |
| 257 | 3300037471 | Ga0395905_0131321 | Ga0395905_0131321_1041_2240 | 394 |
| 258 | 3300037471 | Ga0395905_0197523 | Ga0395905_0197523_33_1229 | 394 |
| 259 | 3300038443 | Ga0395901_0010989 | Ga0395901_0010989_4761_5945 | 394 |
| 260 | 3300038443 | Ga0395901_0039131 | Ga0395901_0039131_1423_2619 | 394 |
| 261 | 3300038443 | Ga0395901_0072747 | Ga0395901_0072747_1943_3139 | 394 |
| 262 | 3300038443 | Ga0395901_0101227 | Ga0395901_0101227_606_1802 | 394 |
| 263 | 3300038443 | Ga0395901_0178289 | Ga0395901_0178289_788_1984 | 394 |
| 264 | 3300038443 | Ga0395901_0241866 | Ga0395901_0241866_448_1632 | 394 |
| 265 | 3300038443 | Ga0395901_0451530 | Ga0395901_0451530_96_1292 | 394 |
| 266 | 3300039437 | Ga0436365_0503355 | Ga0436365_0503355_2373_3569 | 394 |
| 267 | 3300044693 | Ga0466961_0029639 | Ga0466961_0029639_1275_2459 | 394 |
| 268 | 3300044693 | Ga0466961_0044822 | Ga0466961_0044822_472_1668 | 394 |
| 269 | 3300044694 | Ga0466963_0002442 | Ga0466963_0002442_2288_3484 | 394 |
| 270 | 3300044694 | Ga0466963_0004930 | Ga0466963_0004930_1585_2769 | 394 |
| 271 | 3300044694 | Ga0466963_0042376 | Ga0466963_0042376_350_1570 | 394 |
| 272 | 3300044842 | Ga0466957_0014614 | Ga0466957_0014614_1687_2871 | 394 |
| 273 | 3300044842 | Ga0466957_0026925 | Ga0466957_0026925_2112_3308 | 394 |
| 274 | 3300045049 | Ga0466959_0028108 | Ga0466959_0028108_1910_3106 | 394 |
| 275 | 3300045836 | Ga0466958_0052622 | Ga0466958_0052622_1227_2423 | 394 |
| 276 | 3300045976 | Ga0466967_0003430 | Ga0466967_0003430_8190_9386 | 394 |
| 277 | 3300045976 | Ga0466967_0032441 | Ga0466967_0032441_685_1869 | 394 |
| 278 | 3300045976 | Ga0466967_0310805 | Ga0466967_0310805_288_1490 | 394 |
| 279 | 3300045976 | Ga0466967_0338743 | Ga0466967_0338743_170_1366 | 394 |
| 280 | 3300046616 | Ga0495668_0072611 | Ga0495668_0072611_481_1674 | 394 |
| 281 | 3300046684 | Ga0495669_0008239 | Ga0495669_0008239_2988_4181 | 394 |
| 282 | 3300048910 | Ga0496107_0033421 | Ga0496107_0033421_1390_2580 | 394 |
| 283 | 3300048914 | Ga0496111_0062983 | Ga0496111_0062983_455_1645 | 394 |
| 284 | 3300050512 | nmdc:mga0n895_113381_c1 | nmdc:mga0n895_113381_c1_184_1371 | 394 |
| 285 | 3300050515 | nmdc:mga0a205_1107_c1 | nmdc:mga0a205_1107_c1_20081_21268 | 394 |
| 286 | 3300053134 | Ga0500658_0000081 | Ga0500658_0000081_6380_7573 | 394 |
| 287 | 3300061719 | Ga0466962_0106678 | Ga0466962_0106678_132_1316 | 394 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6cgq-assembly1.cif.gz_B-2 | threonine synthase from bacillus subtilis atcc 6633 with plp and plp-ala | 0.9208 | 51 | 374 |
| 2c2b-assembly2.cif.gz_C | crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine | 0.887 | 1 | 374 |
| 1o58-assembly1.cif.gz_B | crystal structure of o-acetylserine sulfhydrylase (tm0665) from thermotoga maritima at 1.80 a resolution | 0.8817 | 76 | 375 |
| 2zsj-assembly2.cif.gz_D | crystal structure of threonine synthase from aquifex aeolicus vf5 | 0.8785 | 51 | 374 |
| 6cgq-assembly1.cif.gz_A | threonine synthase from bacillus subtilis atcc 6633 with plp and plp-ala | 0.8752 | 54 | 386 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6M0B0_306_515_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9529 | 210 | 372 | 3.40.50.1100 |
| 4d9gB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9194 | 120 | 193 | 3.40.50.1100 |
| af_Q9SSP5_269_516_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9051 | 172 | 366 | 3.40.50.1100 |
| 3x44B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9003 | 103 | 194 | 3.40.50.1100 |
| 2jc3H02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9003 | 103 | 196 | 3.40.50.1100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535BMY9-F1-model_v4 | Pyridoxal-phosphate dependent enzyme | 0.9931 | 211 | 318 |
|
| AF-A0A535BMY9-F1-model_v4 | Pyridoxal-phosphate dependent enzyme | 0.9841 | 211 | 318 |
|
| AF-A0A7G9KZE0-F1-model_v4 | Threonine synthase (EC 4.2.3.1) | 0.9838 | 1 | 393 |
GO:0003941
GO:0004794 GO:0004795 GO:0006565 GO:0006567 GO:0009097 GO:0030170 |
| AF-A0A1F4XAE0-F1-model_v4 | Tryptophan synthase beta chain-like PALP domain-containing protein | 0.9835 | 266 | 368 |
|
| AF-A0A7G9KZE0-F1-model_v4 | Threonine synthase (EC 4.2.3.1) | 0.9789 | 1 | 393 |
GO:0003941
GO:0004794 GO:0004795 GO:0006565 GO:0006567 GO:0009097 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar