F388226

General Info

Members Datasets Scaffolds Average Seq Length
287 227 234 555

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0062015|Ga0496117_0062015_170_2101
Length 610
Sequence LISLFVIGFTIRKSKDLSPIKKSGVRAPATAPFPESNQQAARSETWRLTASGRSSAGIDYQXLKFEYRPRAARAAGDDAVIHPVIVVGAGPVGLSAAIDLAQQGVPVVLLDDDDTLSTGSRAICFAKRTLEIFDRLGCGERFVEKGVSWHVGKVFLQDEQLYAFDLLPEEGHARPAFINLQQYYVEGYLAERAFELPNLEIRWKHKVTGVAQSAEHAALTVETPEGIETLHARYVIAADGSRSPMRAAMGLESRGRTFKDRFLIADVKMKAEFPTERWFWFDPPFHRNQSVLLHRQPDNVWRIDFQLGWDADPVAEKQPERVIPRVRALLGADVEFELEWVSVYTFRCQRMDTFRHGRVLFAGDSAHGVSPFGARGANSGVQDADNLAWKLKLVLDGRADDRLLDTYASEREFAADENIRNSTRSTDFITPKSAVSRVFRDATLKLARDCEFARKLVNSGRLSVPAVLADSPLNTPDRNGDAFACAMRPGAAAADAPVREQGASGWLLQHLGDGFAGVLFGLPADAAALVQALDGLALPVRPVLIVPAGHAQPVAGVDVVEDVDGFAAQRYDAQPGTFYLLRPDQHVCARMRTLERQAIADALARATCAR

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
8 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
9 2519103095 Burkholderia sp. KJ006 Isolate Nodule
10 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
11 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
12 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
13 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
14 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
15 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
16 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
17 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
18 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
19 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
20 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
21 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
22 2818991452 Burkholderia cepacia 561 Isolate Unclassified
23 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
24 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
25 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
26 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
27 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
28 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
29 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
30 2904564687 Burkholderia sp. 571 Isolate Unclassified
31 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
32 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
33 2928163908 Burkholderia sp. 567 Isolate Unclassified
34 2928170801 Burkholderia sp. 572 Isolate Unclassified
35 2928536128 Burkholderia sola 565 Isolate Unclassified
36 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
37 2929520902 Variovorax beijingensis 502 Isolate Unclassified
38 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
39 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
40 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
41 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
42 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
43 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
44 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
45 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
46 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
48 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
49 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
50 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
51 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
52 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
53 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
54 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
55 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
56 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
148 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
164 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
165 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
166 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
167 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
207 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
208 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
209 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
210 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
211 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
212 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
213 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
214 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
217 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
218 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
219 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
220 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
221 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
222 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
223 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
224 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
225 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
226 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
227 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 81.53
Metatranscriptomes 0
Isolates 18.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.21
Nodule 3.14
Rhizoplane 2.09
Rhizosphere 54.36
Stem 0
Stem Tuber 0
Unclassified 20.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10013501 3300001989 Bacteria 2982
2 JGI25156J39149_1000064 3300002705 Bacteria 83982
3 JGI25157J39369_1000083 3300002741 Bacteria 84002
4 JGI25150J39212_1002560 3300002774 Bacteria 4482
5 JGI25406J46586_10003630 3300003203 Bacteria 7240
6 Ga0055532_1001472 3300003758 Bacteria 6531
7 Ga0055532_1002905 3300003758 Bacteria 3243
8 Ga0055532_1003276 3300003758 Bacteria 2862
9 Ga0055527_1000988 3300003760 Bacteria 6923
10 Ga0055535_1000632 3300003761 Bacteria 28125
11 Ga0055535_1002309 3300003761 Bacteria 6974
12 Ga0055535_1002319 3300003761 Bacteria 6923
13 Ga0055542_1002195 3300003762 Bacteria 6974
14 Ga0055529_1001056 3300003763 Bacteria 12764
15 Ga0055529_1001109 3300003763 Bacteria 11958
16 Ga0055529_1001176 3300003763 Bacteria 10681
17 Ga0055537_1000024 3300003773 Bacteria 111410
18 Ga0055534_1000032 3300003784 Bacteria 118890
19 Ga0055528_1003131 3300003790 Bacteria 8487
20 Ga0055528_1004537 3300003790 Bacteria 6663
21 Ga0058692_1000957 3300003856 Bacteria 11362
22 Ga0065714_10065020 3300005288 Bacteria 13888
23 Ga0068869_100047384 3300005334 Bacteria 3104
24 Ga0070660_100000008 3300005339 Bacteria 155650
25 Ga0070674_100002745 3300005356 Bacteria 9731
26 Ga0070659_100000087 3300005366 Bacteria 69724
27 Ga0070667_100030341 3300005367 Bacteria 4509
28 Ga0070709_10048599 3300005434 Bacteria 2648
29 Ga0070714_100015999 3300005435 Bacteria 6048
30 Ga0070713_100043244 3300005436 Bacteria 3682
31 Ga0068867_100013402 3300005459 Bacteria 5809
32 Ga0068867_100111547 3300005459 Bacteria 2102
33 Ga0070706_100122615 3300005467 Bacteria 2423
34 Ga0070672_100049062 3300005543 Bacteria 3283
35 Ga0070665_100004978 3300005548 Bacteria 13778
36 Ga0070665_100068262 3300005548 Bacteria 3565
37 Ga0070665_100083845 3300005548 Bacteria 3192
38 Ga0068855_100104939 3300005563 Bacteria 3250
39 Ga0068857_100008364 3300005577 Bacteria 8940
40 Ga0068856_100000510 3300005614 Bacteria 42987
41 Ga0068859_100082703 3300005617 Bacteria 3253
42 Ga0068862_100044132 3300005844 Bacteria 3803
43 Ga0081539_10001256 3300005985 Bacteria 45022
44 Ga0070716_100002620 3300006173 Bacteria 8313
45 Ga0075362_10034863 3300006177 Bacteria 2195
46 Ga0075366_10001796 3300006195 Bacteria 10840
47 Ga0075370_10000553 3300006353 Bacteria 14337
48 Ga0075431_100201296 3300006847 Bacteria 2037
49 Ga0097620_100082706 3300006931 Bacteria 3253
50 Ga0099826_10000060 3300006948 Bacteria 63334
51 Ga0099826_10051062 3300006948 Bacteria 2776
52 Ga0105250_10008182 3300009092 Bacteria 4453
53 Ga0105240_10006071 3300009093 Bacteria 17841
54 Ga0105240_10009840 3300009093 Bacteria 13495
55 Ga0105240_10118787 3300009093 Bacteria 3186
56 Ga0114129_10007104 3300009147 Bacteria 15933
57 Ga0114129_10027130 3300009147 Bacteria 8108
58 Ga0114129_10138998 3300009147 Bacteria 3331
59 Ga0105243_10066528 3300009148 Bacteria 2898
60 Ga0105249_10032533 3300009553 Bacteria 4719
61 Ga0157369_10028943 3300013105 Bacteria 6127
62 Ga0157378_10003514 3300013297 Bacteria 13898
63 Ga0157375_10043774 3300013308 Bacteria 4344
64 Ga0157380_10016567 3300014326 Bacteria 5438
65 Ga0182008_10004794 3300014497 Bacteria 7822
66 Ga0157379_10024806 3300014968 Bacteria 5323
67 Ga0182006_1002898 3300015261 Bacteria 9111
68 Ga0182007_10002911 3300015262 Bacteria 8318
69 Ga0182007_10015991 3300015262 Bacteria 2780
70 Ga0182005_1009511 3300015265 Bacteria 2828
71 Ga0209566_100170 3300025225 Bacteria 70792
72 Ga0209672_100028 3300025228 Bacteria 341962
73 Ga0209672_100038 3300025228 Bacteria 286731
74 Ga0209672_101689 3300025228 Bacteria 7136
75 Ga0209147_100112 3300025229 Bacteria 145046
76 Ga0209147_100117 3300025229 Bacteria 143852
77 Ga0209147_100488 3300025229 Bacteria 23706
78 Ga0209258_100109 3300025242 Bacteria 203881
79 Ga0209258_100112 3300025242 Bacteria 192884
80 Ga0209258_100424 3300025242 Bacteria 49640
81 Ga0209258_100453 3300025242 Bacteria 45277
82 Ga0207425_1000125 3300025245 Bacteria 72177
83 Ga0209646_1000129 3300025246 Bacteria 129401
84 Ga0209026_1000059 3300025250 Bacteria 226652
85 Ga0209677_100126 3300025253 Bacteria 78655
86 Ga0209148_1001535 3300025254 Bacteria 11240
87 Ga0209148_1002458 3300025254 Bacteria 6366
88 Ga0209759_1000081 3300025256 Bacteria 169943
89 Ga0209759_1001564 3300025256 Bacteria 12493
90 Ga0209565_1000039 3300025263 Bacteria 278026
91 Ga0209455_1000050 3300025272 Bacteria 373239
92 Ga0209455_1000157 3300025272 Bacteria 119719
93 Ga0209455_1000534 3300025272 Bacteria 26400
94 Ga0209455_1000752 3300025272 Bacteria 18442
95 Ga0209673_1000038 3300025273 Bacteria 312957
96 Ga0209673_1000284 3300025273 Bacteria 94932
97 Ga0209675_1000030 3300025291 Bacteria 278026
98 Ga0209675_1002245 3300025291 Bacteria 10094
99 Ga0209025_1002265 3300025294 Bacteria 21074
100 Ga0209758_1000679 3300025297 Bacteria 50729
101 Ga0207696_1008997 3300025711 Bacteria 3754
102 Ga0207688_10029398 3300025901 Bacteria 3025
103 Ga0207647_10019558 3300025904 Bacteria 4553
104 Ga0207705_10051380 3300025909 Bacteria 2967
105 Ga0207695_10001729 3300025913 Bacteria 34817
106 Ga0207695_10005596 3300025913 Bacteria 16596
107 Ga0207695_10021168 3300025913 Bacteria 7427
108 Ga0207695_10075687 3300025913 Bacteria 3424
109 Ga0207657_10000337 3300025919 Bacteria 49613
110 Ga0207694_10006796 3300025924 Bacteria 8683
111 Ga0207659_10005559 3300025926 Bacteria 7649
112 Ga0207700_10000004 3300025928 Bacteria 443409
113 Ga0207700_10002510 3300025928 Bacteria 10523
114 Ga0207700_10031817 3300025928 Bacteria 3753
115 Ga0207664_10001046 3300025929 Bacteria 18542
116 Ga0207690_10000006 3300025932 Bacteria 433880
117 Ga0207706_10000544 3300025933 Bacteria 39990
118 Ga0207709_10047873 3300025935 Bacteria 2602
119 Ga0207669_10041860 3300025937 Bacteria 2670
120 Ga0207665_10009860 3300025939 Bacteria 6268
121 Ga0207691_10008195 3300025940 Bacteria 10037
122 Ga0207689_10062171 3300025942 Bacteria 3070
123 Ga0207667_10026684 3300025949 Bacteria 6305
124 Ga0207667_10199998 3300025949 Bacteria 2050
125 Ga0207712_10032586 3300025961 Bacteria 3518
126 Ga0207639_10013039 3300026041 Bacteria 5803
127 Ga0207678_10000228 3300026067 Bacteria 49958
128 Ga0207702_10001084 3300026078 Bacteria 27885
129 Ga0207648_10000190 3300026089 Bacteria 64762
130 Ga0207648_10025808 3300026089 Bacteria 5228
131 Ga0207674_10004452 3300026116 Bacteria 16839
132 Ga0207675_100002430 3300026118 Bacteria 18452
133 Ga0209371_1000090 3300027312 Bacteria 173119
134 Ga0209282_1000200 3300027666 Bacteria 32028
135 Ga0209974_10007194 3300027876 Bacteria 3844
136 Ga0268266_10048942 3300028379 Bacteria 3623
137 Ga0268265_10044695 3300028380 Bacteria 3300
138 Ga0268264_10037631 3300028381 Bacteria 3989
139 Ga0265336_10000008 3300028666 Bacteria 336082
140 Ga0307515_10000332 3300028794 Bacteria 116126
141 Ga0307515_10003326 3300028794 Bacteria 33975
142 Ga0307515_10012210 3300028794 Bacteria 16189
143 Ga0307515_10028818 3300028794 Bacteria 9418
144 Ga0307515_10059888 3300028794 Bacteria 5446
145 Ga0265338_10002854 3300028800 Bacteria 25255
146 Ga0265324_10000871 3300029957 Bacteria 19320
147 Ga0268256_1000115 3300030500 Bacteria 116918
148 Ga0307512_10051189 3300030522 Bacteria 3307
149 Ga0307512_10054292 3300030522 Bacteria 3175
150 Ga0307513_10047156 3300031456 Bacteria 4689
151 Ga0307513_10116318 3300031456 Bacteria 2654
152 Ga0307509_10008176 3300031507 Bacteria 13398
153 Ga0307509_10044322 3300031507 Bacteria 4808
154 Ga0307509_10063084 3300031507 Bacteria 3903
155 Ga0307509_10070293 3300031507 Bacteria 3656
156 Ga0307508_10005499 3300031616 Bacteria 12042
157 Ga0307508_10083604 3300031616 Bacteria 2774
158 Ga0307514_10003838 3300031649 Bacteria 14140
159 Ga0307516_10004749 3300031730 Bacteria 16588
160 Ga0307412_10063732 3300031911 Bacteria 2488
161 Ga0307409_100098727 3300031995 Bacteria 2416
162 Ga0307507_10063668 3300033179 Bacteria 3411
163 Ga0307510_10005618 3300033180 Bacteria 14948
164 Ga0307510_10072136 3300033180 Bacteria 3432
165 Ga0307510_10106099 3300033180 Bacteria 2574
166 Ga0316584_0017152 3300036712 Bacteria 5201
167 Ga0373925_0004630 3300037068 Bacteria 10383
168 Ga0395900_0004048 3300037418 Bacteria 15637
169 Ga0395900_0022924 3300037418 Bacteria 6388
170 Ga0395905_0004949 3300037471 Bacteria 13728
171 Ga0395905_0035033 3300037471 Bacteria 4713
172 Ga0395901_0000043 3300038443 Bacteria 197397
173 Ga0395901_0004563 3300038443 Bacteria 13982
174 Ga0395901_0009297 3300038443 Bacteria 9962
175 Ga0451793_0623531 3300041452 Bacteria 2831
176 Ga0450920_003841 3300042122 Bacteria 2616
177 Ga0450921_000236 3300042123 Bacteria 2302
178 Ga0450906_004325 3300042145 Bacteria 2981
179 Ga0450908_001230 3300042184 Bacteria 4963
180 Ga0466972_0001691 3300044658 Bacteria 10798
181 Ga0466966_0000063 3300044684 Bacteria 74180
182 Ga0466966_0000475 3300044684 Bacteria 25816
183 Ga0466961_0001093 3300044693 Bacteria 16671
184 Ga0466961_0056892 3300044693 Bacteria 2491
185 Ga0466963_0034517 3300044694 Bacteria 3291
186 Ga0466971_0003234 3300044719 Bacteria 6954
187 Ga0466958_0004267 3300045836 Bacteria 7520
188 Ga0495592_0004544 3300046454 Bacteria 10162
189 Ga0495651_0000657 3300046462 Bacteria 26772
190 Ga0495580_0004669 3300046472 Bacteria 11492
191 Ga0495580_0016167 3300046472 Bacteria 5608
192 Ga0495608_0006214 3300046511 Bacteria 8479
193 Ga0495620_0010426 3300046515 Bacteria 4905
194 Ga0495628_0000037 3300046516 Bacteria 109854
195 Ga0495643_0023982 3300046522 Bacteria 3463
196 Ga0495652_0005170 3300046529 Bacteria 12339
197 Ga0495625_0000224 3300046660 Bacteria 89521
198 Ga0495623_0003620 3300046679 Bacteria 10214
199 Ga0495674_0005290 3300047319 Bacteria 12378
200 Ga0495686_0001817 3300047472 Bacteria 21551
201 Ga0495602_0004236 3300048088 Bacteria 14924
202 Ga0496102_0143982 3300048905 Bacteria 2236
203 Ga0496116_0002163 3300048919 Bacteria 20930
204 Ga0496117_0002723 3300048920 Bacteria 21716
205 Ga0496117_0062015 3300048920 Bacteria 2565
206 Ga0496118_0016171 3300048921 Bacteria 6859
207 Ga0496121_0092740 3300048924 Bacteria 2353
208 Ga0496124_0000013 3300048927 Bacteria 484884
209 Ga0496126_0000061 3300048929 Bacteria 261515
210 Ga0501031_0000893 3300049568 Bacteria 17996
211 Ga0501033_0034804 3300049570 Bacteria 3776
212 Ga0501034_0031483 3300049571 Bacteria 5387
213 Ga0501036_0019367 3300049572 Bacteria 5712
214 Ga0501038_0017358 3300049574 Bacteria 6505
215 Ga0501070_0006960 3300049586 Bacteria 9619
216 Ga0501083_0056155 3300049744 Bacteria 2639
217 Ga0501035_0223851 3300049822 Bacteria 1605
218 Ga0501044_0000185 3300049823 Bacteria 77663
219 Ga0501044_0033166 3300049823 Bacteria 5427
220 nmdc:mga0k408_10331_c1 3300050493 Bacteria 5048
221 nmdc:mga0k408_18870_c1 3300050493 Bacteria 3850
222 nmdc:mga0k408_26627_c1 3300050493 Bacteria 3280
223 nmdc:mga07m45_3895_c1 3300050496 Bacteria 7247
224 nmdc:mga05p37_20944_c1 3300050507 Bacteria 7914
225 Ga0500610_0000021 3300053079 Bacteria 66361
226 Ga0500635_0000029 3300053080 Bacteria 100914
227 Ga0500646_0000088 3300053090 Bacteria 26075
228 Ga0500651_0000136 3300053093 Bacteria 45911
229 Ga0500593_000411 3300053117 Bacteria 16935
230 Ga0500607_000674 3300053121 Bacteria 32958
231 Ga0500559_0000019 3300053136 Bacteria 134862
232 Ga0500627_0000237 3300053158 Bacteria 15710
233 Ga0500634_0041907 3300053161 Bacteria 2485
234 Ga0466962_0003474 3300061719 Bacteria 7513

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0223851 Ga0501035_0223851_122_1567 452
2 3300009147 Ga0114129_10007104 Ga0114129_100071043 475
3 3300031995 Ga0307409_100098727 Ga0307409_1000987272 487
4 3300053093 Ga0500651_0000136 Ga0500651_0000136_4384_6027 498
5 3300049744 Ga0501083_0056155 Ga0501083_0056155_125_1741 499
6 3300005985 Ga0081539_10001256 Ga0081539_1000125626 508
7 3300006173 Ga0070716_100002620 Ga0070716_1000026206 508
8 3300025939 Ga0207665_10009860 Ga0207665_100098603 508
9 3300053090 Ga0500646_0000088 Ga0500646_0000088_4287_5879 508
10 3300005434 Ga0070709_10048599 Ga0070709_100485992 510
11 3300025928 Ga0207700_10000004 Ga0207700_10000004189 510
12 3300005436 Ga0070713_100043244 Ga0070713_1000432441 511
13 3300025928 Ga0207700_10031817 Ga0207700_100318172 511
14 3300042184 Ga0450908_001230 Ga0450908_001230_11_1570 512
15 iso_pu_bacteria 2935390628 2935394951 512
16 3300044658 Ga0466972_0001691 Ga0466972_0001691_3950_5569 513
17 3300005548 Ga0070665_100068262 Ga0070665_1000682622 516
18 3300006847 Ga0075431_100201296 Ga0075431_1002012962 516
19 3300009147 Ga0114129_10138998 Ga0114129_101389983 516
20 3300025926 Ga0207659_10005559 Ga0207659_100055594 516
21 3300031911 Ga0307412_10063732 Ga0307412_100637322 518
22 3300009147 Ga0114129_10027130 Ga0114129_100271303 520
23 3300050507 nmdc:mga05p37_20944_c1 nmdc:mga05p37_20944_c1_4893_6494 520
24 3300028666 Ga0265336_10000008 Ga0265336_1000000830 524
25 3300029957 Ga0265324_10000871 Ga0265324_1000087112 524
26 3300031456 Ga0307513_10116318 Ga0307513_101163181 524
27 3300014497 Ga0182008_10004794 Ga0182008_100047943 526
28 3300005467 Ga0070706_100122615 Ga0070706_1001226152 527
29 3300025291 Ga0209675_1002245 Ga0209675_10022452 528
30 3300033180 Ga0307510_10005618 Ga0307510_1000561810 528
31 iso_pu_bacteria 2945984333 2945989044 529
32 3300005563 Ga0068855_100104939 Ga0068855_1001049392 530
33 3300025901 Ga0207688_10029398 Ga0207688_100293983 531
34 3300025933 Ga0207706_10000544 Ga0207706_1000054432 531
35 3300026089 Ga0207648_10025808 Ga0207648_100258084 531
36 3300036712 Ga0316584_0017152 Ga0316584_0017152_947_2572 531
37 3300030522 Ga0307512_10051189 Ga0307512_100511893 532
38 3300003203 JGI25406J46586_10003630 JGI25406J46586_100036301 534
39 3300003773 Ga0055537_1000024 Ga0055537_1000024101 534
40 3300003784 Ga0055534_1000032 Ga0055534_1000032107 534
41 3300003790 Ga0055528_1004537 Ga0055528_10045375 534
42 3300006948 Ga0099826_10000060 Ga0099826_100000602 534
43 3300025263 Ga0209565_1000039 Ga0209565_1000039107 534
44 3300025273 Ga0209673_1000284 Ga0209673_100028423 534
45 3300025291 Ga0209675_1000030 Ga0209675_1000030107 534
46 3300027666 Ga0209282_1000200 Ga0209282_10002002 534
47 iso_pu_bacteria 2643221628 2644159032 534
48 3300002705 JGI25156J39149_1000064 JGI25156J39149_10000649 535
49 3300002741 JGI25157J39369_1000083 JGI25157J39369_10000839 535
50 3300005334 Ga0068869_100047384 Ga0068869_1000473842 535
51 3300005577 Ga0068857_100008364 Ga0068857_1000083643 535
52 3300005614 Ga0068856_100000510 Ga0068856_1000005104 535
53 3300013105 Ga0157369_10028943 Ga0157369_100289435 535
54 3300025242 Ga0209258_100424 Ga0209258_10042442 535
55 3300025246 Ga0209646_1000129 Ga0209646_100012953 535
56 3300025250 Ga0209026_1000059 Ga0209026_100005957 535
57 3300025253 Ga0209677_100126 Ga0209677_10012642 535
58 3300025256 Ga0209759_1000081 Ga0209759_100008197 535
59 3300025913 Ga0207695_10005596 Ga0207695_100055963 535
60 3300025942 Ga0207689_10062171 Ga0207689_100621712 535
61 3300025949 Ga0207667_10199998 Ga0207667_101999981 535
62 3300026078 Ga0207702_10001084 Ga0207702_1000108430 535
63 3300026116 Ga0207674_10004452 Ga0207674_100044527 535
64 3300037418 Ga0395900_0022924 Ga0395900_0022924_419_2092 536
65 iso_pu_bacteria 2929199973 2929202803 536
66 iso_pu_bacteria 8055909800 8055912095 536
67 3300006948 Ga0099826_10051062 Ga0099826_100510622 537
68 3300046515 Ga0495620_0010426 Ga0495620_0010426_2554_4224 537
69 3300049568 Ga0501031_0000893 Ga0501031_0000893_12329_14086 537
70 3300049570 Ga0501033_0034804 Ga0501033_0034804_1023_2780 537
71 3300049571 Ga0501034_0031483 Ga0501034_0031483_2382_4139 537
72 3300049572 Ga0501036_0019367 Ga0501036_0019367_2270_4027 537
73 3300049574 Ga0501038_0017358 Ga0501038_0017358_3475_5232 537
74 3300049586 Ga0501070_0006960 Ga0501070_0006960_4474_6231 537
75 3300049823 Ga0501044_0033166 Ga0501044_0033166_1417_3174 537
76 3300050493 nmdc:mga0k408_26627_c1 nmdc:mga0k408_26627_c1_363_1997 537
77 3300053079 Ga0500610_0000021 Ga0500610_0000021_57441_59111 537
78 3300053117 Ga0500593_000411 Ga0500593_000411_626_2296 537
79 3300053121 Ga0500607_000674 Ga0500607_000674_11911_13581 537
80 3300053158 Ga0500627_0000237 Ga0500627_0000237_1060_2730 537
81 3300053161 Ga0500634_0041907 Ga0500634_0041907_266_1936 537
82 iso_pu_bacteria 2929520902 2929524922 537
83 iso_pu_bacteria 2945945610 2945947547 537
84 3300003761 Ga0055535_1000632 Ga0055535_100063212 538
85 3300003763 Ga0055529_1001056 Ga0055529_10010566 538
86 3300005288 Ga0065714_10065020 Ga0065714_1006502014 538
87 3300005356 Ga0070674_100002745 Ga0070674_1000027459 538
88 3300005367 Ga0070667_100030341 Ga0070667_1000303415 538
89 3300005435 Ga0070714_100015999 Ga0070714_1000159994 538
90 3300005459 Ga0068867_100111547 Ga0068867_1001115473 538
91 3300005543 Ga0070672_100049062 Ga0070672_1000490622 538
92 3300005548 Ga0070665_100004978 Ga0070665_1000049786 538
93 3300006177 Ga0075362_10034863 Ga0075362_100348632 538
94 3300006353 Ga0075370_10000553 Ga0075370_1000055314 538
95 3300009148 Ga0105243_10066528 Ga0105243_100665281 538
96 3300025242 Ga0209258_100453 Ga0209258_10045319 538
97 3300025256 Ga0209759_1001564 Ga0209759_100156412 538
98 3300025272 Ga0209455_1000157 Ga0209455_100015722 538
99 3300025928 Ga0207700_10002510 Ga0207700_100025104 538
100 3300025929 Ga0207664_10001046 Ga0207664_1000104612 538
101 3300025935 Ga0207709_10047873 Ga0207709_100478732 538
102 3300025937 Ga0207669_10041860 Ga0207669_100418603 538
103 3300025940 Ga0207691_10008195 Ga0207691_100081953 538
104 3300042122 Ga0450920_003841 Ga0450920_003841_67_1704 538
105 3300042123 Ga0450921_000236 Ga0450921_000236_546_2183 538
106 3300042145 Ga0450906_004325 Ga0450906_004325_538_2175 538
107 3300044684 Ga0466966_0000475 Ga0466966_0000475_14941_16632 538
108 3300046660 Ga0495625_0000224 Ga0495625_0000224_55209_56846 538
109 3300050493 nmdc:mga0k408_18870_c1 nmdc:mga0k408_18870_c1_657_2327 538
110 3300050496 nmdc:mga07m45_3895_c1 nmdc:mga07m45_3895_c1_4350_6017 538
111 3300053080 Ga0500635_0000029 Ga0500635_0000029_56500_58173 538
112 3300028794 Ga0307515_10003326 Ga0307515_1000332613 539
113 3300031507 Ga0307509_10070293 Ga0307509_100702933 539
114 3300031616 Ga0307508_10005499 Ga0307508_100054999 539
115 3300031649 Ga0307514_10003838 Ga0307514_100038389 539
116 3300033179 Ga0307507_10063668 Ga0307507_100636683 539
117 3300046472 Ga0495580_0016167 Ga0495580_0016167_821_2446 541
118 3300009093 Ga0105240_10009840 Ga0105240_100098403 542
119 3300025913 Ga0207695_10021168 Ga0207695_100211685 542
120 3300026041 Ga0207639_10013039 Ga0207639_100130392 542
121 3300047472 Ga0495686_0001817 Ga0495686_0001817_12465_14144 542
122 3300005548 Ga0070665_100083845 Ga0070665_1000838452 543
123 3300028379 Ga0268266_10048942 Ga0268266_100489423 543
124 3300028794 Ga0307515_10028818 Ga0307515_100288187 543
125 3300030522 Ga0307512_10054292 Ga0307512_100542922 543
126 3300031456 Ga0307513_10047156 Ga0307513_100471562 543
127 3300031507 Ga0307509_10008176 Ga0307509_100081769 543
128 3300031507 Ga0307509_10044322 Ga0307509_100443223 543
129 3300031507 Ga0307509_10063084 Ga0307509_100630843 543
130 3300031616 Ga0307508_10083604 Ga0307508_100836043 543
131 3300033180 Ga0307510_10072136 Ga0307510_100721363 543
132 3300033180 Ga0307510_10106099 Ga0307510_101060993 543
133 3300046454 Ga0495592_0004544 Ga0495592_0004544_758_2407 543
134 3300053136 Ga0500559_0000019 Ga0500559_0000019_50836_52485 543
135 3300006195 Ga0075366_10001796 Ga0075366_1000179611 544
136 3300037418 Ga0395900_0004048 Ga0395900_0004048_7063_8754 544
137 3300037471 Ga0395905_0035033 Ga0395905_0035033_1355_3001 544
138 3300038443 Ga0395901_0009297 Ga0395901_0009297_3498_5189 544
139 iso_pu_bacteria 2857542790 2857543009 544
140 3300002774 JGI25150J39212_1002560 JGI25150J39212_10025603 545
141 3300005459 Ga0068867_100013402 Ga0068867_1000134023 545
142 3300005617 Ga0068859_100082703 Ga0068859_1000827033 545
143 3300005844 Ga0068862_100044132 Ga0068862_1000441323 545
144 3300006931 Ga0097620_100082706 Ga0097620_1000827062 545
145 3300009553 Ga0105249_10032533 Ga0105249_100325334 545
146 3300013297 Ga0157378_10003514 Ga0157378_100035149 545
147 3300013308 Ga0157375_10043774 Ga0157375_100437744 545
148 3300014326 Ga0157380_10016567 Ga0157380_100165673 545
149 3300014968 Ga0157379_10024806 Ga0157379_100248063 545
150 3300015261 Ga0182006_1002898 Ga0182006_10028986 545
151 3300025245 Ga0207425_1000125 Ga0207425_100012556 545
152 3300025294 Ga0209025_1002265 Ga0209025_100226514 545
153 3300025297 Ga0209758_1000679 Ga0209758_100067946 545
154 3300025961 Ga0207712_10032586 Ga0207712_100325863 545
155 3300026089 Ga0207648_10000190 Ga0207648_100001904 545
156 3300026118 Ga0207675_100002430 Ga0207675_1000024303 545
157 3300028380 Ga0268265_10044695 Ga0268265_100446952 545
158 3300028381 Ga0268264_10037631 Ga0268264_100376313 545
159 3300031730 Ga0307516_10004749 Ga0307516_100047495 545
160 3300050493 nmdc:mga0k408_10331_c1 nmdc:mga0k408_10331_c1_505_2187 545
161 iso_pu_bacteria 2881101125 2881102477 545
162 3300027876 Ga0209974_10007194 Ga0209974_100071944 546
163 3300028794 Ga0307515_10000332 Ga0307515_1000033272 546
164 3300028794 Ga0307515_10012210 Ga0307515_1001221011 546
165 3300028794 Ga0307515_10059888 Ga0307515_100598884 546
166 3300041452 Ga0451793_0623531 Ga0451793_0623531_350_2113 546
167 3300048905 Ga0496102_0143982 Ga0496102_0143982_459_2129 546
168 3300048920 Ga0496117_0002723 Ga0496117_0002723_18237_19907 546
169 3300048921 Ga0496118_0016171 Ga0496118_0016171_1439_3109 546
170 3300048927 Ga0496124_0000013 Ga0496124_0000013_28526_30256 546
171 3300048929 Ga0496126_0000061 Ga0496126_0000061_192541_194211 546
172 iso_pu_bacteria 2510065045 2510248812 546
173 iso_pu_bacteria 2585428062 2587757583 546
174 iso_pu_bacteria 2599185239 2599737114 546
175 iso_pu_bacteria 2643221654 2644301293 546
176 iso_pu_bacteria 2718217991 2719642762 546
177 iso_pu_bacteria 2818991452 2819632610 546
178 iso_pu_bacteria 2834641062 2834643566 546
179 iso_pu_bacteria 2863421361 2863421640 546
180 iso_pu_bacteria 2870068957 2870072411 546
181 iso_pu_bacteria 2904564687 2904565805 546
182 iso_pu_bacteria 2904571731 2904572848 546
183 iso_pu_bacteria 2928170801 2928173282 546
184 iso_pu_bacteria 2928536128 2928538628 546
185 iso_pu_bacteria 8003400568 8003403639 546
186 iso_pu_bacteria 8018845410 8018849065 546
187 iso_pu_bacteria 8021120328 8021126644 546
188 3300037068 Ga0373925_0004630 Ga0373925_0004630_4020_5729 547
189 3300047319 Ga0495674_0005290 Ga0495674_0005290_9751_11427 547
190 iso_pu_bacteria 2501025502 2501083685 547
191 iso_pu_bacteria 2501025504 2501413234 547
192 iso_pu_bacteria 2510917013 2511087485 547
193 iso_pu_bacteria 2510917014 2511100323 547
194 iso_pu_bacteria 2510917015 2511106012 547
195 iso_pu_bacteria 2513237082 2513551925 547
196 iso_pu_bacteria 2513237083 2513563305 547
197 iso_pu_bacteria 2858688981 2858699208 547
198 iso_pu_bacteria 2883087390 2883090855 547
199 iso_pu_bacteria 8003955200 8003957092 547
200 3300038443 Ga0395901_0004563 Ga0395901_0004563_2654_4333 549
201 iso_pu_bacteria 2599185240 2599742808 549
202 iso_pu_bacteria 2599185355 2600204926 549
203 iso_pu_bacteria 2675903129 2676741915 549
204 iso_pu_bacteria 8020938398 8020944794 549
205 iso_pu_bacteria 8020945358 8020949661 549
206 iso_pu_bacteria 8020953355 8020959871 549
207 3300003758 Ga0055532_1002905 Ga0055532_10029053 550
208 3300003758 Ga0055532_1003276 Ga0055532_10032762 550
209 3300003761 Ga0055535_1002309 Ga0055535_10023097 550
210 3300003762 Ga0055542_1002195 Ga0055542_10021957 550
211 3300003763 Ga0055529_1001176 Ga0055529_100117613 550
212 3300003790 Ga0055528_1003131 Ga0055528_10031315 550
213 3300003856 Ga0058692_1000957 Ga0058692_10009575 550
214 3300009093 Ga0105240_10006071 Ga0105240_1000607116 550
215 3300015262 Ga0182007_10002911 Ga0182007_100029113 550
216 3300015262 Ga0182007_10015991 Ga0182007_100159913 550
217 3300025225 Ga0209566_100170 Ga0209566_10017041 550
218 3300025228 Ga0209672_100028 Ga0209672_100028249 550
219 3300025229 Ga0209147_100117 Ga0209147_10011761 550
220 3300025229 Ga0209147_100488 Ga0209147_10048812 550
221 3300025242 Ga0209258_100112 Ga0209258_100112103 550
222 3300025254 Ga0209148_1001535 Ga0209148_100153512 550
223 3300025272 Ga0209455_1000050 Ga0209455_100005071 550
224 3300025273 Ga0209673_1000038 Ga0209673_10000386 550
225 3300025913 Ga0207695_10001729 Ga0207695_1000172921 550
226 3300027312 Ga0209371_1000090 Ga0209371_100009058 550
227 3300030500 Ga0268256_1000115 Ga0268256_10001155 550
228 3300046462 Ga0495651_0000657 Ga0495651_0000657_15698_17383 550
229 3300046472 Ga0495580_0004669 Ga0495580_0004669_244_1950 550
230 3300046511 Ga0495608_0006214 Ga0495608_0006214_4815_6500 550
231 3300046516 Ga0495628_0000037 Ga0495628_0000037_47763_49448 550
232 3300046529 Ga0495652_0005170 Ga0495652_0005170_7321_9006 550
233 3300046679 Ga0495623_0003620 Ga0495623_0003620_4389_6074 550
234 3300048088 Ga0495602_0004236 Ga0495602_0004236_3611_5296 550
235 3300003763 Ga0055529_1001109 Ga0055529_10011096 551
236 3300025228 Ga0209672_101689 Ga0209672_1016897 551
237 3300025272 Ga0209455_1000534 Ga0209455_10005346 551
238 3300028800 Ga0265338_10002854 Ga0265338_1000285419 551
239 3300048919 Ga0496116_0002163 Ga0496116_0002163_11400_13124 551
240 3300049823 Ga0501044_0000185 Ga0501044_0000185_56173_57876 551
241 iso_pu_bacteria 2928157003 2928159778 551
242 iso_pu_bacteria 2928163908 2928164164 551
243 iso_pu_bacteria 8039098773 8039099259 551
244 3300037471 Ga0395905_0004949 Ga0395905_0004949_7431_9143 552
245 3300046522 Ga0495643_0023982 Ga0495643_0023982_1351_3063 552
246 3300038443 Ga0395901_0000043 Ga0395901_0000043_147202_148950 553
247 3300044684 Ga0466966_0000063 Ga0466966_0000063_24782_26509 553
248 3300044693 Ga0466961_0001093 Ga0466961_0001093_544_2271 553
249 3300044694 Ga0466963_0034517 Ga0466963_0034517_1054_2781 553
250 3300044719 Ga0466971_0003234 Ga0466971_0003234_536_2263 553
251 3300045836 Ga0466958_0004267 Ga0466958_0004267_613_2340 553
252 3300061719 Ga0466962_0003474 Ga0466962_0003474_3502_5229 553
253 iso_pu_bacteria 2519103095 2519457943 554
254 iso_pu_bacteria 2582581311 2585295240 554
255 iso_pu_bacteria 2816332253 2817260117 554
256 iso_pu_bacteria 2816332256 2817277781 554
257 iso_pu_bacteria 2816332286 2817455825 554
258 iso_pu_bacteria 2981990288 2981994223 554
259 iso_pu_bacteria 8020807995 8020810470 554
260 iso_pu_bacteria 8040167225 8040171771 554
261 iso_pu_bacteria 8040173305 8040176284 554
262 3300001989 JGI24739J22299_10013501 JGI24739J22299_100135013 555
263 3300003758 Ga0055532_1001472 Ga0055532_10014726 555
264 3300003760 Ga0055527_1000988 Ga0055527_10009886 555
265 3300003761 Ga0055535_1002319 Ga0055535_10023196 555
266 3300005339 Ga0070660_100000008 Ga0070660_10000000815 555
267 3300005366 Ga0070659_100000087 Ga0070659_10000008760 555
268 3300009092 Ga0105250_10008182 Ga0105250_100081823 555
269 3300009093 Ga0105240_10118787 Ga0105240_101187873 555
270 3300015265 Ga0182005_1009511 Ga0182005_10095112 555
271 3300025228 Ga0209672_100038 Ga0209672_10003872 555
272 3300025229 Ga0209147_100112 Ga0209147_10011284 555
273 3300025242 Ga0209258_100109 Ga0209258_100109104 555
274 3300025254 Ga0209148_1002458 Ga0209148_10024583 555
275 3300025272 Ga0209455_1000752 Ga0209455_100075217 555
276 3300025711 Ga0207696_1008997 Ga0207696_10089973 555
277 3300025904 Ga0207647_10019558 Ga0207647_100195581 555
278 3300025909 Ga0207705_10051380 Ga0207705_100513803 555
279 3300025913 Ga0207695_10075687 Ga0207695_100756872 555
280 3300025919 Ga0207657_10000337 Ga0207657_1000033738 555
281 3300025924 Ga0207694_10006796 Ga0207694_100067962 555
282 3300025932 Ga0207690_10000006 Ga0207690_1000000615 555
283 3300025949 Ga0207667_10026684 Ga0207667_100266845 555
284 3300026067 Ga0207678_10000228 Ga0207678_1000022815 555
285 3300044693 Ga0466961_0056892 Ga0466961_0056892_456_2183 555
286 3300048920 Ga0496117_0062015 Ga0496117_0062015_170_2101 555
287 3300048924 Ga0496121_0092740 Ga0496121_0092740_603_2279 555

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

83

122

0.92

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

86

135

0.92

PF01494

FAD_binding_3

FAD binding domain

82

422

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eod-assembly3.cif.gz_C structure of reductive aminase from aspergillus terreus in complex with nadph 0.9584 27 56
8bj5-assembly2.cif.gz_C imine reductase ir007 from amycolatopsis azurea 0.9571 29 56
3l6d-assembly1.cif.gz_A crystal structure of putative oxidoreductase from pseudomonas putida kt2440 0.9463 27 56
5a9s-assembly1.cif.gz_B nadph complex of imine reductase from amycolatopsis orientalis 0.9386 28 56
8c79-assembly1.cif.gz_B crystal structure of leishmania donovani 6-phosphogluconate dehydrogenase complexed with nadph 0.9338 27 56
ID Description Score Start End Superfamily
af_K8F7V7_1826_1944_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9831 29 55 3.50.50.60
2f1kD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9708 28 56 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9662 28 56 3.40.50.720
af_C0VXV5_2_190_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9645 28 58 3.40.50.720
1yonA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9556 29 56 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3M1CDN8-F1-model_v4 FAD-dependent oxidoreductase 0.9702 1 409 GO:0008688
GO:0019622
GO:0071949
AF-A0A2N2SAA5-F1-model_v4 FAD-dependent oxidoreductase 0.9697 70 553 GO:0016709
GO:0071949
AF-A0A442GX02-F1-model_v4 FAD-dependent oxidoreductase 0.9652 5 553 GO:0016709
GO:0071949
AF-L2EHU1-F1-model_v4 deleted 0.9638 1 513
AF-A0A2N2SAA5-F1-model_v4 FAD-dependent oxidoreductase 0.9619 70 553 GO:0016709
GO:0071949

Feature Viewer

pLDDT pTM Quality
93.2 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map