F388226
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 287 | 227 | 234 | 555 |
Family's Representative Sequence
| Representative Sequence | 3300048920|Ga0496117_0062015|Ga0496117_0062015_170_2101 |
| Length | 610 |
| Sequence | LISLFVIGFTIRKSKDLSPIKKSGVRAPATAPFPESNQQAARSETWRLTASGRSSAGIDYQXLKFEYRPRAARAAGDDAVIHPVIVVGAGPVGLSAAIDLAQQGVPVVLLDDDDTLSTGSRAICFAKRTLEIFDRLGCGERFVEKGVSWHVGKVFLQDEQLYAFDLLPEEGHARPAFINLQQYYVEGYLAERAFELPNLEIRWKHKVTGVAQSAEHAALTVETPEGIETLHARYVIAADGSRSPMRAAMGLESRGRTFKDRFLIADVKMKAEFPTERWFWFDPPFHRNQSVLLHRQPDNVWRIDFQLGWDADPVAEKQPERVIPRVRALLGADVEFELEWVSVYTFRCQRMDTFRHGRVLFAGDSAHGVSPFGARGANSGVQDADNLAWKLKLVLDGRADDRLLDTYASEREFAADENIRNSTRSTDFITPKSAVSRVFRDATLKLARDCEFARKLVNSGRLSVPAVLADSPLNTPDRNGDAFACAMRPGAAAADAPVREQGASGWLLQHLGDGFAGVLFGLPADAAALVQALDGLALPVRPVLIVPAGHAQPVAGVDVVEDVDGFAAQRYDAQPGTFYLLRPDQHVCARMRTLERQAIADALARATCAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 3 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 4 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 5 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 6 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 7 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 8 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 9 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 10 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 11 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 12 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 13 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 14 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 15 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 16 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 17 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 18 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 19 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 20 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 21 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 22 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 23 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 24 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 25 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 26 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 27 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 28 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 29 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 30 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 31 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 32 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 33 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 34 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 35 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 36 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 37 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 38 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 39 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 40 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 41 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 42 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 43 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 44 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 45 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 46 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 48 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 49 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 50 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 54 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 55 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 56 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 57 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 58 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 82 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 139 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 145 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 149 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 150 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 151 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 152 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 153 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 154 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 157 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 158 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 159 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 164 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 165 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 166 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 167 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 168 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 169 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 170 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 171 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 172 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 173 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 174 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 188 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 189 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 190 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 191 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 192 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 193 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 194 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 204 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 205 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 207 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 208 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 209 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 210 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 211 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 212 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 213 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 214 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 215 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 216 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 217 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 218 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 219 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 220 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 221 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 222 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 223 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 224 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 225 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 226 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 227 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.53 |
| Metatranscriptomes | 0 |
| Isolates | 18.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.21 |
| Nodule | 3.14 |
| Rhizoplane | 2.09 |
| Rhizosphere | 54.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10013501 | 3300001989 | Bacteria | 2982 |
| 2 | JGI25156J39149_1000064 | 3300002705 | Bacteria | 83982 |
| 3 | JGI25157J39369_1000083 | 3300002741 | Bacteria | 84002 |
| 4 | JGI25150J39212_1002560 | 3300002774 | Bacteria | 4482 |
| 5 | JGI25406J46586_10003630 | 3300003203 | Bacteria | 7240 |
| 6 | Ga0055532_1001472 | 3300003758 | Bacteria | 6531 |
| 7 | Ga0055532_1002905 | 3300003758 | Bacteria | 3243 |
| 8 | Ga0055532_1003276 | 3300003758 | Bacteria | 2862 |
| 9 | Ga0055527_1000988 | 3300003760 | Bacteria | 6923 |
| 10 | Ga0055535_1000632 | 3300003761 | Bacteria | 28125 |
| 11 | Ga0055535_1002309 | 3300003761 | Bacteria | 6974 |
| 12 | Ga0055535_1002319 | 3300003761 | Bacteria | 6923 |
| 13 | Ga0055542_1002195 | 3300003762 | Bacteria | 6974 |
| 14 | Ga0055529_1001056 | 3300003763 | Bacteria | 12764 |
| 15 | Ga0055529_1001109 | 3300003763 | Bacteria | 11958 |
| 16 | Ga0055529_1001176 | 3300003763 | Bacteria | 10681 |
| 17 | Ga0055537_1000024 | 3300003773 | Bacteria | 111410 |
| 18 | Ga0055534_1000032 | 3300003784 | Bacteria | 118890 |
| 19 | Ga0055528_1003131 | 3300003790 | Bacteria | 8487 |
| 20 | Ga0055528_1004537 | 3300003790 | Bacteria | 6663 |
| 21 | Ga0058692_1000957 | 3300003856 | Bacteria | 11362 |
| 22 | Ga0065714_10065020 | 3300005288 | Bacteria | 13888 |
| 23 | Ga0068869_100047384 | 3300005334 | Bacteria | 3104 |
| 24 | Ga0070660_100000008 | 3300005339 | Bacteria | 155650 |
| 25 | Ga0070674_100002745 | 3300005356 | Bacteria | 9731 |
| 26 | Ga0070659_100000087 | 3300005366 | Bacteria | 69724 |
| 27 | Ga0070667_100030341 | 3300005367 | Bacteria | 4509 |
| 28 | Ga0070709_10048599 | 3300005434 | Bacteria | 2648 |
| 29 | Ga0070714_100015999 | 3300005435 | Bacteria | 6048 |
| 30 | Ga0070713_100043244 | 3300005436 | Bacteria | 3682 |
| 31 | Ga0068867_100013402 | 3300005459 | Bacteria | 5809 |
| 32 | Ga0068867_100111547 | 3300005459 | Bacteria | 2102 |
| 33 | Ga0070706_100122615 | 3300005467 | Bacteria | 2423 |
| 34 | Ga0070672_100049062 | 3300005543 | Bacteria | 3283 |
| 35 | Ga0070665_100004978 | 3300005548 | Bacteria | 13778 |
| 36 | Ga0070665_100068262 | 3300005548 | Bacteria | 3565 |
| 37 | Ga0070665_100083845 | 3300005548 | Bacteria | 3192 |
| 38 | Ga0068855_100104939 | 3300005563 | Bacteria | 3250 |
| 39 | Ga0068857_100008364 | 3300005577 | Bacteria | 8940 |
| 40 | Ga0068856_100000510 | 3300005614 | Bacteria | 42987 |
| 41 | Ga0068859_100082703 | 3300005617 | Bacteria | 3253 |
| 42 | Ga0068862_100044132 | 3300005844 | Bacteria | 3803 |
| 43 | Ga0081539_10001256 | 3300005985 | Bacteria | 45022 |
| 44 | Ga0070716_100002620 | 3300006173 | Bacteria | 8313 |
| 45 | Ga0075362_10034863 | 3300006177 | Bacteria | 2195 |
| 46 | Ga0075366_10001796 | 3300006195 | Bacteria | 10840 |
| 47 | Ga0075370_10000553 | 3300006353 | Bacteria | 14337 |
| 48 | Ga0075431_100201296 | 3300006847 | Bacteria | 2037 |
| 49 | Ga0097620_100082706 | 3300006931 | Bacteria | 3253 |
| 50 | Ga0099826_10000060 | 3300006948 | Bacteria | 63334 |
| 51 | Ga0099826_10051062 | 3300006948 | Bacteria | 2776 |
| 52 | Ga0105250_10008182 | 3300009092 | Bacteria | 4453 |
| 53 | Ga0105240_10006071 | 3300009093 | Bacteria | 17841 |
| 54 | Ga0105240_10009840 | 3300009093 | Bacteria | 13495 |
| 55 | Ga0105240_10118787 | 3300009093 | Bacteria | 3186 |
| 56 | Ga0114129_10007104 | 3300009147 | Bacteria | 15933 |
| 57 | Ga0114129_10027130 | 3300009147 | Bacteria | 8108 |
| 58 | Ga0114129_10138998 | 3300009147 | Bacteria | 3331 |
| 59 | Ga0105243_10066528 | 3300009148 | Bacteria | 2898 |
| 60 | Ga0105249_10032533 | 3300009553 | Bacteria | 4719 |
| 61 | Ga0157369_10028943 | 3300013105 | Bacteria | 6127 |
| 62 | Ga0157378_10003514 | 3300013297 | Bacteria | 13898 |
| 63 | Ga0157375_10043774 | 3300013308 | Bacteria | 4344 |
| 64 | Ga0157380_10016567 | 3300014326 | Bacteria | 5438 |
| 65 | Ga0182008_10004794 | 3300014497 | Bacteria | 7822 |
| 66 | Ga0157379_10024806 | 3300014968 | Bacteria | 5323 |
| 67 | Ga0182006_1002898 | 3300015261 | Bacteria | 9111 |
| 68 | Ga0182007_10002911 | 3300015262 | Bacteria | 8318 |
| 69 | Ga0182007_10015991 | 3300015262 | Bacteria | 2780 |
| 70 | Ga0182005_1009511 | 3300015265 | Bacteria | 2828 |
| 71 | Ga0209566_100170 | 3300025225 | Bacteria | 70792 |
| 72 | Ga0209672_100028 | 3300025228 | Bacteria | 341962 |
| 73 | Ga0209672_100038 | 3300025228 | Bacteria | 286731 |
| 74 | Ga0209672_101689 | 3300025228 | Bacteria | 7136 |
| 75 | Ga0209147_100112 | 3300025229 | Bacteria | 145046 |
| 76 | Ga0209147_100117 | 3300025229 | Bacteria | 143852 |
| 77 | Ga0209147_100488 | 3300025229 | Bacteria | 23706 |
| 78 | Ga0209258_100109 | 3300025242 | Bacteria | 203881 |
| 79 | Ga0209258_100112 | 3300025242 | Bacteria | 192884 |
| 80 | Ga0209258_100424 | 3300025242 | Bacteria | 49640 |
| 81 | Ga0209258_100453 | 3300025242 | Bacteria | 45277 |
| 82 | Ga0207425_1000125 | 3300025245 | Bacteria | 72177 |
| 83 | Ga0209646_1000129 | 3300025246 | Bacteria | 129401 |
| 84 | Ga0209026_1000059 | 3300025250 | Bacteria | 226652 |
| 85 | Ga0209677_100126 | 3300025253 | Bacteria | 78655 |
| 86 | Ga0209148_1001535 | 3300025254 | Bacteria | 11240 |
| 87 | Ga0209148_1002458 | 3300025254 | Bacteria | 6366 |
| 88 | Ga0209759_1000081 | 3300025256 | Bacteria | 169943 |
| 89 | Ga0209759_1001564 | 3300025256 | Bacteria | 12493 |
| 90 | Ga0209565_1000039 | 3300025263 | Bacteria | 278026 |
| 91 | Ga0209455_1000050 | 3300025272 | Bacteria | 373239 |
| 92 | Ga0209455_1000157 | 3300025272 | Bacteria | 119719 |
| 93 | Ga0209455_1000534 | 3300025272 | Bacteria | 26400 |
| 94 | Ga0209455_1000752 | 3300025272 | Bacteria | 18442 |
| 95 | Ga0209673_1000038 | 3300025273 | Bacteria | 312957 |
| 96 | Ga0209673_1000284 | 3300025273 | Bacteria | 94932 |
| 97 | Ga0209675_1000030 | 3300025291 | Bacteria | 278026 |
| 98 | Ga0209675_1002245 | 3300025291 | Bacteria | 10094 |
| 99 | Ga0209025_1002265 | 3300025294 | Bacteria | 21074 |
| 100 | Ga0209758_1000679 | 3300025297 | Bacteria | 50729 |
| 101 | Ga0207696_1008997 | 3300025711 | Bacteria | 3754 |
| 102 | Ga0207688_10029398 | 3300025901 | Bacteria | 3025 |
| 103 | Ga0207647_10019558 | 3300025904 | Bacteria | 4553 |
| 104 | Ga0207705_10051380 | 3300025909 | Bacteria | 2967 |
| 105 | Ga0207695_10001729 | 3300025913 | Bacteria | 34817 |
| 106 | Ga0207695_10005596 | 3300025913 | Bacteria | 16596 |
| 107 | Ga0207695_10021168 | 3300025913 | Bacteria | 7427 |
| 108 | Ga0207695_10075687 | 3300025913 | Bacteria | 3424 |
| 109 | Ga0207657_10000337 | 3300025919 | Bacteria | 49613 |
| 110 | Ga0207694_10006796 | 3300025924 | Bacteria | 8683 |
| 111 | Ga0207659_10005559 | 3300025926 | Bacteria | 7649 |
| 112 | Ga0207700_10000004 | 3300025928 | Bacteria | 443409 |
| 113 | Ga0207700_10002510 | 3300025928 | Bacteria | 10523 |
| 114 | Ga0207700_10031817 | 3300025928 | Bacteria | 3753 |
| 115 | Ga0207664_10001046 | 3300025929 | Bacteria | 18542 |
| 116 | Ga0207690_10000006 | 3300025932 | Bacteria | 433880 |
| 117 | Ga0207706_10000544 | 3300025933 | Bacteria | 39990 |
| 118 | Ga0207709_10047873 | 3300025935 | Bacteria | 2602 |
| 119 | Ga0207669_10041860 | 3300025937 | Bacteria | 2670 |
| 120 | Ga0207665_10009860 | 3300025939 | Bacteria | 6268 |
| 121 | Ga0207691_10008195 | 3300025940 | Bacteria | 10037 |
| 122 | Ga0207689_10062171 | 3300025942 | Bacteria | 3070 |
| 123 | Ga0207667_10026684 | 3300025949 | Bacteria | 6305 |
| 124 | Ga0207667_10199998 | 3300025949 | Bacteria | 2050 |
| 125 | Ga0207712_10032586 | 3300025961 | Bacteria | 3518 |
| 126 | Ga0207639_10013039 | 3300026041 | Bacteria | 5803 |
| 127 | Ga0207678_10000228 | 3300026067 | Bacteria | 49958 |
| 128 | Ga0207702_10001084 | 3300026078 | Bacteria | 27885 |
| 129 | Ga0207648_10000190 | 3300026089 | Bacteria | 64762 |
| 130 | Ga0207648_10025808 | 3300026089 | Bacteria | 5228 |
| 131 | Ga0207674_10004452 | 3300026116 | Bacteria | 16839 |
| 132 | Ga0207675_100002430 | 3300026118 | Bacteria | 18452 |
| 133 | Ga0209371_1000090 | 3300027312 | Bacteria | 173119 |
| 134 | Ga0209282_1000200 | 3300027666 | Bacteria | 32028 |
| 135 | Ga0209974_10007194 | 3300027876 | Bacteria | 3844 |
| 136 | Ga0268266_10048942 | 3300028379 | Bacteria | 3623 |
| 137 | Ga0268265_10044695 | 3300028380 | Bacteria | 3300 |
| 138 | Ga0268264_10037631 | 3300028381 | Bacteria | 3989 |
| 139 | Ga0265336_10000008 | 3300028666 | Bacteria | 336082 |
| 140 | Ga0307515_10000332 | 3300028794 | Bacteria | 116126 |
| 141 | Ga0307515_10003326 | 3300028794 | Bacteria | 33975 |
| 142 | Ga0307515_10012210 | 3300028794 | Bacteria | 16189 |
| 143 | Ga0307515_10028818 | 3300028794 | Bacteria | 9418 |
| 144 | Ga0307515_10059888 | 3300028794 | Bacteria | 5446 |
| 145 | Ga0265338_10002854 | 3300028800 | Bacteria | 25255 |
| 146 | Ga0265324_10000871 | 3300029957 | Bacteria | 19320 |
| 147 | Ga0268256_1000115 | 3300030500 | Bacteria | 116918 |
| 148 | Ga0307512_10051189 | 3300030522 | Bacteria | 3307 |
| 149 | Ga0307512_10054292 | 3300030522 | Bacteria | 3175 |
| 150 | Ga0307513_10047156 | 3300031456 | Bacteria | 4689 |
| 151 | Ga0307513_10116318 | 3300031456 | Bacteria | 2654 |
| 152 | Ga0307509_10008176 | 3300031507 | Bacteria | 13398 |
| 153 | Ga0307509_10044322 | 3300031507 | Bacteria | 4808 |
| 154 | Ga0307509_10063084 | 3300031507 | Bacteria | 3903 |
| 155 | Ga0307509_10070293 | 3300031507 | Bacteria | 3656 |
| 156 | Ga0307508_10005499 | 3300031616 | Bacteria | 12042 |
| 157 | Ga0307508_10083604 | 3300031616 | Bacteria | 2774 |
| 158 | Ga0307514_10003838 | 3300031649 | Bacteria | 14140 |
| 159 | Ga0307516_10004749 | 3300031730 | Bacteria | 16588 |
| 160 | Ga0307412_10063732 | 3300031911 | Bacteria | 2488 |
| 161 | Ga0307409_100098727 | 3300031995 | Bacteria | 2416 |
| 162 | Ga0307507_10063668 | 3300033179 | Bacteria | 3411 |
| 163 | Ga0307510_10005618 | 3300033180 | Bacteria | 14948 |
| 164 | Ga0307510_10072136 | 3300033180 | Bacteria | 3432 |
| 165 | Ga0307510_10106099 | 3300033180 | Bacteria | 2574 |
| 166 | Ga0316584_0017152 | 3300036712 | Bacteria | 5201 |
| 167 | Ga0373925_0004630 | 3300037068 | Bacteria | 10383 |
| 168 | Ga0395900_0004048 | 3300037418 | Bacteria | 15637 |
| 169 | Ga0395900_0022924 | 3300037418 | Bacteria | 6388 |
| 170 | Ga0395905_0004949 | 3300037471 | Bacteria | 13728 |
| 171 | Ga0395905_0035033 | 3300037471 | Bacteria | 4713 |
| 172 | Ga0395901_0000043 | 3300038443 | Bacteria | 197397 |
| 173 | Ga0395901_0004563 | 3300038443 | Bacteria | 13982 |
| 174 | Ga0395901_0009297 | 3300038443 | Bacteria | 9962 |
| 175 | Ga0451793_0623531 | 3300041452 | Bacteria | 2831 |
| 176 | Ga0450920_003841 | 3300042122 | Bacteria | 2616 |
| 177 | Ga0450921_000236 | 3300042123 | Bacteria | 2302 |
| 178 | Ga0450906_004325 | 3300042145 | Bacteria | 2981 |
| 179 | Ga0450908_001230 | 3300042184 | Bacteria | 4963 |
| 180 | Ga0466972_0001691 | 3300044658 | Bacteria | 10798 |
| 181 | Ga0466966_0000063 | 3300044684 | Bacteria | 74180 |
| 182 | Ga0466966_0000475 | 3300044684 | Bacteria | 25816 |
| 183 | Ga0466961_0001093 | 3300044693 | Bacteria | 16671 |
| 184 | Ga0466961_0056892 | 3300044693 | Bacteria | 2491 |
| 185 | Ga0466963_0034517 | 3300044694 | Bacteria | 3291 |
| 186 | Ga0466971_0003234 | 3300044719 | Bacteria | 6954 |
| 187 | Ga0466958_0004267 | 3300045836 | Bacteria | 7520 |
| 188 | Ga0495592_0004544 | 3300046454 | Bacteria | 10162 |
| 189 | Ga0495651_0000657 | 3300046462 | Bacteria | 26772 |
| 190 | Ga0495580_0004669 | 3300046472 | Bacteria | 11492 |
| 191 | Ga0495580_0016167 | 3300046472 | Bacteria | 5608 |
| 192 | Ga0495608_0006214 | 3300046511 | Bacteria | 8479 |
| 193 | Ga0495620_0010426 | 3300046515 | Bacteria | 4905 |
| 194 | Ga0495628_0000037 | 3300046516 | Bacteria | 109854 |
| 195 | Ga0495643_0023982 | 3300046522 | Bacteria | 3463 |
| 196 | Ga0495652_0005170 | 3300046529 | Bacteria | 12339 |
| 197 | Ga0495625_0000224 | 3300046660 | Bacteria | 89521 |
| 198 | Ga0495623_0003620 | 3300046679 | Bacteria | 10214 |
| 199 | Ga0495674_0005290 | 3300047319 | Bacteria | 12378 |
| 200 | Ga0495686_0001817 | 3300047472 | Bacteria | 21551 |
| 201 | Ga0495602_0004236 | 3300048088 | Bacteria | 14924 |
| 202 | Ga0496102_0143982 | 3300048905 | Bacteria | 2236 |
| 203 | Ga0496116_0002163 | 3300048919 | Bacteria | 20930 |
| 204 | Ga0496117_0002723 | 3300048920 | Bacteria | 21716 |
| 205 | Ga0496117_0062015 | 3300048920 | Bacteria | 2565 |
| 206 | Ga0496118_0016171 | 3300048921 | Bacteria | 6859 |
| 207 | Ga0496121_0092740 | 3300048924 | Bacteria | 2353 |
| 208 | Ga0496124_0000013 | 3300048927 | Bacteria | 484884 |
| 209 | Ga0496126_0000061 | 3300048929 | Bacteria | 261515 |
| 210 | Ga0501031_0000893 | 3300049568 | Bacteria | 17996 |
| 211 | Ga0501033_0034804 | 3300049570 | Bacteria | 3776 |
| 212 | Ga0501034_0031483 | 3300049571 | Bacteria | 5387 |
| 213 | Ga0501036_0019367 | 3300049572 | Bacteria | 5712 |
| 214 | Ga0501038_0017358 | 3300049574 | Bacteria | 6505 |
| 215 | Ga0501070_0006960 | 3300049586 | Bacteria | 9619 |
| 216 | Ga0501083_0056155 | 3300049744 | Bacteria | 2639 |
| 217 | Ga0501035_0223851 | 3300049822 | Bacteria | 1605 |
| 218 | Ga0501044_0000185 | 3300049823 | Bacteria | 77663 |
| 219 | Ga0501044_0033166 | 3300049823 | Bacteria | 5427 |
| 220 | nmdc:mga0k408_10331_c1 | 3300050493 | Bacteria | 5048 |
| 221 | nmdc:mga0k408_18870_c1 | 3300050493 | Bacteria | 3850 |
| 222 | nmdc:mga0k408_26627_c1 | 3300050493 | Bacteria | 3280 |
| 223 | nmdc:mga07m45_3895_c1 | 3300050496 | Bacteria | 7247 |
| 224 | nmdc:mga05p37_20944_c1 | 3300050507 | Bacteria | 7914 |
| 225 | Ga0500610_0000021 | 3300053079 | Bacteria | 66361 |
| 226 | Ga0500635_0000029 | 3300053080 | Bacteria | 100914 |
| 227 | Ga0500646_0000088 | 3300053090 | Bacteria | 26075 |
| 228 | Ga0500651_0000136 | 3300053093 | Bacteria | 45911 |
| 229 | Ga0500593_000411 | 3300053117 | Bacteria | 16935 |
| 230 | Ga0500607_000674 | 3300053121 | Bacteria | 32958 |
| 231 | Ga0500559_0000019 | 3300053136 | Bacteria | 134862 |
| 232 | Ga0500627_0000237 | 3300053158 | Bacteria | 15710 |
| 233 | Ga0500634_0041907 | 3300053161 | Bacteria | 2485 |
| 234 | Ga0466962_0003474 | 3300061719 | Bacteria | 7513 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049822 | Ga0501035_0223851 | Ga0501035_0223851_122_1567 | 452 |
| 2 | 3300009147 | Ga0114129_10007104 | Ga0114129_100071043 | 475 |
| 3 | 3300031995 | Ga0307409_100098727 | Ga0307409_1000987272 | 487 |
| 4 | 3300053093 | Ga0500651_0000136 | Ga0500651_0000136_4384_6027 | 498 |
| 5 | 3300049744 | Ga0501083_0056155 | Ga0501083_0056155_125_1741 | 499 |
| 6 | 3300005985 | Ga0081539_10001256 | Ga0081539_1000125626 | 508 |
| 7 | 3300006173 | Ga0070716_100002620 | Ga0070716_1000026206 | 508 |
| 8 | 3300025939 | Ga0207665_10009860 | Ga0207665_100098603 | 508 |
| 9 | 3300053090 | Ga0500646_0000088 | Ga0500646_0000088_4287_5879 | 508 |
| 10 | 3300005434 | Ga0070709_10048599 | Ga0070709_100485992 | 510 |
| 11 | 3300025928 | Ga0207700_10000004 | Ga0207700_10000004189 | 510 |
| 12 | 3300005436 | Ga0070713_100043244 | Ga0070713_1000432441 | 511 |
| 13 | 3300025928 | Ga0207700_10031817 | Ga0207700_100318172 | 511 |
| 14 | 3300042184 | Ga0450908_001230 | Ga0450908_001230_11_1570 | 512 |
| 15 | iso_pu_bacteria | 2935390628 | 2935394951 | 512 |
| 16 | 3300044658 | Ga0466972_0001691 | Ga0466972_0001691_3950_5569 | 513 |
| 17 | 3300005548 | Ga0070665_100068262 | Ga0070665_1000682622 | 516 |
| 18 | 3300006847 | Ga0075431_100201296 | Ga0075431_1002012962 | 516 |
| 19 | 3300009147 | Ga0114129_10138998 | Ga0114129_101389983 | 516 |
| 20 | 3300025926 | Ga0207659_10005559 | Ga0207659_100055594 | 516 |
| 21 | 3300031911 | Ga0307412_10063732 | Ga0307412_100637322 | 518 |
| 22 | 3300009147 | Ga0114129_10027130 | Ga0114129_100271303 | 520 |
| 23 | 3300050507 | nmdc:mga05p37_20944_c1 | nmdc:mga05p37_20944_c1_4893_6494 | 520 |
| 24 | 3300028666 | Ga0265336_10000008 | Ga0265336_1000000830 | 524 |
| 25 | 3300029957 | Ga0265324_10000871 | Ga0265324_1000087112 | 524 |
| 26 | 3300031456 | Ga0307513_10116318 | Ga0307513_101163181 | 524 |
| 27 | 3300014497 | Ga0182008_10004794 | Ga0182008_100047943 | 526 |
| 28 | 3300005467 | Ga0070706_100122615 | Ga0070706_1001226152 | 527 |
| 29 | 3300025291 | Ga0209675_1002245 | Ga0209675_10022452 | 528 |
| 30 | 3300033180 | Ga0307510_10005618 | Ga0307510_1000561810 | 528 |
| 31 | iso_pu_bacteria | 2945984333 | 2945989044 | 529 |
| 32 | 3300005563 | Ga0068855_100104939 | Ga0068855_1001049392 | 530 |
| 33 | 3300025901 | Ga0207688_10029398 | Ga0207688_100293983 | 531 |
| 34 | 3300025933 | Ga0207706_10000544 | Ga0207706_1000054432 | 531 |
| 35 | 3300026089 | Ga0207648_10025808 | Ga0207648_100258084 | 531 |
| 36 | 3300036712 | Ga0316584_0017152 | Ga0316584_0017152_947_2572 | 531 |
| 37 | 3300030522 | Ga0307512_10051189 | Ga0307512_100511893 | 532 |
| 38 | 3300003203 | JGI25406J46586_10003630 | JGI25406J46586_100036301 | 534 |
| 39 | 3300003773 | Ga0055537_1000024 | Ga0055537_1000024101 | 534 |
| 40 | 3300003784 | Ga0055534_1000032 | Ga0055534_1000032107 | 534 |
| 41 | 3300003790 | Ga0055528_1004537 | Ga0055528_10045375 | 534 |
| 42 | 3300006948 | Ga0099826_10000060 | Ga0099826_100000602 | 534 |
| 43 | 3300025263 | Ga0209565_1000039 | Ga0209565_1000039107 | 534 |
| 44 | 3300025273 | Ga0209673_1000284 | Ga0209673_100028423 | 534 |
| 45 | 3300025291 | Ga0209675_1000030 | Ga0209675_1000030107 | 534 |
| 46 | 3300027666 | Ga0209282_1000200 | Ga0209282_10002002 | 534 |
| 47 | iso_pu_bacteria | 2643221628 | 2644159032 | 534 |
| 48 | 3300002705 | JGI25156J39149_1000064 | JGI25156J39149_10000649 | 535 |
| 49 | 3300002741 | JGI25157J39369_1000083 | JGI25157J39369_10000839 | 535 |
| 50 | 3300005334 | Ga0068869_100047384 | Ga0068869_1000473842 | 535 |
| 51 | 3300005577 | Ga0068857_100008364 | Ga0068857_1000083643 | 535 |
| 52 | 3300005614 | Ga0068856_100000510 | Ga0068856_1000005104 | 535 |
| 53 | 3300013105 | Ga0157369_10028943 | Ga0157369_100289435 | 535 |
| 54 | 3300025242 | Ga0209258_100424 | Ga0209258_10042442 | 535 |
| 55 | 3300025246 | Ga0209646_1000129 | Ga0209646_100012953 | 535 |
| 56 | 3300025250 | Ga0209026_1000059 | Ga0209026_100005957 | 535 |
| 57 | 3300025253 | Ga0209677_100126 | Ga0209677_10012642 | 535 |
| 58 | 3300025256 | Ga0209759_1000081 | Ga0209759_100008197 | 535 |
| 59 | 3300025913 | Ga0207695_10005596 | Ga0207695_100055963 | 535 |
| 60 | 3300025942 | Ga0207689_10062171 | Ga0207689_100621712 | 535 |
| 61 | 3300025949 | Ga0207667_10199998 | Ga0207667_101999981 | 535 |
| 62 | 3300026078 | Ga0207702_10001084 | Ga0207702_1000108430 | 535 |
| 63 | 3300026116 | Ga0207674_10004452 | Ga0207674_100044527 | 535 |
| 64 | 3300037418 | Ga0395900_0022924 | Ga0395900_0022924_419_2092 | 536 |
| 65 | iso_pu_bacteria | 2929199973 | 2929202803 | 536 |
| 66 | iso_pu_bacteria | 8055909800 | 8055912095 | 536 |
| 67 | 3300006948 | Ga0099826_10051062 | Ga0099826_100510622 | 537 |
| 68 | 3300046515 | Ga0495620_0010426 | Ga0495620_0010426_2554_4224 | 537 |
| 69 | 3300049568 | Ga0501031_0000893 | Ga0501031_0000893_12329_14086 | 537 |
| 70 | 3300049570 | Ga0501033_0034804 | Ga0501033_0034804_1023_2780 | 537 |
| 71 | 3300049571 | Ga0501034_0031483 | Ga0501034_0031483_2382_4139 | 537 |
| 72 | 3300049572 | Ga0501036_0019367 | Ga0501036_0019367_2270_4027 | 537 |
| 73 | 3300049574 | Ga0501038_0017358 | Ga0501038_0017358_3475_5232 | 537 |
| 74 | 3300049586 | Ga0501070_0006960 | Ga0501070_0006960_4474_6231 | 537 |
| 75 | 3300049823 | Ga0501044_0033166 | Ga0501044_0033166_1417_3174 | 537 |
| 76 | 3300050493 | nmdc:mga0k408_26627_c1 | nmdc:mga0k408_26627_c1_363_1997 | 537 |
| 77 | 3300053079 | Ga0500610_0000021 | Ga0500610_0000021_57441_59111 | 537 |
| 78 | 3300053117 | Ga0500593_000411 | Ga0500593_000411_626_2296 | 537 |
| 79 | 3300053121 | Ga0500607_000674 | Ga0500607_000674_11911_13581 | 537 |
| 80 | 3300053158 | Ga0500627_0000237 | Ga0500627_0000237_1060_2730 | 537 |
| 81 | 3300053161 | Ga0500634_0041907 | Ga0500634_0041907_266_1936 | 537 |
| 82 | iso_pu_bacteria | 2929520902 | 2929524922 | 537 |
| 83 | iso_pu_bacteria | 2945945610 | 2945947547 | 537 |
| 84 | 3300003761 | Ga0055535_1000632 | Ga0055535_100063212 | 538 |
| 85 | 3300003763 | Ga0055529_1001056 | Ga0055529_10010566 | 538 |
| 86 | 3300005288 | Ga0065714_10065020 | Ga0065714_1006502014 | 538 |
| 87 | 3300005356 | Ga0070674_100002745 | Ga0070674_1000027459 | 538 |
| 88 | 3300005367 | Ga0070667_100030341 | Ga0070667_1000303415 | 538 |
| 89 | 3300005435 | Ga0070714_100015999 | Ga0070714_1000159994 | 538 |
| 90 | 3300005459 | Ga0068867_100111547 | Ga0068867_1001115473 | 538 |
| 91 | 3300005543 | Ga0070672_100049062 | Ga0070672_1000490622 | 538 |
| 92 | 3300005548 | Ga0070665_100004978 | Ga0070665_1000049786 | 538 |
| 93 | 3300006177 | Ga0075362_10034863 | Ga0075362_100348632 | 538 |
| 94 | 3300006353 | Ga0075370_10000553 | Ga0075370_1000055314 | 538 |
| 95 | 3300009148 | Ga0105243_10066528 | Ga0105243_100665281 | 538 |
| 96 | 3300025242 | Ga0209258_100453 | Ga0209258_10045319 | 538 |
| 97 | 3300025256 | Ga0209759_1001564 | Ga0209759_100156412 | 538 |
| 98 | 3300025272 | Ga0209455_1000157 | Ga0209455_100015722 | 538 |
| 99 | 3300025928 | Ga0207700_10002510 | Ga0207700_100025104 | 538 |
| 100 | 3300025929 | Ga0207664_10001046 | Ga0207664_1000104612 | 538 |
| 101 | 3300025935 | Ga0207709_10047873 | Ga0207709_100478732 | 538 |
| 102 | 3300025937 | Ga0207669_10041860 | Ga0207669_100418603 | 538 |
| 103 | 3300025940 | Ga0207691_10008195 | Ga0207691_100081953 | 538 |
| 104 | 3300042122 | Ga0450920_003841 | Ga0450920_003841_67_1704 | 538 |
| 105 | 3300042123 | Ga0450921_000236 | Ga0450921_000236_546_2183 | 538 |
| 106 | 3300042145 | Ga0450906_004325 | Ga0450906_004325_538_2175 | 538 |
| 107 | 3300044684 | Ga0466966_0000475 | Ga0466966_0000475_14941_16632 | 538 |
| 108 | 3300046660 | Ga0495625_0000224 | Ga0495625_0000224_55209_56846 | 538 |
| 109 | 3300050493 | nmdc:mga0k408_18870_c1 | nmdc:mga0k408_18870_c1_657_2327 | 538 |
| 110 | 3300050496 | nmdc:mga07m45_3895_c1 | nmdc:mga07m45_3895_c1_4350_6017 | 538 |
| 111 | 3300053080 | Ga0500635_0000029 | Ga0500635_0000029_56500_58173 | 538 |
| 112 | 3300028794 | Ga0307515_10003326 | Ga0307515_1000332613 | 539 |
| 113 | 3300031507 | Ga0307509_10070293 | Ga0307509_100702933 | 539 |
| 114 | 3300031616 | Ga0307508_10005499 | Ga0307508_100054999 | 539 |
| 115 | 3300031649 | Ga0307514_10003838 | Ga0307514_100038389 | 539 |
| 116 | 3300033179 | Ga0307507_10063668 | Ga0307507_100636683 | 539 |
| 117 | 3300046472 | Ga0495580_0016167 | Ga0495580_0016167_821_2446 | 541 |
| 118 | 3300009093 | Ga0105240_10009840 | Ga0105240_100098403 | 542 |
| 119 | 3300025913 | Ga0207695_10021168 | Ga0207695_100211685 | 542 |
| 120 | 3300026041 | Ga0207639_10013039 | Ga0207639_100130392 | 542 |
| 121 | 3300047472 | Ga0495686_0001817 | Ga0495686_0001817_12465_14144 | 542 |
| 122 | 3300005548 | Ga0070665_100083845 | Ga0070665_1000838452 | 543 |
| 123 | 3300028379 | Ga0268266_10048942 | Ga0268266_100489423 | 543 |
| 124 | 3300028794 | Ga0307515_10028818 | Ga0307515_100288187 | 543 |
| 125 | 3300030522 | Ga0307512_10054292 | Ga0307512_100542922 | 543 |
| 126 | 3300031456 | Ga0307513_10047156 | Ga0307513_100471562 | 543 |
| 127 | 3300031507 | Ga0307509_10008176 | Ga0307509_100081769 | 543 |
| 128 | 3300031507 | Ga0307509_10044322 | Ga0307509_100443223 | 543 |
| 129 | 3300031507 | Ga0307509_10063084 | Ga0307509_100630843 | 543 |
| 130 | 3300031616 | Ga0307508_10083604 | Ga0307508_100836043 | 543 |
| 131 | 3300033180 | Ga0307510_10072136 | Ga0307510_100721363 | 543 |
| 132 | 3300033180 | Ga0307510_10106099 | Ga0307510_101060993 | 543 |
| 133 | 3300046454 | Ga0495592_0004544 | Ga0495592_0004544_758_2407 | 543 |
| 134 | 3300053136 | Ga0500559_0000019 | Ga0500559_0000019_50836_52485 | 543 |
| 135 | 3300006195 | Ga0075366_10001796 | Ga0075366_1000179611 | 544 |
| 136 | 3300037418 | Ga0395900_0004048 | Ga0395900_0004048_7063_8754 | 544 |
| 137 | 3300037471 | Ga0395905_0035033 | Ga0395905_0035033_1355_3001 | 544 |
| 138 | 3300038443 | Ga0395901_0009297 | Ga0395901_0009297_3498_5189 | 544 |
| 139 | iso_pu_bacteria | 2857542790 | 2857543009 | 544 |
| 140 | 3300002774 | JGI25150J39212_1002560 | JGI25150J39212_10025603 | 545 |
| 141 | 3300005459 | Ga0068867_100013402 | Ga0068867_1000134023 | 545 |
| 142 | 3300005617 | Ga0068859_100082703 | Ga0068859_1000827033 | 545 |
| 143 | 3300005844 | Ga0068862_100044132 | Ga0068862_1000441323 | 545 |
| 144 | 3300006931 | Ga0097620_100082706 | Ga0097620_1000827062 | 545 |
| 145 | 3300009553 | Ga0105249_10032533 | Ga0105249_100325334 | 545 |
| 146 | 3300013297 | Ga0157378_10003514 | Ga0157378_100035149 | 545 |
| 147 | 3300013308 | Ga0157375_10043774 | Ga0157375_100437744 | 545 |
| 148 | 3300014326 | Ga0157380_10016567 | Ga0157380_100165673 | 545 |
| 149 | 3300014968 | Ga0157379_10024806 | Ga0157379_100248063 | 545 |
| 150 | 3300015261 | Ga0182006_1002898 | Ga0182006_10028986 | 545 |
| 151 | 3300025245 | Ga0207425_1000125 | Ga0207425_100012556 | 545 |
| 152 | 3300025294 | Ga0209025_1002265 | Ga0209025_100226514 | 545 |
| 153 | 3300025297 | Ga0209758_1000679 | Ga0209758_100067946 | 545 |
| 154 | 3300025961 | Ga0207712_10032586 | Ga0207712_100325863 | 545 |
| 155 | 3300026089 | Ga0207648_10000190 | Ga0207648_100001904 | 545 |
| 156 | 3300026118 | Ga0207675_100002430 | Ga0207675_1000024303 | 545 |
| 157 | 3300028380 | Ga0268265_10044695 | Ga0268265_100446952 | 545 |
| 158 | 3300028381 | Ga0268264_10037631 | Ga0268264_100376313 | 545 |
| 159 | 3300031730 | Ga0307516_10004749 | Ga0307516_100047495 | 545 |
| 160 | 3300050493 | nmdc:mga0k408_10331_c1 | nmdc:mga0k408_10331_c1_505_2187 | 545 |
| 161 | iso_pu_bacteria | 2881101125 | 2881102477 | 545 |
| 162 | 3300027876 | Ga0209974_10007194 | Ga0209974_100071944 | 546 |
| 163 | 3300028794 | Ga0307515_10000332 | Ga0307515_1000033272 | 546 |
| 164 | 3300028794 | Ga0307515_10012210 | Ga0307515_1001221011 | 546 |
| 165 | 3300028794 | Ga0307515_10059888 | Ga0307515_100598884 | 546 |
| 166 | 3300041452 | Ga0451793_0623531 | Ga0451793_0623531_350_2113 | 546 |
| 167 | 3300048905 | Ga0496102_0143982 | Ga0496102_0143982_459_2129 | 546 |
| 168 | 3300048920 | Ga0496117_0002723 | Ga0496117_0002723_18237_19907 | 546 |
| 169 | 3300048921 | Ga0496118_0016171 | Ga0496118_0016171_1439_3109 | 546 |
| 170 | 3300048927 | Ga0496124_0000013 | Ga0496124_0000013_28526_30256 | 546 |
| 171 | 3300048929 | Ga0496126_0000061 | Ga0496126_0000061_192541_194211 | 546 |
| 172 | iso_pu_bacteria | 2510065045 | 2510248812 | 546 |
| 173 | iso_pu_bacteria | 2585428062 | 2587757583 | 546 |
| 174 | iso_pu_bacteria | 2599185239 | 2599737114 | 546 |
| 175 | iso_pu_bacteria | 2643221654 | 2644301293 | 546 |
| 176 | iso_pu_bacteria | 2718217991 | 2719642762 | 546 |
| 177 | iso_pu_bacteria | 2818991452 | 2819632610 | 546 |
| 178 | iso_pu_bacteria | 2834641062 | 2834643566 | 546 |
| 179 | iso_pu_bacteria | 2863421361 | 2863421640 | 546 |
| 180 | iso_pu_bacteria | 2870068957 | 2870072411 | 546 |
| 181 | iso_pu_bacteria | 2904564687 | 2904565805 | 546 |
| 182 | iso_pu_bacteria | 2904571731 | 2904572848 | 546 |
| 183 | iso_pu_bacteria | 2928170801 | 2928173282 | 546 |
| 184 | iso_pu_bacteria | 2928536128 | 2928538628 | 546 |
| 185 | iso_pu_bacteria | 8003400568 | 8003403639 | 546 |
| 186 | iso_pu_bacteria | 8018845410 | 8018849065 | 546 |
| 187 | iso_pu_bacteria | 8021120328 | 8021126644 | 546 |
| 188 | 3300037068 | Ga0373925_0004630 | Ga0373925_0004630_4020_5729 | 547 |
| 189 | 3300047319 | Ga0495674_0005290 | Ga0495674_0005290_9751_11427 | 547 |
| 190 | iso_pu_bacteria | 2501025502 | 2501083685 | 547 |
| 191 | iso_pu_bacteria | 2501025504 | 2501413234 | 547 |
| 192 | iso_pu_bacteria | 2510917013 | 2511087485 | 547 |
| 193 | iso_pu_bacteria | 2510917014 | 2511100323 | 547 |
| 194 | iso_pu_bacteria | 2510917015 | 2511106012 | 547 |
| 195 | iso_pu_bacteria | 2513237082 | 2513551925 | 547 |
| 196 | iso_pu_bacteria | 2513237083 | 2513563305 | 547 |
| 197 | iso_pu_bacteria | 2858688981 | 2858699208 | 547 |
| 198 | iso_pu_bacteria | 2883087390 | 2883090855 | 547 |
| 199 | iso_pu_bacteria | 8003955200 | 8003957092 | 547 |
| 200 | 3300038443 | Ga0395901_0004563 | Ga0395901_0004563_2654_4333 | 549 |
| 201 | iso_pu_bacteria | 2599185240 | 2599742808 | 549 |
| 202 | iso_pu_bacteria | 2599185355 | 2600204926 | 549 |
| 203 | iso_pu_bacteria | 2675903129 | 2676741915 | 549 |
| 204 | iso_pu_bacteria | 8020938398 | 8020944794 | 549 |
| 205 | iso_pu_bacteria | 8020945358 | 8020949661 | 549 |
| 206 | iso_pu_bacteria | 8020953355 | 8020959871 | 549 |
| 207 | 3300003758 | Ga0055532_1002905 | Ga0055532_10029053 | 550 |
| 208 | 3300003758 | Ga0055532_1003276 | Ga0055532_10032762 | 550 |
| 209 | 3300003761 | Ga0055535_1002309 | Ga0055535_10023097 | 550 |
| 210 | 3300003762 | Ga0055542_1002195 | Ga0055542_10021957 | 550 |
| 211 | 3300003763 | Ga0055529_1001176 | Ga0055529_100117613 | 550 |
| 212 | 3300003790 | Ga0055528_1003131 | Ga0055528_10031315 | 550 |
| 213 | 3300003856 | Ga0058692_1000957 | Ga0058692_10009575 | 550 |
| 214 | 3300009093 | Ga0105240_10006071 | Ga0105240_1000607116 | 550 |
| 215 | 3300015262 | Ga0182007_10002911 | Ga0182007_100029113 | 550 |
| 216 | 3300015262 | Ga0182007_10015991 | Ga0182007_100159913 | 550 |
| 217 | 3300025225 | Ga0209566_100170 | Ga0209566_10017041 | 550 |
| 218 | 3300025228 | Ga0209672_100028 | Ga0209672_100028249 | 550 |
| 219 | 3300025229 | Ga0209147_100117 | Ga0209147_10011761 | 550 |
| 220 | 3300025229 | Ga0209147_100488 | Ga0209147_10048812 | 550 |
| 221 | 3300025242 | Ga0209258_100112 | Ga0209258_100112103 | 550 |
| 222 | 3300025254 | Ga0209148_1001535 | Ga0209148_100153512 | 550 |
| 223 | 3300025272 | Ga0209455_1000050 | Ga0209455_100005071 | 550 |
| 224 | 3300025273 | Ga0209673_1000038 | Ga0209673_10000386 | 550 |
| 225 | 3300025913 | Ga0207695_10001729 | Ga0207695_1000172921 | 550 |
| 226 | 3300027312 | Ga0209371_1000090 | Ga0209371_100009058 | 550 |
| 227 | 3300030500 | Ga0268256_1000115 | Ga0268256_10001155 | 550 |
| 228 | 3300046462 | Ga0495651_0000657 | Ga0495651_0000657_15698_17383 | 550 |
| 229 | 3300046472 | Ga0495580_0004669 | Ga0495580_0004669_244_1950 | 550 |
| 230 | 3300046511 | Ga0495608_0006214 | Ga0495608_0006214_4815_6500 | 550 |
| 231 | 3300046516 | Ga0495628_0000037 | Ga0495628_0000037_47763_49448 | 550 |
| 232 | 3300046529 | Ga0495652_0005170 | Ga0495652_0005170_7321_9006 | 550 |
| 233 | 3300046679 | Ga0495623_0003620 | Ga0495623_0003620_4389_6074 | 550 |
| 234 | 3300048088 | Ga0495602_0004236 | Ga0495602_0004236_3611_5296 | 550 |
| 235 | 3300003763 | Ga0055529_1001109 | Ga0055529_10011096 | 551 |
| 236 | 3300025228 | Ga0209672_101689 | Ga0209672_1016897 | 551 |
| 237 | 3300025272 | Ga0209455_1000534 | Ga0209455_10005346 | 551 |
| 238 | 3300028800 | Ga0265338_10002854 | Ga0265338_1000285419 | 551 |
| 239 | 3300048919 | Ga0496116_0002163 | Ga0496116_0002163_11400_13124 | 551 |
| 240 | 3300049823 | Ga0501044_0000185 | Ga0501044_0000185_56173_57876 | 551 |
| 241 | iso_pu_bacteria | 2928157003 | 2928159778 | 551 |
| 242 | iso_pu_bacteria | 2928163908 | 2928164164 | 551 |
| 243 | iso_pu_bacteria | 8039098773 | 8039099259 | 551 |
| 244 | 3300037471 | Ga0395905_0004949 | Ga0395905_0004949_7431_9143 | 552 |
| 245 | 3300046522 | Ga0495643_0023982 | Ga0495643_0023982_1351_3063 | 552 |
| 246 | 3300038443 | Ga0395901_0000043 | Ga0395901_0000043_147202_148950 | 553 |
| 247 | 3300044684 | Ga0466966_0000063 | Ga0466966_0000063_24782_26509 | 553 |
| 248 | 3300044693 | Ga0466961_0001093 | Ga0466961_0001093_544_2271 | 553 |
| 249 | 3300044694 | Ga0466963_0034517 | Ga0466963_0034517_1054_2781 | 553 |
| 250 | 3300044719 | Ga0466971_0003234 | Ga0466971_0003234_536_2263 | 553 |
| 251 | 3300045836 | Ga0466958_0004267 | Ga0466958_0004267_613_2340 | 553 |
| 252 | 3300061719 | Ga0466962_0003474 | Ga0466962_0003474_3502_5229 | 553 |
| 253 | iso_pu_bacteria | 2519103095 | 2519457943 | 554 |
| 254 | iso_pu_bacteria | 2582581311 | 2585295240 | 554 |
| 255 | iso_pu_bacteria | 2816332253 | 2817260117 | 554 |
| 256 | iso_pu_bacteria | 2816332256 | 2817277781 | 554 |
| 257 | iso_pu_bacteria | 2816332286 | 2817455825 | 554 |
| 258 | iso_pu_bacteria | 2981990288 | 2981994223 | 554 |
| 259 | iso_pu_bacteria | 8020807995 | 8020810470 | 554 |
| 260 | iso_pu_bacteria | 8040167225 | 8040171771 | 554 |
| 261 | iso_pu_bacteria | 8040173305 | 8040176284 | 554 |
| 262 | 3300001989 | JGI24739J22299_10013501 | JGI24739J22299_100135013 | 555 |
| 263 | 3300003758 | Ga0055532_1001472 | Ga0055532_10014726 | 555 |
| 264 | 3300003760 | Ga0055527_1000988 | Ga0055527_10009886 | 555 |
| 265 | 3300003761 | Ga0055535_1002319 | Ga0055535_10023196 | 555 |
| 266 | 3300005339 | Ga0070660_100000008 | Ga0070660_10000000815 | 555 |
| 267 | 3300005366 | Ga0070659_100000087 | Ga0070659_10000008760 | 555 |
| 268 | 3300009092 | Ga0105250_10008182 | Ga0105250_100081823 | 555 |
| 269 | 3300009093 | Ga0105240_10118787 | Ga0105240_101187873 | 555 |
| 270 | 3300015265 | Ga0182005_1009511 | Ga0182005_10095112 | 555 |
| 271 | 3300025228 | Ga0209672_100038 | Ga0209672_10003872 | 555 |
| 272 | 3300025229 | Ga0209147_100112 | Ga0209147_10011284 | 555 |
| 273 | 3300025242 | Ga0209258_100109 | Ga0209258_100109104 | 555 |
| 274 | 3300025254 | Ga0209148_1002458 | Ga0209148_10024583 | 555 |
| 275 | 3300025272 | Ga0209455_1000752 | Ga0209455_100075217 | 555 |
| 276 | 3300025711 | Ga0207696_1008997 | Ga0207696_10089973 | 555 |
| 277 | 3300025904 | Ga0207647_10019558 | Ga0207647_100195581 | 555 |
| 278 | 3300025909 | Ga0207705_10051380 | Ga0207705_100513803 | 555 |
| 279 | 3300025913 | Ga0207695_10075687 | Ga0207695_100756872 | 555 |
| 280 | 3300025919 | Ga0207657_10000337 | Ga0207657_1000033738 | 555 |
| 281 | 3300025924 | Ga0207694_10006796 | Ga0207694_100067962 | 555 |
| 282 | 3300025932 | Ga0207690_10000006 | Ga0207690_1000000615 | 555 |
| 283 | 3300025949 | Ga0207667_10026684 | Ga0207667_100266845 | 555 |
| 284 | 3300026067 | Ga0207678_10000228 | Ga0207678_1000022815 | 555 |
| 285 | 3300044693 | Ga0466961_0056892 | Ga0466961_0056892_456_2183 | 555 |
| 286 | 3300048920 | Ga0496117_0062015 | Ga0496117_0062015_170_2101 | 555 |
| 287 | 3300048924 | Ga0496121_0092740 | Ga0496121_0092740_603_2279 | 555 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6eod-assembly3.cif.gz_C | structure of reductive aminase from aspergillus terreus in complex with nadph | 0.9584 | 27 | 56 |
| 8bj5-assembly2.cif.gz_C | imine reductase ir007 from amycolatopsis azurea | 0.9571 | 29 | 56 |
| 3l6d-assembly1.cif.gz_A | crystal structure of putative oxidoreductase from pseudomonas putida kt2440 | 0.9463 | 27 | 56 |
| 5a9s-assembly1.cif.gz_B | nadph complex of imine reductase from amycolatopsis orientalis | 0.9386 | 28 | 56 |
| 8c79-assembly1.cif.gz_B | crystal structure of leishmania donovani 6-phosphogluconate dehydrogenase complexed with nadph | 0.9338 | 27 | 56 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K8F7V7_1826_1944_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9831 | 29 | 55 | 3.50.50.60 |
| 2f1kD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9708 | 28 | 56 | 3.40.50.720 |
| af_Q4DU92_1_145_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9662 | 28 | 56 | 3.40.50.720 |
| af_C0VXV5_2_190_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9645 | 28 | 58 | 3.40.50.720 |
| 1yonA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9556 | 29 | 56 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1CDN8-F1-model_v4 | FAD-dependent oxidoreductase | 0.9702 | 1 | 409 |
GO:0008688
GO:0019622 GO:0071949 |
| AF-A0A2N2SAA5-F1-model_v4 | FAD-dependent oxidoreductase | 0.9697 | 70 | 553 |
GO:0016709
GO:0071949 |
| AF-A0A442GX02-F1-model_v4 | FAD-dependent oxidoreductase | 0.9652 | 5 | 553 |
GO:0016709
GO:0071949 |
| AF-L2EHU1-F1-model_v4 | deleted | 0.9638 | 1 | 513 |
|
| AF-A0A2N2SAA5-F1-model_v4 | FAD-dependent oxidoreductase | 0.9619 | 70 | 553 |
GO:0016709
GO:0071949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar