F388135

General Info

Members Datasets Scaffolds Average Seq Length
287 131 575 221

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_2689600|Ga0451807_2689600_99_737
Length 212
Sequence VVDDHEVVRQGLVALLDRRDGFQVVAEAGTVAEAIEQARRFQPDIVVMDVRLPDGSGIEACREIRSELPQTRVVMLTSYPDEEAVLSAIVAGASGYLLKQIRARDLVAALENVGRGESLLDPAVTEKVLERIRRIATGSQETDELSQLTGQERKILMLVAEGKTNKEIAAEIYLSDKTVKNYVSSILAKLNLERRAQAAAFVAKHRLDRGGV

Samples

Sample ID Description Type Environment
1 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
60 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
61 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
62 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
70 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
75 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
78 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
79 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
80 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
81 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
84 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
105 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
106 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
107 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
108 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
116 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
124 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
125 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
126 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
127 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
128 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
129 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
131 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 6.62
Rhizosphere 91.29
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451807_2689600 3300041486 Bacteria 1188
2 rootH1_10007988 3300003316 Bacteria 6158
3 rootH1_10007988 3300003323 Bacteria 4007
4 rootH2_10029229 3300003320 Bacteria 8744
5 rootH2_10085022 3300003320 Bacteria 3117
6 Ga0070660_100683549 3300005339 Bacteria 860
7 Ga0070689_100231554 3300005340 Bacteria 1519
8 Ga0070671_100235163 3300005355 Bacteria 1555
9 Ga0070708_100000243 3300005445 Bacteria 40502
10 Ga0070708_100262176 3300005445 Bacteria 1625
11 Ga0070662_100249950 3300005457 Bacteria 1425
12 Ga0068867_100370635 3300005459 Bacteria 1200
13 Ga0070706_100111404 3300005467 Bacteria 2547
14 Ga0070707_100014846 3300005468 Bacteria 7303
15 Ga0070707_100018286 3300005468 Bacteria 6595
16 Ga0070707_100033632 3300005468 Bacteria 4888
17 Ga0070707_100457331 3300005468 Bacteria 1237
18 Ga0070698_100008491 3300005471 Bacteria 11095
19 Ga0070698_100220737 3300005471 Bacteria 1829
20 Ga0070699_100001520 3300005518 Bacteria 21203
21 Ga0070699_100011559 3300005518 Bacteria 7622
22 Ga0070699_100262155 3300005518 Bacteria 1546
23 Ga0070697_100040321 3300005536 Bacteria 3777
24 Ga0070697_100329622 3300005536 Bacteria 1316
25 Ga0070686_100204715 3300005544 Bacteria 1417
26 Ga0070696_100073015 3300005546 Bacteria 2417
27 Ga0070696_100833392 3300005546 Bacteria 761
28 Ga0070704_100035645 3300005549 Bacteria 3384
29 Ga0070704_100179745 3300005549 Bacteria 1691
30 Ga0068858_100476207 3300005842 Bacteria 1205
31 Ga0068862_100090620 3300005844 Bacteria 2662
32 Ga0075367_10371762 3300006178 Unclassified 903
33 Ga0075433_10002616 3300006852 Bacteria 13729
34 Ga0075434_100199806 3300006871 Bacteria 2019
35 Ga0075434_100393888 3300006871 Bacteria 1406
36 Ga0075435_100026130 3300007076 Bacteria 4552
37 Ga0111539_10469899 3300009094 Bacteria 1465
38 Ga0105245_10065351 3300009098 Bacteria 3290
39 Ga0105245_10782749 3300009098 Unclassified 991
40 Ga0105245_10817276 3300009098 Bacteria 971
41 Ga0105245_10968013 3300009098 Bacteria 894
42 Ga0114129_10000286 3300009147 Bacteria 58249
43 Ga0114129_10057005 3300009147 Bacteria 5470
44 Ga0114129_10354858 3300009147 Bacteria 1941
45 Ga0114129_10560853 3300009147 Bacteria 1484
46 Ga0114129_11027530 3300009147 Bacteria 1036
47 Ga0105239_10096407 3300010375 Bacteria 3268
48 Ga0105239_10333370 3300010375 Bacteria 1712
49 Ga0105246_10028648 3300011119 Bacteria 3660
50 Ga0157378_10287859 3300013297 Bacteria 1586
51 Ga0157375_10010755 3300013308 Bacteria 8062
52 Ga0163163_10023520 3300014325 Bacteria 5849
53 Ga0163163_10442911 3300014325 Bacteria 1359
54 Ga0163163_10788936 3300014325 Bacteria 1013
55 Ga0157380_10267309 3300014326 Bacteria 1557
56 Ga0157380_10273481 3300014326 Bacteria 1541
57 Ga0157379_10047225 3300014968 Bacteria 3840
58 Ga0157379_10511786 3300014968 Bacteria 1113
59 Ga0157376_10473617 3300014969 Bacteria 1226
60 Ga0163161_10251115 3300017792 Bacteria 1379
61 Ga0207688_10016866 3300025901 Bacteria 3966
62 Ga0207707_10035186 3300025912 Bacteria 4380
63 Ga0207663_10418153 3300025916 Bacteria 1028
64 Ga0207646_10046287 3300025922 Bacteria 3903
65 Ga0207646_10075816 3300025922 Bacteria 3005
66 Ga0207646_10159038 3300025922 Bacteria 2038
67 Ga0207646_10399089 3300025922 Bacteria 1242
68 Ga0207687_10074027 3300025927 Bacteria 2440
69 Ga0207687_10358639 3300025927 Bacteria 1189
70 Ga0207706_10251840 3300025933 Bacteria 1542
71 Ga0207706_10336259 3300025933 Bacteria 1314
72 Ga0207711_10598467 3300025941 Bacteria 1029
73 Ga0207661_10585206 3300025944 Bacteria 1024
74 Ga0207712_10033216 3300025961 Bacteria 3486
75 Ga0207640_10278070 3300025981 Unclassified 1313
76 Ga0207677_10177325 3300026023 Bacteria 1673
77 Ga0207677_10633885 3300026023 Bacteria 941
78 Ga0207703_10551116 3300026035 Bacteria 1087
79 Ga0207678_10285907 3300026067 Bacteria 1416
80 Ga0207702_10592892 3300026078 Bacteria 1087
81 Ga0207641_10036303 3300026088 Bacteria 4114
82 Ga0207648_10415347 3300026089 Bacteria 1221
83 Ga0207676_10024200 3300026095 Bacteria 4491
84 Ga0207674_10344884 3300026116 Bacteria 1440
85 Ga0209968_1027828 3300027526 Bacteria 937
86 Ga0209982_1015374 3300027552 Bacteria 1161
87 Ga0209971_1000264 3300027682 Bacteria 14802
88 Ga0209998_10000431 3300027717 Bacteria 11754
89 Ga0209974_10001213 3300027876 Bacteria 9237
90 Ga0265322_10008470 3300028654 Bacteria 2995
91 Ga0265336_10036682 3300028666 Bacteria 1509
92 Ga0316576_10046892 3300031727 Bacteria 3129
93 Ga0316578_10064783 3300031728 Bacteria 2157
94 Ga0307413_10020276 3300031824 Bacteria 3532
95 Ga0307413_10279022 3300031824 Bacteria 1256
96 Ga0307413_10401565 3300031824 Bacteria 1074
97 Ga0307407_10053870 3300031903 Bacteria 2317
98 Ga0307409_100127370 3300031995 Bacteria 2168
99 Ga0307409_100842616 3300031995 Bacteria 927
100 Ga0307416_100452606 3300032002 Bacteria 1337
101 Ga0307416_100953203 3300032002 Bacteria 960
102 Ga0307411_10017616 3300032005 Bacteria 4077
103 Ga0307415_100093111 3300032126 Bacteria 2187
104 Ga0373960_0276396 3300035121 Bacteria 618
105 Ga0373946_0193435 3300035171 Bacteria 971
106 Ga0373937_0989481 3300036401 Bacteria 790
107 Ga0373925_0193200 3300037068 Bacteria 1616
108 Ga0451853_3409581 3300041512 Bacteria 660
109 Ga0451853_4050453 3300041512 Bacteria 1156
110 Ga0439441_000944 3300042001 Bacteria 3542
111 Ga0450910_029761 3300042147 Bacteria 854
112 Ga0451577_0467169 3300042876 Bacteria 1146
113 Ga0495613_0705367 3300046689 Bacteria 664
114 Ga0495676_0222010 3300047321 Bacteria 1302
115 Ga0495676_0494002 3300047321 Bacteria 804
116 Ga0496100_0460644 3300048903 Bacteria 976
117 Ga0496101_0538987 3300048904 Bacteria 923
118 Ga0496104_0015808 3300048907 Bacteria 6846
119 Ga0496104_0026784 3300048907 Bacteria 5328
120 Ga0496105_0002943 3300048908 Bacteria 12510
121 Ga0496105_0050873 3300048908 Bacteria 3423
122 Ga0496106_0811862 3300048909 Bacteria 742
123 Ga0496107_0335841 3300048910 Bacteria 1124
124 Ga0496108_0006441 3300048911 Bacteria 9515
125 Ga0496108_0337526 3300048911 Bacteria 1315
126 Ga0496109_0004751 3300048912 Bacteria 11350
127 Ga0496109_0205272 3300048912 Bacteria 1853
128 Ga0496109_0359896 3300048912 Unclassified 1375
129 Ga0496111_0000812 3300048914 Bacteria 16775
130 Ga0496112_0007442 3300048915 Bacteria 9719
131 Ga0496113_0018044 3300048916 Bacteria 4909
132 Ga0496114_0208395 3300048917 Bacteria 1714
133 Ga0496114_0316949 3300048917 Bacteria 1378
134 Ga0501031_0003785 3300049568 Bacteria 9737
135 Ga0501031_0062810 3300049568 Bacteria 2420
136 Ga0501031_0074242 3300049568 Bacteria 2214
137 Ga0501032_0039407 3300049569 Bacteria 3214
138 Ga0501033_0200627 3300049570 Bacteria 1425
139 Ga0501034_0453301 3300049571 Bacteria 1200
140 Ga0501036_0027796 3300049572 Bacteria 4781
141 Ga0501036_0032665 3300049572 Bacteria 4399
142 Ga0501036_0054170 3300049572 Bacteria 3397
143 Ga0501036_0090279 3300049572 Bacteria 2588
144 Ga0501036_0184811 3300049572 Bacteria 1754
145 Ga0501037_0025848 3300049573 Bacteria 4336
146 Ga0501037_0294194 3300049573 Bacteria 1129
147 Ga0501037_0522077 3300049573 Bacteria 804
148 Ga0501038_0033973 3300049574 Bacteria 4487
149 Ga0501038_0158488 3300049574 Bacteria 1841
150 Ga0501040_0002763 3300049576 Bacteria 11302
151 Ga0501040_0015825 3300049576 Bacteria 4985
152 Ga0501040_0079488 3300049576 Bacteria 2270
153 Ga0501040_0082080 3300049576 Bacteria 2234
154 Ga0501040_0158386 3300049576 Bacteria 1600
155 Ga0501040_0181784 3300049576 Bacteria 1491
156 Ga0501041_0002966 3300049577 Bacteria 9730
157 Ga0501041_0017301 3300049577 Bacteria 4289
158 Ga0501041_0045735 3300049577 Bacteria 2662
159 Ga0501041_0081738 3300049577 Bacteria 1990
160 Ga0501041_0207618 3300049577 Bacteria 1228
161 Ga0501042_0003928 3300049578 Bacteria 9405
162 Ga0501042_0032731 3300049578 Bacteria 3683
163 Ga0501042_0081167 3300049578 Bacteria 2324
164 Ga0501042_0085672 3300049578 Bacteria 2259
165 Ga0501042_0250501 3300049578 Bacteria 1278
166 Ga0501042_0448937 3300049578 Bacteria 935
167 Ga0501043_0033994 3300049579 Bacteria 4011
168 Ga0501043_0038690 3300049579 Bacteria 3751
169 Ga0501046_0009031 3300049580 Bacteria 8642
170 Ga0501046_0031034 3300049580 Bacteria 4335
171 Ga0501046_0138923 3300049580 Bacteria 1840
172 Ga0501048_0003835 3300049582 Bacteria 11468
173 Ga0501048_0010414 3300049582 Bacteria 6944
174 Ga0501048_0020984 3300049582 Bacteria 4785
175 Ga0501048_0022318 3300049582 Bacteria 4631
176 Ga0501048_0030055 3300049582 Bacteria 3935
177 Ga0501067_0002476 3300049583 Bacteria 10192
178 Ga0501067_0006854 3300049583 Bacteria 6321
179 Ga0501067_0008151 3300049583 Bacteria 5820
180 Ga0501067_0181655 3300049583 Bacteria 1172
181 Ga0501068_0054282 3300049584 Bacteria 2427
182 Ga0501068_0433961 3300049584 Bacteria 849
183 Ga0501069_0000976 3300049585 Bacteria 13606
184 Ga0501069_0029603 3300049585 Bacteria 3005
185 Ga0501069_0046934 3300049585 Bacteria 2397
186 Ga0501069_0217669 3300049585 Bacteria 1109
187 Ga0501071_0004215 3300049587 Bacteria 9104
188 Ga0501071_0011650 3300049587 Bacteria 5935
189 Ga0501071_0020020 3300049587 Bacteria 4649
190 Ga0501071_0020961 3300049587 Bacteria 4549
191 Ga0501071_0073709 3300049587 Bacteria 2490
192 Ga0501071_0081067 3300049587 Bacteria 2374
193 Ga0501071_0211937 3300049587 Bacteria 1457
194 Ga0501071_0274933 3300049587 Bacteria 1274
195 Ga0501071_0992769 3300049587 Bacteria 648
196 Ga0501072_0002519 3300049588 Bacteria 13723
197 Ga0501072_0021165 3300049588 Bacteria 5045
198 Ga0501072_0042102 3300049588 Bacteria 3587
199 Ga0501072_0163454 3300049588 Bacteria 1776
200 Ga0501072_0322244 3300049588 Bacteria 1228
201 Ga0501074_0005921 3300049590 Bacteria 8816
202 Ga0501074_0007000 3300049590 Bacteria 8146
203 Ga0501074_0040973 3300049590 Bacteria 3353
204 Ga0501074_0102969 3300049590 Bacteria 2044
205 Ga0501074_0227368 3300049590 Bacteria 1328
206 Ga0501075_0001599 3300049591 Bacteria 14828
207 Ga0501075_0017076 3300049591 Bacteria 5237
208 Ga0501075_0026795 3300049591 Bacteria 4245
209 Ga0501075_0146028 3300049591 Bacteria 1802
210 Ga0501075_0256397 3300049591 Bacteria 1333
211 Ga0501075_0407980 3300049591 Bacteria 1036
212 Ga0501075_0686332 3300049591 Bacteria 780
213 Ga0501076_0005006 3300049592 Bacteria 9484
214 Ga0501076_0009745 3300049592 Bacteria 7097
215 Ga0501076_0018044 3300049592 Bacteria 5370
216 Ga0501076_0073573 3300049592 Bacteria 2736
217 Ga0501076_0106038 3300049592 Bacteria 2268
218 Ga0501076_1059719 3300049592 Bacteria 668
219 Ga0501077_0005454 3300049593 Bacteria 7741
220 Ga0501077_0006636 3300049593 Bacteria 7107
221 Ga0501077_0084243 3300049593 Bacteria 2015
222 Ga0501077_0096821 3300049593 Bacteria 1870
223 Ga0501077_0116133 3300049593 Bacteria 1696
224 Ga0501079_0005802 3300049741 Bacteria 9228
225 Ga0501079_0015146 3300049741 Bacteria 5880
226 Ga0501079_0036397 3300049741 Bacteria 3792
227 Ga0501079_0040813 3300049741 Bacteria 3581
228 Ga0501079_0099146 3300049741 Bacteria 2258
229 Ga0501079_0108732 3300049741 Bacteria 2153
230 Ga0501079_0205465 3300049741 Bacteria 1538
231 Ga0501080_0010879 3300049742 Bacteria 8328
232 Ga0501080_0014433 3300049742 Bacteria 7276
233 Ga0501080_0048548 3300049742 Bacteria 3951
234 Ga0501080_0315968 3300049742 Bacteria 1415
235 Ga0501080_0342984 3300049742 Bacteria 1350
236 Ga0501081_0009679 3300049743 Bacteria 6283
237 Ga0501081_0030827 3300049743 Bacteria 3632
238 Ga0501081_0032910 3300049743 Bacteria 3520
239 Ga0501081_0070261 3300049743 Bacteria 2440
240 Ga0501081_0083878 3300049743 Unclassified 2234
241 Ga0501081_0123809 3300049743 Bacteria 1844
242 Ga0501081_0160867 3300049743 Bacteria 1618
243 Ga0501081_0430479 3300049743 Bacteria 979
244 Ga0501083_0084881 3300049744 Bacteria 2095
245 Ga0501083_0397885 3300049744 Bacteria 896
246 Ga0501035_0031546 3300049822 Bacteria 4825
247 Ga0501035_0058005 3300049822 Bacteria 3451
248 Ga0501035_0247952 3300049822 Bacteria 1513
249 Ga0501035_0409368 3300049822 Bacteria 1127
250 Ga0501044_0055227 3300049823 Bacteria 4080
251 Ga0501045_0015390 3300049824 Bacteria 5430
252 Ga0501045_0016894 3300049824 Bacteria 5181
253 Ga0501045_0026904 3300049824 Bacteria 4140
254 Ga0501045_0027603 3300049824 Bacteria 4092
255 Ga0501045_0065584 3300049824 Bacteria 2666
256 nmdc:mga05p37_254306_c1 3300050507 Bacteria 2106
257 nmdc:mga05p37_41374_c2 3300050507 Bacteria 3532
258 nmdc:mga05p37_647977_c1 3300050507 Bacteria 1183
259 nmdc:mga08y16_79660_c1 3300050511 Bacteria 3414
260 nmdc:mga0n895_148655_c1 3300050512 Bacteria 1659
261 nmdc:mga0n895_252835_c1 3300050512 Bacteria 1788
262 nmdc:mga0n895_395484_c1 3300050512 Bacteria 1398
263 nmdc:mga0n895_91260_c1 3300050512 Bacteria 3048
264 nmdc:mga0a205_2161_c1 3300050515 Bacteria 15672
265 Ga0495601_0079207 3300053077 Bacteria 2106
266 Ga0495619_0374228 3300053085 Bacteria 984
267 Ga0501084_0002469 3300054114 Bacteria 14895
268 Ga0501084_0005997 3300054114 Bacteria 9995
269 Ga0501084_0016146 3300054114 Bacteria 6200
270 Ga0501084_0039919 3300054114 Bacteria 3925
271 Ga0501084_0255343 3300054114 Bacteria 1480
272 Ga0501084_0381331 3300054114 Bacteria 1191
273 Ga0590071_003483 3300059421 Bacteria 3863
274 Ga0590074_014401 3300059423 Bacteria 1338
275 Ga0590077_004768 3300059426 Bacteria 2775
276 Ga0501082_0010921 3300060353 Bacteria 7816
277 Ga0501082_0014119 3300060353 Bacteria 6872
278 Ga0501082_0045339 3300060353 Bacteria 3792
279 Ga0501082_0170450 3300060353 Bacteria 1892
280 Ga0501082_0802851 3300060353 Bacteria 823
281 Ga0530510_0000416 3300061734 Bacteria 27646
282 Ga0530510_0000743 3300061734 Bacteria 21139
283 Ga0530510_0026030 3300061734 Bacteria 4184
284 Ga0530510_0072456 3300061734 Bacteria 2500
285 Ga0530510_0076012 3300061734 Bacteria 2439
286 Ga0530510_0094257 3300061734 Bacteria 2186
287 Ga0530510_0379693 3300061734 Bacteria 1063
288 Ga0530510_0534847 3300061734 Bacteria 889
289 Ga0451807_2689600
290 rootH1_10007988
291 rootH2_10029229
292 rootH2_10085022
293 Ga0070660_100683549
294 Ga0070689_100231554
295 Ga0070671_100235163
296 Ga0070708_100000243
297 Ga0070708_100262176
298 Ga0070662_100249950
299 Ga0068867_100370635
300 Ga0070706_100111404
301 Ga0070707_100014846
302 Ga0070707_100018286
303 Ga0070707_100033632
304 Ga0070707_100457331
305 Ga0070698_100008491
306 Ga0070698_100220737
307 Ga0070699_100001520
308 Ga0070699_100011559
309 Ga0070699_100262155
310 Ga0070697_100040321
311 Ga0070697_100329622
312 Ga0070686_100204715
313 Ga0070696_100073015
314 Ga0070696_100833392
315 Ga0070704_100035645
316 Ga0070704_100179745
317 Ga0068858_100476207
318 Ga0068862_100090620
319 Ga0075367_10371762
320 Ga0075433_10002616
321 Ga0075434_100199806
322 Ga0075434_100393888
323 Ga0075435_100026130
324 Ga0111539_10469899
325 Ga0105245_10065351
326 Ga0105245_10782749
327 Ga0105245_10817276
328 Ga0105245_10968013
329 Ga0114129_10000286
330 Ga0114129_10057005
331 Ga0114129_10354858
332 Ga0114129_10560853
333 Ga0114129_11027530
334 Ga0105239_10096407
335 Ga0105239_10333370
336 Ga0105246_10028648
337 Ga0157378_10287859
338 Ga0157375_10010755
339 Ga0163163_10023520
340 Ga0163163_10442911
341 Ga0163163_10788936
342 Ga0157380_10267309
343 Ga0157380_10273481
344 Ga0157379_10047225
345 Ga0157379_10511786
346 Ga0157376_10473617
347 Ga0163161_10251115
348 Ga0207688_10016866
349 Ga0207707_10035186
350 Ga0207663_10418153
351 Ga0207646_10046287
352 Ga0207646_10075816
353 Ga0207646_10159038
354 Ga0207646_10399089
355 Ga0207687_10074027
356 Ga0207687_10358639
357 Ga0207706_10251840
358 Ga0207706_10336259
359 Ga0207711_10598467
360 Ga0207661_10585206
361 Ga0207712_10033216
362 Ga0207640_10278070
363 Ga0207677_10177325
364 Ga0207677_10633885
365 Ga0207703_10551116
366 Ga0207678_10285907
367 Ga0207702_10592892
368 Ga0207641_10036303
369 Ga0207648_10415347
370 Ga0207676_10024200
371 Ga0207674_10344884
372 Ga0209968_1027828
373 Ga0209982_1015374
374 Ga0209971_1000264
375 Ga0209998_10000431
376 Ga0209974_10001213
377 Ga0265322_10008470
378 Ga0265336_10036682
379 Ga0316576_10046892
380 Ga0316578_10064783
381 Ga0307413_10020276
382 Ga0307413_10279022
383 Ga0307413_10401565
384 Ga0307407_10053870
385 Ga0307409_100127370
386 Ga0307409_100842616
387 Ga0307416_100452606
388 Ga0307416_100953203
389 Ga0307411_10017616
390 Ga0307415_100093111
391 Ga0373960_0276396
392 Ga0373946_0193435
393 Ga0373937_0989481
394 Ga0373925_0193200
395 Ga0451853_3409581
396 Ga0451853_4050453
397 Ga0439441_000944
398 Ga0450910_029761
399 Ga0451577_0467169
400 Ga0495613_0705367
401 Ga0495676_0222010
402 Ga0495676_0494002
403 Ga0496100_0460644
404 Ga0496101_0538987
405 Ga0496104_0015808
406 Ga0496104_0026784
407 Ga0496105_0002943
408 Ga0496105_0050873
409 Ga0496106_0811862
410 Ga0496107_0335841
411 Ga0496108_0006441
412 Ga0496108_0337526
413 Ga0496109_0004751
414 Ga0496109_0205272
415 Ga0496109_0359896
416 Ga0496111_0000812
417 Ga0496112_0007442
418 Ga0496113_0018044
419 Ga0496114_0208395
420 Ga0496114_0316949
421 Ga0501031_0003785
422 Ga0501031_0062810
423 Ga0501031_0074242
424 Ga0501032_0039407
425 Ga0501033_0200627
426 Ga0501034_0453301
427 Ga0501036_0027796
428 Ga0501036_0032665
429 Ga0501036_0054170
430 Ga0501036_0090279
431 Ga0501036_0184811
432 Ga0501037_0025848
433 Ga0501037_0294194
434 Ga0501037_0522077
435 Ga0501038_0033973
436 Ga0501038_0158488
437 Ga0501040_0002763
438 Ga0501040_0015825
439 Ga0501040_0079488
440 Ga0501040_0082080
441 Ga0501040_0158386
442 Ga0501040_0181784
443 Ga0501041_0002966
444 Ga0501041_0017301
445 Ga0501041_0045735
446 Ga0501041_0081738
447 Ga0501041_0207618
448 Ga0501042_0003928
449 Ga0501042_0032731
450 Ga0501042_0081167
451 Ga0501042_0085672
452 Ga0501042_0250501
453 Ga0501042_0448937
454 Ga0501043_0033994
455 Ga0501043_0038690
456 Ga0501046_0009031
457 Ga0501046_0031034
458 Ga0501046_0138923
459 Ga0501048_0003835
460 Ga0501048_0010414
461 Ga0501048_0020984
462 Ga0501048_0022318
463 Ga0501048_0030055
464 Ga0501067_0002476
465 Ga0501067_0006854
466 Ga0501067_0008151
467 Ga0501067_0181655
468 Ga0501068_0054282
469 Ga0501068_0433961
470 Ga0501069_0000976
471 Ga0501069_0029603
472 Ga0501069_0046934
473 Ga0501069_0217669
474 Ga0501071_0004215
475 Ga0501071_0011650
476 Ga0501071_0020020
477 Ga0501071_0020961
478 Ga0501071_0073709
479 Ga0501071_0081067
480 Ga0501071_0211937
481 Ga0501071_0274933
482 Ga0501071_0992769
483 Ga0501072_0002519
484 Ga0501072_0021165
485 Ga0501072_0042102
486 Ga0501072_0163454
487 Ga0501072_0322244
488 Ga0501074_0005921
489 Ga0501074_0007000
490 Ga0501074_0040973
491 Ga0501074_0102969
492 Ga0501074_0227368
493 Ga0501075_0001599
494 Ga0501075_0017076
495 Ga0501075_0026795
496 Ga0501075_0146028
497 Ga0501075_0256397
498 Ga0501075_0407980
499 Ga0501075_0686332
500 Ga0501076_0005006
501 Ga0501076_0009745
502 Ga0501076_0018044
503 Ga0501076_0073573
504 Ga0501076_0106038
505 Ga0501076_1059719
506 Ga0501077_0005454
507 Ga0501077_0006636
508 Ga0501077_0084243
509 Ga0501077_0096821
510 Ga0501077_0116133
511 Ga0501079_0005802
512 Ga0501079_0015146
513 Ga0501079_0036397
514 Ga0501079_0040813
515 Ga0501079_0099146
516 Ga0501079_0108732
517 Ga0501079_0205465
518 Ga0501080_0010879
519 Ga0501080_0014433
520 Ga0501080_0048548
521 Ga0501080_0315968
522 Ga0501080_0342984
523 Ga0501081_0009679
524 Ga0501081_0030827
525 Ga0501081_0032910
526 Ga0501081_0070261
527 Ga0501081_0083878
528 Ga0501081_0123809
529 Ga0501081_0160867
530 Ga0501081_0430479
531 Ga0501083_0084881
532 Ga0501083_0397885
533 Ga0501035_0031546
534 Ga0501035_0058005
535 Ga0501035_0247952
536 Ga0501035_0409368
537 Ga0501044_0055227
538 Ga0501045_0015390
539 Ga0501045_0016894
540 Ga0501045_0026904
541 Ga0501045_0027603
542 Ga0501045_0065584
543 nmdc:mga05p37_254306_c1
544 nmdc:mga05p37_41374_c2
545 nmdc:mga05p37_647977_c1
546 nmdc:mga08y16_79660_c1
547 nmdc:mga0n895_148655_c1
548 nmdc:mga0n895_252835_c1
549 nmdc:mga0n895_395484_c1
550 nmdc:mga0n895_91260_c1
551 nmdc:mga0a205_2161_c1
552 Ga0495601_0079207
553 Ga0495619_0374228
554 Ga0501084_0002469
555 Ga0501084_0005997
556 Ga0501084_0016146
557 Ga0501084_0039919
558 Ga0501084_0255343
559 Ga0501084_0381331
560 Ga0590071_003483
561 Ga0590074_014401
562 Ga0590077_004768
563 Ga0501082_0010921
564 Ga0501082_0014119
565 Ga0501082_0045339
566 Ga0501082_0170450
567 Ga0501082_0802851
568 Ga0530510_0000416
569 Ga0530510_0000743
570 Ga0530510_0026030
571 Ga0530510_0072456
572 Ga0530510_0076012
573 Ga0530510_0094257
574 Ga0530510_0379693
575 Ga0530510_0534847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

1

111

0.98

PF00196

GerE

Bacterial regulatory proteins, luxR family

146

202

0.96

PF08281

Sigma70_r4_2

Sigma-70, region 4

142

190

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9498 9 126
3eul-assembly2.cif.gz_B structure of the signal receiver domain of the putative response regulator narl from mycobacterium tuberculosis 0.9399 8 130
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9389 11 130
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9385 11 130
6c40-assembly1.cif.gz_D-2 chey41pytyrd54k from thermotoga maritima 0.9345 11 126
ID Description Score Start End Superfamily
6ekhY00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9498 9 126 3.40.50.2300
3eulC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9446 10 127 3.40.50.2300
4tmyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9378 10 126 3.40.50.2300
af_P71814_19_100_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9369 10 90 3.40.50.2300
3q15D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9336 11 126 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3N5HNT6-F1-model_v4 DNA-binding response regulator 0.9453 1 143 GO:0000160
GO:0003677
AF-A0A0Q7ZCT2-F1-model_v4 Response regulatory domain-containing protein 0.9396 3 202 GO:0000160
GO:0003677
GO:0006355
AF-A0A4P8GUS9-F1-model_v4 Response regulator transcription factor 0.9364 1 202 GO:0000160
GO:0003677
GO:0006355
AF-A0A533YHJ6-F1-model_v4 Response regulator transcription factor 0.9348 3 142 GO:0000160
GO:0003677
AF-A0A4Q5N3Z8-F1-model_v4 Response regulator transcription factor 0.9277 9 203 GO:0000160
GO:0003677
GO:0006355

Map