F388117

General Info

Members Datasets Scaffolds Average Seq Length
287 133 574 148

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_1070603|Ga0395900_1070603_21_515
Length 164
Sequence MGRSRRSANEAAPTAVEETPTVGRDDLGFLLAKAMQRWNELLAERFAAAGYRDVRPSYGSVLLPLFEEDGLRMGELAERAHLSKQTMTEMVRRLERDRLVERRADPNDGRASLIFLTARSRSFEPIAERVLGDLDRLVRRRLPNERVDDLKAGLRELLRLGADG

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
60 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
65 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
66 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
67 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
68 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
69 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
70 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
71 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
72 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
73 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
77 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
78 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
79 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
80 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
81 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
85 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
86 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
117 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
118 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
130 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
131 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 1.74
Rhizosphere 96.52
Stem 0
Stem Tuber 0
Unclassified 9.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_1070603 3300037418 Bacteria 724
2 JGI25407J50210_10039432 3300003373 Bacteria 1211
3 JGI25407J50210_10059995 3300003373 Bacteria 957
4 JGI25407J50210_10077511 3300003373 Bacteria 827
5 Ga0070692_10272756 3300005345 Archaea 1022
6 Ga0070692_10602845 3300005345 Bacteria 727
7 Ga0070709_10017363 3300005434 Bacteria 4126
8 Ga0070709_10051516 3300005434 Bacteria 2583
9 Ga0070714_100044041 3300005435 Bacteria 3777
10 Ga0070714_100059362 3300005435 Bacteria 3279
11 Ga0070713_100027922 3300005436 Bacteria 4450
12 Ga0070713_100560539 3300005436 Unclassified 1082
13 Ga0070710_10011366 3300005437 Bacteria 4398
14 Ga0070710_10092766 3300005437 Bacteria 1784
15 Ga0070711_100037463 3300005439 Bacteria 3254
16 Ga0070711_100547690 3300005439 Unclassified 959
17 Ga0070694_100803186 3300005444 Bacteria 771
18 Ga0070708_100873824 3300005445 Bacteria 844
19 Ga0070681_10483728 3300005458 Bacteria 1151
20 Ga0070706_101668350 3300005467 Unclassified 581
21 Ga0070707_100602957 3300005468 Bacteria 1061
22 Ga0070698_100021975 3300005471 Bacteria 6679
23 Ga0070698_100126776 3300005471 Bacteria 2510
24 Ga0070698_100911083 3300005471 Bacteria 825
25 Ga0070699_100073236 3300005518 Bacteria 2980
26 Ga0070699_100103946 3300005518 Bacteria 2491
27 Ga0070697_101434886 3300005536 Unclassified 616
28 Ga0070696_101209608 3300005546 Bacteria 639
29 Ga0081455_10026468 3300005937 Bacteria 5333
30 Ga0081455_10098071 3300005937 Unclassified 2360
31 Ga0081455_10128328 3300005937 Bacteria 1987
32 Ga0081455_10403572 3300005937 Bacteria 948
33 Ga0081455_10726695 3300005937 Bacteria 630
34 Ga0081538_10000026 3300005981 Bacteria 126575
35 Ga0081538_10000676 3300005981 Bacteria 37492
36 Ga0081538_10001126 3300005981 Bacteria 28304
37 Ga0081538_10001467 3300005981 Bacteria 24195
38 Ga0081538_10010630 3300005981 Bacteria 7534
39 Ga0081538_10013823 3300005981 Bacteria 6368
40 Ga0081538_10019400 3300005981 Bacteria 5055
41 Ga0081538_10030739 3300005981 Bacteria 3639
42 Ga0081538_10045695 3300005981 Bacteria 2711
43 Ga0081538_10048982 3300005981 Unclassified 2568
44 Ga0081538_10092076 3300005981 Bacteria 1563
45 Ga0081538_10131321 3300005981 Bacteria 1176
46 Ga0081538_10295091 3300005981 Unclassified 598
47 Ga0070717_10385871 3300006028 Bacteria 1256
48 Ga0070717_10689536 3300006028 Unclassified 928
49 Ga0075365_10049478 3300006038 Bacteria 2770
50 Ga0070716_100000587 3300006173 Bacteria 15288
51 Ga0070712_100070655 3300006175 Bacteria 2495
52 Ga0070712_100151191 3300006175 Bacteria 1783
53 Ga0075366_10123802 3300006195 Bacteria 1559
54 Ga0075428_100036333 3300006844 Bacteria 5426
55 Ga0075428_100203230 3300006844 Bacteria 2141
56 Ga0075428_101203833 3300006844 Bacteria 798
57 Ga0075430_100019495 3300006846 Bacteria 5768
58 Ga0075430_100264519 3300006846 Bacteria 1424
59 Ga0075431_100130352 3300006847 Bacteria 2594
60 Ga0075431_100157796 3300006847 Bacteria 2334
61 Ga0075431_100531760 3300006847 Bacteria 1164
62 Ga0075433_10060114 3300006852 Bacteria 3327
63 Ga0075434_100366356 3300006871 Bacteria 1462
64 Ga0075434_100394810 3300006871 Bacteria 1404
65 Ga0075429_100013900 3300006880 Bacteria 6982
66 Ga0075429_100073229 3300006880 Bacteria 2984
67 Ga0075429_100601280 3300006880 Bacteria 964
68 Ga0075436_100000809 3300006914 Bacteria 20792
69 Ga0075435_100002901 3300007076 Bacteria 11513
70 Ga0111539_10029065 3300009094 Bacteria 6740
71 Ga0111539_10109070 3300009094 Bacteria 3249
72 Ga0111539_10162444 3300009094 Bacteria 2612
73 Ga0111539_10303308 3300009094 Unclassified 1859
74 Ga0111539_10555284 3300009094 Bacteria 1337
75 Ga0111539_10914674 3300009094 Bacteria 1020
76 Ga0114129_10011648 3300009147 Bacteria 12518
77 Ga0114129_10252161 3300009147 Bacteria 2368
78 Ga0114129_10299711 3300009147 Bacteria 2143
79 Ga0114129_10741629 3300009147 Bacteria 1258
80 Ga0114129_11657593 3300009147 Bacteria 781
81 Ga0114129_11867142 3300009147 Unclassified 729
82 Ga0105241_11467336 3300009174 Bacteria 655
83 Ga0157369_11427979 3300013105 Bacteria 704
84 Ga0157376_10337425 3300014969 Bacteria 1438
85 Ga0207692_10242815 3300025898 Unclassified 1076
86 Ga0207699_10123572 3300025906 Bacteria 1677
87 Ga0207707_10215968 3300025912 Bacteria 1669
88 Ga0207693_10001039 3300025915 Bacteria 24856
89 Ga0207663_10390479 3300025916 Bacteria 1062
90 Ga0207646_10385857 3300025922 Bacteria 1265
91 Ga0207687_10156577 3300025927 Unclassified 1744
92 Ga0207700_10388426 3300025928 Bacteria 1221
93 Ga0207704_10277916 3300025938 Unclassified 1271
94 Ga0207665_10025223 3300025939 Bacteria 3921
95 Ga0207428_10002578 3300027907 Bacteria 18097
96 Ga0207428_10087269 3300027907 Bacteria 2427
97 Ga0207428_10162228 3300027907 Bacteria 1697
98 Ga0207428_10195208 3300027907 Bacteria 1525
99 Ga0307408_100581195 3300031548 Bacteria 993
100 Ga0307405_10055923 3300031731 Bacteria 2472
101 Ga0307405_10254201 3300031731 Bacteria 1309
102 Ga0307413_10309490 3300031824 Unclassified 1202
103 Ga0307410_10107045 3300031852 Bacteria 2016
104 Ga0307407_10219004 3300031903 Bacteria 1286
105 Ga0307412_10121103 3300031911 Bacteria 1884
106 Ga0307409_100994676 3300031995 Bacteria 856
107 Ga0307409_101179338 3300031995 Unclassified 789
108 Ga0307416_100013586 3300032002 Bacteria 5543
109 Ga0307416_100130264 3300032002 Unclassified 2263
110 Ga0307416_100213727 3300032002 Bacteria 1842
111 Ga0307416_100325755 3300032002 Bacteria 1541
112 Ga0307416_100401894 3300032002 Bacteria 1408
113 Ga0307414_10282896 3300032004 Bacteria 1395
114 Ga0307415_100000305 3300032126 Bacteria 21243
115 Ga0307415_100534606 3300032126 Bacteria 1031
116 Ga0373944_0388609 3300035089 Unclassified 536
117 Ga0395899_0009793 3300037312 Bacteria 7353
118 Ga0395899_0013324 3300037312 Bacteria 6290
119 Ga0395900_0011014 3300037418 Bacteria 9243
120 Ga0395898_0112324 3300037466 Bacteria 2611
121 Ga0395898_0149340 3300037466 Bacteria 2236
122 Ga0395898_0741178 3300037466 Bacteria 924
123 Ga0395905_0029971 3300037471 Bacteria 5128
124 Ga0395905_1154582 3300037471 Bacteria 678
125 Ga0395901_0176957 3300038443 Unclassified 2237
126 Ga0439439_0193720 3300041406 Bacteria 589
127 Ga0439453_0105512 3300041408 Bacteria 632
128 Ga0439437_022493 3300042000 Bacteria 768
129 Ga0439441_012713 3300042001 Unclassified 1450
130 Ga0439454_048948 3300042011 Bacteria 710
131 Ga0439463_029484 3300042016 Bacteria 1382
132 Ga0439434_0087277 3300042435 Bacteria 995
133 Ga0439440_0162255 3300042993 Unclassified 646
134 Ga0453683_0757903 3300044673 Bacteria 638
135 Ga0466968_0186588 3300044735 Bacteria 966
136 Ga0466960_0919018 3300044901 Bacteria 534
137 Ga0495629_0004817 3300046459 Bacteria 10124
138 Ga0495582_0003641 3300046473 Bacteria 8676
139 Ga0495652_0393511 3300046529 Unclassified 983
140 Ga0495658_0019056 3300046683 Bacteria 3577
141 Ga0495613_0004187 3300046689 Bacteria 10794
142 Ga0495581_0051114 3300047315 Bacteria 2387
143 Ga0495684_0007446 3300047471 Bacteria 8479
144 Ga0496100_0142573 3300048903 Bacteria 1700
145 Ga0496104_0087208 3300048907 Bacteria 2980
146 Ga0496107_0244563 3300048910 Bacteria 1335
147 Ga0496113_0815378 3300048916 Bacteria 741
148 Ga0496115_0128560 3300048918 Bacteria 2087
149 Ga0501031_0091161 3300049568 Unclassified 1988
150 Ga0501031_0104730 3300049568 Bacteria 1846
151 Ga0501031_0575579 3300049568 Bacteria 725
152 Ga0501032_0300307 3300049569 Bacteria 1038
153 Ga0501033_0130558 3300049570 Bacteria 1820
154 Ga0501034_0572753 3300049571 Bacteria 1037
155 Ga0501036_0013303 3300049572 Bacteria 6833
156 Ga0501036_0020322 3300049572 Bacteria 5577
157 Ga0501036_0178811 3300049572 Bacteria 1786
158 Ga0501036_0505452 3300049572 Bacteria 1005
159 Ga0501036_0619124 3300049572 Bacteria 897
160 Ga0501038_0029900 3300049574 Bacteria 4825
161 Ga0501038_0205349 3300049574 Bacteria 1579
162 Ga0501038_0710749 3300049574 Bacteria 752
163 Ga0501038_0964052 3300049574 Bacteria 627
164 Ga0501039_0002840 3300049575 Bacteria 12947
165 Ga0501039_0046069 3300049575 Bacteria 3369
166 Ga0501039_0068664 3300049575 Bacteria 2751
167 Ga0501040_0004407 3300049576 Bacteria 9146
168 Ga0501040_0031064 3300049576 Bacteria 3609
169 Ga0501040_0034271 3300049576 Bacteria 3440
170 Ga0501040_0125488 3300049576 Bacteria 1803
171 Ga0501040_0158746 3300049576 Bacteria 1598
172 Ga0501040_0720028 3300049576 Bacteria 722
173 Ga0501041_0007082 3300049577 Bacteria 6574
174 Ga0501041_0017022 3300049577 Bacteria 4325
175 Ga0501041_0343077 3300049577 Bacteria 943
176 Ga0501041_0443188 3300049577 Bacteria 824
177 Ga0501042_0019798 3300049578 Bacteria 4678
178 Ga0501042_0029101 3300049578 Bacteria 3896
179 Ga0501042_0119276 3300049578 Bacteria 1899
180 Ga0501042_0183733 3300049578 Bacteria 1508
181 Ga0501043_0245117 3300049579 Bacteria 1381
182 Ga0501046_0686781 3300049580 Unclassified 722
183 Ga0501048_0009390 3300049582 Bacteria 7343
184 Ga0501048_0010090 3300049582 Bacteria 7066
185 Ga0501048_0231858 3300049582 Bacteria 1310
186 Ga0501048_0361620 3300049582 Bacteria 1035
187 Ga0501048_0528161 3300049582 Bacteria 846
188 Ga0501048_1379062 3300049582 Unclassified 507
189 Ga0501068_0116896 3300049584 Bacteria 1661
190 Ga0501068_0161707 3300049584 Bacteria 1411
191 Ga0501068_0731396 3300049584 Bacteria 647
192 Ga0501069_0150777 3300049585 Bacteria 1336
193 Ga0501070_0200715 3300049586 Bacteria 1638
194 Ga0501070_0367278 3300049586 Bacteria 1167
195 Ga0501071_0004686 3300049587 Bacteria 8691
196 Ga0501071_0015064 3300049587 Bacteria 5302
197 Ga0501071_0023567 3300049587 Bacteria 4299
198 Ga0501071_0083203 3300049587 Bacteria 2344
199 Ga0501071_0603615 3300049587 Bacteria 844
200 Ga0501071_0686025 3300049587 Bacteria 789
201 Ga0501072_0001773 3300049588 Bacteria 16052
202 Ga0501072_0048995 3300049588 Bacteria 3325
203 Ga0501072_0059170 3300049588 Bacteria 3021
204 Ga0501072_0209041 3300049588 Unclassified 1555
205 Ga0501072_0218526 3300049588 Bacteria 1519
206 Ga0501072_0227032 3300049588 Bacteria 1487
207 Ga0501072_0779739 3300049588 Bacteria 749
208 Ga0501073_0347228 3300049589 Bacteria 1024
209 Ga0501074_0028104 3300049590 Bacteria 4076
210 Ga0501074_0251272 3300049590 Bacteria 1257
211 Ga0501075_0003754 3300049591 Bacteria 10203
212 Ga0501075_0024304 3300049591 Bacteria 4441
213 Ga0501075_0067090 3300049591 Bacteria 2709
214 Ga0501075_0075477 3300049591 Bacteria 2549
215 Ga0501075_0090157 3300049591 Bacteria 2326
216 Ga0501075_0911073 3300049591 Bacteria 668
217 Ga0501076_0004204 3300049592 Bacteria 10194
218 Ga0501076_0011209 3300049592 Bacteria 6672
219 Ga0501076_0011933 3300049592 Bacteria 6489
220 Ga0501076_0273501 3300049592 Bacteria 1383
221 Ga0501076_1373715 3300049592 Bacteria 580
222 Ga0501077_0006236 3300049593 Bacteria 7290
223 Ga0501077_0120685 3300049593 Bacteria 1661
224 Ga0501077_0270107 3300049593 Bacteria 1082
225 Ga0501079_0006826 3300049741 Bacteria 8593
226 Ga0501079_0011050 3300049741 Bacteria 6884
227 Ga0501079_0015900 3300049741 Bacteria 5752
228 Ga0501079_0194869 3300049741 Bacteria 1582
229 Ga0501079_0621218 3300049741 Bacteria 850
230 Ga0501080_0007636 3300049742 Bacteria 9779
231 Ga0501080_0350393 3300049742 Bacteria 1333
232 Ga0501080_0843559 3300049742 Bacteria 801
233 Ga0501081_0002928 3300049743 Bacteria 10829
234 Ga0501081_0024793 3300049743 Bacteria 4029
235 Ga0501081_0201986 3300049743 Bacteria 1441
236 Ga0501081_0484048 3300049743 Bacteria 921
237 Ga0501083_0033076 3300049744 Bacteria 3542
238 Ga0501083_0686386 3300049744 Bacteria 666
239 Ga0501035_0593381 3300049822 Bacteria 903
240 Ga0501044_0605209 3300049823 Bacteria 989
241 Ga0501045_0007859 3300049824 Bacteria 7424
242 Ga0501045_0024659 3300049824 Bacteria 4319
243 Ga0501045_0025753 3300049824 Bacteria 4229
244 Ga0501045_0086649 3300049824 Bacteria 2312
245 Ga0501045_0149046 3300049824 Bacteria 1740
246 nmdc:mga03683_67347_c1 3300050489 Bacteria 1524
247 nmdc:mga06z11_587527_c1 3300050494 Bacteria 677
248 nmdc:mga05p37_159061_c1 3300050507 Bacteria 2759
249 nmdc:mga05p37_214616_c1 3300050507 Bacteria 2324
250 nmdc:mga05p37_251251_c1 3300050507 Bacteria 2121
251 nmdc:mga05p37_302767_c1 3300050507 Bacteria 1899
252 nmdc:mga05p37_77960_c1 3300050507 Bacteria 4080
253 nmdc:mga05p37_988550_c1 3300050507 Bacteria 895
254 nmdc:mga09592_78999_c1 3300050508 Bacteria 2801
255 nmdc:mga0qj67_14476_c1 3300050509 Bacteria 5964
256 nmdc:mga0qj67_443469_c1 3300050509 Bacteria 1046
257 nmdc:mga06r32_1377068_c1 3300050510 Unclassified 648
258 nmdc:mga06r32_140340_c1 3300050510 Bacteria 2392
259 nmdc:mga06r32_23650_c1 3300050510 Bacteria 5689
260 nmdc:mga08y16_464177_c1 3300050511 Bacteria 1290
261 nmdc:mga08y16_484879_c1 3300050511 Bacteria 1258
262 nmdc:mga08y16_544569_c1 3300050511 Bacteria 1175
263 nmdc:mga08y16_83145_c1 3300050511 Bacteria 3337
264 nmdc:mga08y16_87179_c1 3300050511 Bacteria 3252
265 nmdc:mga0n895_122563_c1 3300050512 Bacteria 2621
266 nmdc:mga0rr50_668613_c1 3300050513 Bacteria 886
267 nmdc:mga0a205_422325_c1 3300050515 Bacteria 1195
268 nmdc:mga0a205_8359_c1 3300050515 Bacteria 7953
269 Ga0500566_0142671 3300053094 Bacteria 1269
270 Ga0501084_0015250 3300054114 Bacteria 6372
271 Ga0501084_0051123 3300054114 Bacteria 3458
272 Ga0501084_0076125 3300054114 Bacteria 2812
273 Ga0590071_025560 3300059421 Bacteria 1400
274 Ga0590075_021808 3300059424 Bacteria 1601
275 Ga0590077_117952 3300059426 Unclassified 627
276 Ga0501082_0025382 3300060353 Bacteria 5107
277 Ga0501082_0034173 3300060353 Bacteria 4386
278 Ga0501082_0054035 3300060353 Bacteria 3462
279 Ga0501082_0105981 3300060353 Bacteria 2432
280 Ga0501082_0157263 3300060353 Bacteria 1975
281 Ga0501082_0193514 3300060353 Bacteria 1769
282 Ga0530510_0005932 3300061734 Bacteria 8470
283 Ga0530510_0030345 3300061734 Bacteria 3883
284 Ga0530510_0151159 3300061734 Bacteria 1714
285 Ga0530510_0191562 3300061734 Bacteria 1518
286 Ga0530510_0548338 3300061734 Bacteria 878
287 Ga0530510_0961449 3300061734 Unclassified 653
288 Ga0395900_1070603
289 JGI25407J50210_10039432
290 JGI25407J50210_10059995
291 JGI25407J50210_10077511
292 Ga0070692_10272756
293 Ga0070692_10602845
294 Ga0070709_10017363
295 Ga0070709_10051516
296 Ga0070714_100044041
297 Ga0070714_100059362
298 Ga0070713_100027922
299 Ga0070713_100560539
300 Ga0070710_10011366
301 Ga0070710_10092766
302 Ga0070711_100037463
303 Ga0070711_100547690
304 Ga0070694_100803186
305 Ga0070708_100873824
306 Ga0070681_10483728
307 Ga0070706_101668350
308 Ga0070707_100602957
309 Ga0070698_100021975
310 Ga0070698_100126776
311 Ga0070698_100911083
312 Ga0070699_100073236
313 Ga0070699_100103946
314 Ga0070697_101434886
315 Ga0070696_101209608
316 Ga0081455_10026468
317 Ga0081455_10098071
318 Ga0081455_10128328
319 Ga0081455_10403572
320 Ga0081455_10726695
321 Ga0081538_10000026
322 Ga0081538_10000676
323 Ga0081538_10001126
324 Ga0081538_10001467
325 Ga0081538_10010630
326 Ga0081538_10013823
327 Ga0081538_10019400
328 Ga0081538_10030739
329 Ga0081538_10045695
330 Ga0081538_10048982
331 Ga0081538_10092076
332 Ga0081538_10131321
333 Ga0081538_10295091
334 Ga0070717_10385871
335 Ga0070717_10689536
336 Ga0075365_10049478
337 Ga0070716_100000587
338 Ga0070712_100070655
339 Ga0070712_100151191
340 Ga0075366_10123802
341 Ga0075428_100036333
342 Ga0075428_100203230
343 Ga0075428_101203833
344 Ga0075430_100019495
345 Ga0075430_100264519
346 Ga0075431_100130352
347 Ga0075431_100157796
348 Ga0075431_100531760
349 Ga0075433_10060114
350 Ga0075434_100366356
351 Ga0075434_100394810
352 Ga0075429_100013900
353 Ga0075429_100073229
354 Ga0075429_100601280
355 Ga0075436_100000809
356 Ga0075435_100002901
357 Ga0111539_10029065
358 Ga0111539_10109070
359 Ga0111539_10162444
360 Ga0111539_10303308
361 Ga0111539_10555284
362 Ga0111539_10914674
363 Ga0114129_10011648
364 Ga0114129_10252161
365 Ga0114129_10299711
366 Ga0114129_10741629
367 Ga0114129_11657593
368 Ga0114129_11867142
369 Ga0105241_11467336
370 Ga0157369_11427979
371 Ga0157376_10337425
372 Ga0207692_10242815
373 Ga0207699_10123572
374 Ga0207707_10215968
375 Ga0207693_10001039
376 Ga0207663_10390479
377 Ga0207646_10385857
378 Ga0207687_10156577
379 Ga0207700_10388426
380 Ga0207704_10277916
381 Ga0207665_10025223
382 Ga0207428_10002578
383 Ga0207428_10087269
384 Ga0207428_10162228
385 Ga0207428_10195208
386 Ga0307408_100581195
387 Ga0307405_10055923
388 Ga0307405_10254201
389 Ga0307413_10309490
390 Ga0307410_10107045
391 Ga0307407_10219004
392 Ga0307412_10121103
393 Ga0307409_100994676
394 Ga0307409_101179338
395 Ga0307416_100013586
396 Ga0307416_100130264
397 Ga0307416_100213727
398 Ga0307416_100325755
399 Ga0307416_100401894
400 Ga0307414_10282896
401 Ga0307415_100000305
402 Ga0307415_100534606
403 Ga0373944_0388609
404 Ga0395899_0009793
405 Ga0395899_0013324
406 Ga0395900_0011014
407 Ga0395898_0112324
408 Ga0395898_0149340
409 Ga0395898_0741178
410 Ga0395905_0029971
411 Ga0395905_1154582
412 Ga0395901_0176957
413 Ga0439439_0193720
414 Ga0439453_0105512
415 Ga0439437_022493
416 Ga0439441_012713
417 Ga0439454_048948
418 Ga0439463_029484
419 Ga0439434_0087277
420 Ga0439440_0162255
421 Ga0453683_0757903
422 Ga0466968_0186588
423 Ga0466960_0919018
424 Ga0495629_0004817
425 Ga0495582_0003641
426 Ga0495652_0393511
427 Ga0495658_0019056
428 Ga0495613_0004187
429 Ga0495581_0051114
430 Ga0495684_0007446
431 Ga0496100_0142573
432 Ga0496104_0087208
433 Ga0496107_0244563
434 Ga0496113_0815378
435 Ga0496115_0128560
436 Ga0501031_0091161
437 Ga0501031_0104730
438 Ga0501031_0575579
439 Ga0501032_0300307
440 Ga0501033_0130558
441 Ga0501034_0572753
442 Ga0501036_0013303
443 Ga0501036_0020322
444 Ga0501036_0178811
445 Ga0501036_0505452
446 Ga0501036_0619124
447 Ga0501038_0029900
448 Ga0501038_0205349
449 Ga0501038_0710749
450 Ga0501038_0964052
451 Ga0501039_0002840
452 Ga0501039_0046069
453 Ga0501039_0068664
454 Ga0501040_0004407
455 Ga0501040_0031064
456 Ga0501040_0034271
457 Ga0501040_0125488
458 Ga0501040_0158746
459 Ga0501040_0720028
460 Ga0501041_0007082
461 Ga0501041_0017022
462 Ga0501041_0343077
463 Ga0501041_0443188
464 Ga0501042_0019798
465 Ga0501042_0029101
466 Ga0501042_0119276
467 Ga0501042_0183733
468 Ga0501043_0245117
469 Ga0501046_0686781
470 Ga0501048_0009390
471 Ga0501048_0010090
472 Ga0501048_0231858
473 Ga0501048_0361620
474 Ga0501048_0528161
475 Ga0501048_1379062
476 Ga0501068_0116896
477 Ga0501068_0161707
478 Ga0501068_0731396
479 Ga0501069_0150777
480 Ga0501070_0200715
481 Ga0501070_0367278
482 Ga0501071_0004686
483 Ga0501071_0015064
484 Ga0501071_0023567
485 Ga0501071_0083203
486 Ga0501071_0603615
487 Ga0501071_0686025
488 Ga0501072_0001773
489 Ga0501072_0048995
490 Ga0501072_0059170
491 Ga0501072_0209041
492 Ga0501072_0218526
493 Ga0501072_0227032
494 Ga0501072_0779739
495 Ga0501073_0347228
496 Ga0501074_0028104
497 Ga0501074_0251272
498 Ga0501075_0003754
499 Ga0501075_0024304
500 Ga0501075_0067090
501 Ga0501075_0075477
502 Ga0501075_0090157
503 Ga0501075_0911073
504 Ga0501076_0004204
505 Ga0501076_0011209
506 Ga0501076_0011933
507 Ga0501076_0273501
508 Ga0501076_1373715
509 Ga0501077_0006236
510 Ga0501077_0120685
511 Ga0501077_0270107
512 Ga0501079_0006826
513 Ga0501079_0011050
514 Ga0501079_0015900
515 Ga0501079_0194869
516 Ga0501079_0621218
517 Ga0501080_0007636
518 Ga0501080_0350393
519 Ga0501080_0843559
520 Ga0501081_0002928
521 Ga0501081_0024793
522 Ga0501081_0201986
523 Ga0501081_0484048
524 Ga0501083_0033076
525 Ga0501083_0686386
526 Ga0501035_0593381
527 Ga0501044_0605209
528 Ga0501045_0007859
529 Ga0501045_0024659
530 Ga0501045_0025753
531 Ga0501045_0086649
532 Ga0501045_0149046
533 nmdc:mga03683_67347_c1
534 nmdc:mga06z11_587527_c1
535 nmdc:mga05p37_159061_c1
536 nmdc:mga05p37_214616_c1
537 nmdc:mga05p37_251251_c1
538 nmdc:mga05p37_302767_c1
539 nmdc:mga05p37_77960_c1
540 nmdc:mga05p37_988550_c1
541 nmdc:mga09592_78999_c1
542 nmdc:mga0qj67_14476_c1
543 nmdc:mga0qj67_443469_c1
544 nmdc:mga06r32_1377068_c1
545 nmdc:mga06r32_140340_c1
546 nmdc:mga06r32_23650_c1
547 nmdc:mga08y16_464177_c1
548 nmdc:mga08y16_484879_c1
549 nmdc:mga08y16_544569_c1
550 nmdc:mga08y16_83145_c1
551 nmdc:mga08y16_87179_c1
552 nmdc:mga0n895_122563_c1
553 nmdc:mga0rr50_668613_c1
554 nmdc:mga0a205_422325_c1
555 nmdc:mga0a205_8359_c1
556 Ga0500566_0142671
557 Ga0501084_0015250
558 Ga0501084_0051123
559 Ga0501084_0076125
560 Ga0590071_025560
561 Ga0590075_021808
562 Ga0590077_117952
563 Ga0501082_0025382
564 Ga0501082_0034173
565 Ga0501082_0054035
566 Ga0501082_0105981
567 Ga0501082_0157263
568 Ga0501082_0193514
569 Ga0530510_0005932
570 Ga0530510_0030345
571 Ga0530510_0151159
572 Ga0530510_0191562
573 Ga0530510_0548338
574 Ga0530510_0961449

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

56

112

0.96

PF12802

MarR_2

MarR family

53

111

0.91

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

64

101

0.91

PF01638

HxlR

HxlR-like helix-turn-helix

58

141

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wi9-assembly1.cif.gz_A solution structure of the pci domain from mouse hypothetical protein aah51541 0.8439 63 96
2efo-assembly1.cif.gz_A crystal structure of tyr77 to ala of st1022 from sulfolobus tokodaii 7 0.7904 62 97
2qz8-assembly1.cif.gz_B-2 crystal structure of mycobacterium tuberculosis leucine response regulatory protein (lrpa) 0.7775 61 96
3i71-assembly1.cif.gz_B ethanolamine utilization microcompartment shell subunit, eutk c-terminal domain 0.7322 58 95
6y45-assembly2.cif.gz_D crystal structure of the h33a variant of rsrr 0.6329 61 99
ID Description Score Start End Superfamily
4l5jA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.938 59 90 1.10.10.10
4pcqC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.889 61 95 1.10.10.10
af_Q2FUY1_146_230_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8841 61 93 1.10.10.10
af_A0A144A2K5_2429_2486_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8518 61 96 1.10.10.10
4l5iD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8463 59 93 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A561UQK2-F1-model_v4 AsnC family transcriptional regulator 0.7736 57 96 GO:0005829
GO:0043200
GO:0043565
AF-A0A7W0PI60-F1-model_v4 Helix-turn-helix transcriptional regulator 0.7657 57 95 GO:0003677
GO:0003700
AF-A0A821NWL3-F1-model_v4 Uncharacterized protein 0.6254 52 96
AF-A0A538C4E2-F1-model_v4 MarR family transcriptional regulator 0.6036 10 140 GO:0003677
GO:0003700
GO:0006950
AF-A0A2V7Q2F5-F1-model_v4 HTH marR-type domain-containing protein 0.5928 10 140 GO:0003677
GO:0003700
GO:0006950

Map