F388034

General Info

Members Datasets Scaffolds Average Seq Length
287 158 574 352

Family's Representative Sequence

Representative Sequence 3300025908|Ga0207643_10035005|Ga0207643_100350051
Length 392
Sequence MQVVYSPRHLAHDIDTETFMGIAIPANEVAERAERIRTALEADGGFTFMDPTAHGEAPITAIHDERLVRFLEVAWSEVRAQAIPRAFLSADTYPNIAMFEGMSPDAIERLVREPSHVGGRAGFWGLDSAAPLVAGTYDAACAAVDVALTTMDLVLDGAPAAYGLCRPPGHHAARSMYGGYCFFNNAAIVAHAIATSTGERVSILDVDYHHGNGTQQIFWRRGDVRYVSIHADPARAYPYFLGHAEETGEGDGAGENVNIPLRAGATDADFLEATDRAIEAIGGAPGSIVVVSLGFDTYGLDPIGDFALTTSVYHEVGRRVAALRLGLVGRDELERAEELRALLRRGRPGLSPLGLPQHRRHCRGSAAHRRSQPLRDAWIPPSRPACLSSPLD

Samples

Sample ID Description Type Environment
1 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
74 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
82 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
150 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
151 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
156 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
157 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
158 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 6.62
Rhizosphere 92.68
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207643_10035005 3300025908 Bacteria 2815
2 Ga0070683_100159864 3300005329 Bacteria 2137
3 Ga0070660_100134219 3300005339 Bacteria 1982
4 Ga0070689_100062683 3300005340 Bacteria 2893
5 Ga0070675_100297956 3300005354 Bacteria 1420
6 Ga0070674_100008831 3300005356 Bacteria 6016
7 Ga0070688_100002486 3300005365 Bacteria 9324
8 Ga0070659_100016571 3300005366 Bacteria 5533
9 Ga0070700_100005890 3300005441 Bacteria 6515
10 Ga0070708_100014098 3300005445 Bacteria 6570
11 Ga0070708_100033654 3300005445 Bacteria 4454
12 Ga0070708_100033742 3300005445 Bacteria 4447
13 Ga0070708_100053940 3300005445 Bacteria 3569
14 Ga0070708_100060539 3300005445 Bacteria 3380
15 Ga0070708_100109286 3300005445 Bacteria 2540
16 Ga0070678_100274280 3300005456 Bacteria 1423
17 Ga0070678_100285567 3300005456 Bacteria 1397
18 Ga0070681_10179698 3300005458 Bacteria 2037
19 Ga0070706_100133382 3300005467 Bacteria 2318
20 Ga0070706_100135456 3300005467 Unclassified 2299
21 Ga0070707_100000163 3300005468 Bacteria 63764
22 Ga0070707_100038400 3300005468 Bacteria 4573
23 Ga0070707_100127875 3300005468 Bacteria 2469
24 Ga0070707_100260020 3300005468 Bacteria 1689
25 Ga0070707_100343471 3300005468 Bacteria 1450
26 Ga0070698_100016770 3300005471 Bacteria 7726
27 Ga0070698_100025807 3300005471 Bacteria 6124
28 Ga0070698_100046835 3300005471 Bacteria 4421
29 Ga0070698_100067001 3300005471 Bacteria 3612
30 Ga0070698_100089780 3300005471 Bacteria 3057
31 Ga0070699_100001077 3300005518 Bacteria 25401
32 Ga0070699_100001296 3300005518 Bacteria 23080
33 Ga0070699_100008469 3300005518 Bacteria 8908
34 Ga0070679_100119293 3300005530 Bacteria 2623
35 Ga0070684_100135795 3300005535 Bacteria 2222
36 Ga0070697_100019829 3300005536 Bacteria 5313
37 Ga0070697_100020155 3300005536 Bacteria 5271
38 Ga0070697_100027101 3300005536 Bacteria 4583
39 Ga0070697_100183020 3300005536 Bacteria 1776
40 Ga0070672_100039035 3300005543 Bacteria 3634
41 Ga0070695_100005199 3300005545 Bacteria 7678
42 Ga0070695_100054472 3300005545 Bacteria 2575
43 Ga0070695_100067500 3300005545 Bacteria 2333
44 Ga0070696_100017275 3300005546 Bacteria 4869
45 Ga0070696_100038006 3300005546 Bacteria 3321
46 Ga0070696_100062353 3300005546 Bacteria 2609
47 Ga0068857_100182549 3300005577 Bacteria 1909
48 Ga0068854_100164764 3300005578 Bacteria 1720
49 Ga0070702_100034667 3300005615 Bacteria 2783
50 Ga0068864_100016751 3300005618 Bacteria 6108
51 Ga0068861_100212842 3300005719 Bacteria 1629
52 Ga0068860_100176503 3300005843 Bacteria 2065
53 Ga0068860_100380372 3300005843 Bacteria 1394
54 Ga0081455_10058099 3300005937 Bacteria 3275
55 Ga0081539_10004486 3300005985 Bacteria 15363
56 Ga0081539_10004682 3300005985 Bacteria 14847
57 Ga0097621_100301652 3300006237 Bacteria 1415
58 Ga0075428_100006306 3300006844 Bacteria 13183
59 Ga0075433_10059339 3300006852 Bacteria 3347
60 Ga0075434_100015697 3300006871 Bacteria 7268
61 Ga0075435_100052947 3300007076 Bacteria 3271
62 Ga0075435_100137613 3300007076 Bacteria 2047
63 Ga0075435_100150934 3300007076 Bacteria 1953
64 Ga0111539_10135015 3300009094 Bacteria 2889
65 Ga0111539_10157175 3300009094 Bacteria 2660
66 Ga0105245_10027477 3300009098 Bacteria 5013
67 Ga0105245_10239095 3300009098 Bacteria 1759
68 Ga0114129_10017170 3300009147 Bacteria 10308
69 Ga0114129_10097211 3300009147 Bacteria 4076
70 Ga0114129_10248139 3300009147 Bacteria 2390
71 Ga0105243_10171889 3300009148 Bacteria 1878
72 Ga0105242_10057001 3300009176 Bacteria 3198
73 Ga0105248_10038404 3300009177 Bacteria 5358
74 Ga0105248_10301311 3300009177 Bacteria 1805
75 Ga0105249_10036190 3300009553 Bacteria 4478
76 Ga0105249_10099722 3300009553 Bacteria 2730
77 Ga0105249_10135021 3300009553 Bacteria 2360
78 Ga0105249_10550196 3300009553 Bacteria 1205
79 Ga0105239_10147968 3300010375 Bacteria 2620
80 Ga0157375_10375183 3300013308 Bacteria 1589
81 Ga0163163_10017138 3300014325 Bacteria 6748
82 Ga0163163_10367957 3300014325 Bacteria 1494
83 Ga0157380_10060906 3300014326 Bacteria 3018
84 Ga0157380_10540795 3300014326 Unclassified 1141
85 Ga0182008_10087312 3300014497 Bacteria 1536
86 Ga0157379_10141828 3300014968 Bacteria 2166
87 Ga0157376_10631789 3300014969 Bacteria 1069
88 Ga0207653_10021013 3300025885 Bacteria 2069
89 Ga0207642_10058051 3300025899 Bacteria 1784
90 Ga0207684_10004490 3300025910 Bacteria 13125
91 Ga0207684_10008896 3300025910 Bacteria 8917
92 Ga0207684_10089109 3300025910 Bacteria 2629
93 Ga0207684_10113687 3300025910 Bacteria 2318
94 Ga0207684_10129009 3300025910 Unclassified 2170
95 Ga0207662_10014832 3300025918 Bacteria 4377
96 Ga0207657_10145349 3300025919 Bacteria 1935
97 Ga0207646_10003272 3300025922 Bacteria 18451
98 Ga0207646_10005854 3300025922 Bacteria 12851
99 Ga0207646_10011891 3300025922 Bacteria 8397
100 Ga0207646_10027694 3300025922 Bacteria 5166
101 Ga0207646_10149853 3300025922 Bacteria 2103
102 Ga0207646_10298475 3300025922 Bacteria 1456
103 Ga0207659_10057721 3300025926 Bacteria 2785
104 Ga0207659_10178897 3300025926 Unclassified 1679
105 Ga0207687_10035408 3300025927 Bacteria 3395
106 Ga0207687_10062822 3300025927 Bacteria 2628
107 Ga0207706_10066331 3300025933 Bacteria 3176
108 Ga0207686_10097973 3300025934 Bacteria 1951
109 Ga0207691_10117201 3300025940 Bacteria 2363
110 Ga0207712_10026386 3300025961 Bacteria 3870
111 Ga0207712_10048916 3300025961 Bacteria 2943
112 Ga0207708_10011851 3300026075 Bacteria 6492
113 Ga0207648_10005758 3300026089 Bacteria 12417
114 Ga0207676_10077572 3300026095 Bacteria 2688
115 Ga0207674_10007027 3300026116 Bacteria 13163
116 Ga0207675_100031518 3300026118 Bacteria 4938
117 Ga0207683_10019227 3300026121 Bacteria 5832
118 Ga0209998_10001268 3300027717 Bacteria 6175
119 Ga0209974_10008789 3300027876 Bacteria 3442
120 Ga0209974_10020266 3300027876 Bacteria 2204
121 Ga0207428_10157301 3300027907 Unclassified 1728
122 Ga0268265_10127521 3300028380 Bacteria 2109
123 Ga0268264_10100428 3300028381 Bacteria 2513
124 Ga0268264_10194957 3300028381 Bacteria 1849
125 Ga0316576_10017439 3300031727 Bacteria 4878
126 Ga0316576_10025722 3300031727 Bacteria 4123
127 Ga0316578_10014005 3300031728 Bacteria 4269
128 Ga0316578_10042552 3300031728 Bacteria 2634
129 Ga0307405_10078001 3300031731 Bacteria 2154
130 Ga0307406_10042430 3300031901 Bacteria 2840
131 Ga0307412_10065649 3300031911 Bacteria 2457
132 Ga0307409_100247218 3300031995 Bacteria 1628
133 Ga0307416_100001078 3300032002 Bacteria 14560
134 Ga0307415_100004695 3300032126 Bacteria 7147
135 Ga0307415_100219547 3300032126 Bacteria 1523
136 Ga0316580_10022249 3300032139 Bacteria 1956
137 Ga0373961_0012744 3300035241 Bacteria 2110
138 Ga0316574_0032316 3300035398 Bacteria 3180
139 Ga0373927_0092659 3300035695 Bacteria 1963
140 Ga0373937_0199127 3300036401 Bacteria 1883
141 Ga0316584_0109954 3300036712 Bacteria 2062
142 Ga0395899_0079732 3300037312 Bacteria 2384
143 Ga0395900_0001943 3300037418 Bacteria 23410
144 Ga0395898_0002954 3300037466 Bacteria 19324
145 Ga0395905_0024193 3300037471 Bacteria 5732
146 Ga0395901_0021940 3300038443 Bacteria 6545
147 Ga0439431_0032468 3300041997 Bacteria 1302
148 Ga0451577_0006499 3300042876 Bacteria 11643
149 Ga0451577_0073911 3300042876 Bacteria 3041
150 Ga0451577_0138756 3300042876 Bacteria 2184
151 Ga0451577_0382907 3300042876 Bacteria 1277
152 Ga0453683_0014226 3300044673 Bacteria 5172
153 Ga0453684_0204212 3300044712 Bacteria 2301
154 Ga0453684_0244823 3300044712 Bacteria 2062
155 Ga0453684_0279250 3300044712 Bacteria 1906
156 Ga0453684_0394185 3300044712 Bacteria 1552
157 Ga0451576_0016356 3300045051 Bacteria 8190
158 Ga0451576_0086258 3300045051 Bacteria 3265
159 Ga0495603_0073293 3300046455 Bacteria 2012
160 Ga0495641_0050750 3300046461 Bacteria 1896
161 Ga0495651_0029801 3300046462 Bacteria 4255
162 Ga0495664_0106495 3300046477 Bacteria 1691
163 Ga0495602_0120966 3300048088 Bacteria 2107
164 Ga0496101_0141076 3300048904 Bacteria 1837
165 Ga0496102_0017689 3300048905 Bacteria 6248
166 Ga0496104_0150429 3300048907 Bacteria 2235
167 Ga0496104_0237778 3300048907 Bacteria 1733
168 Ga0496105_0039248 3300048908 Bacteria 3902
169 Ga0496106_0320994 3300048909 Bacteria 1243
170 Ga0496108_0013593 3300048911 Bacteria 6644
171 Ga0496108_0019610 3300048911 Bacteria 5555
172 Ga0496108_0047955 3300048911 Bacteria 3571
173 Ga0496109_0006101 3300048912 Bacteria 10124
174 Ga0496109_0107892 3300048912 Bacteria 2587
175 Ga0496111_0031279 3300048914 Bacteria 3791
176 Ga0496111_0218188 3300048914 Bacteria 1417
177 Ga0496112_0046518 3300048915 Bacteria 4256
178 Ga0496112_0433518 3300048915 Bacteria 1253
179 Ga0496113_0118933 3300048916 Bacteria 2064
180 Ga0496113_0126616 3300048916 Bacteria 2001
181 Ga0496114_0151488 3300048917 Bacteria 2012
182 Ga0496114_0296553 3300048917 Bacteria 1427
183 Ga0501031_0047618 3300049568 Bacteria 2795
184 Ga0501031_0053428 3300049568 Bacteria 2632
185 Ga0501033_0095133 3300049570 Bacteria 2177
186 Ga0501034_0041412 3300049571 Bacteria 4660
187 Ga0501036_0028962 3300049572 Bacteria 4680
188 Ga0501036_0095903 3300049572 Bacteria 2507
189 Ga0501037_0052726 3300049573 Bacteria 2974
190 Ga0501038_0031097 3300049574 Bacteria 4720
191 Ga0501039_0064750 3300049575 Bacteria 2834
192 Ga0501039_0165214 3300049575 Bacteria 1740
193 Ga0501039_0210475 3300049575 Bacteria 1529
194 Ga0501040_0008798 3300049576 Bacteria 6559
195 Ga0501040_0025260 3300049576 Bacteria 3994
196 Ga0501040_0130327 3300049576 Bacteria 1768
197 Ga0501040_0162344 3300049576 Bacteria 1580
198 Ga0501041_0024232 3300049577 Bacteria 3642
199 Ga0501041_0074691 3300049577 Bacteria 2083
200 Ga0501042_0010349 3300049578 Bacteria 6249
201 Ga0501042_0036977 3300049578 Bacteria 3464
202 Ga0501042_0049489 3300049578 Bacteria 2998
203 Ga0501043_0049108 3300049579 Bacteria 3317
204 Ga0501043_0135383 3300049579 Bacteria 1930
205 Ga0501046_0077808 3300049580 Bacteria 2567
206 Ga0501048_0042886 3300049582 Bacteria 3238
207 Ga0501048_0088987 3300049582 Bacteria 2178
208 Ga0501048_0248515 3300049582 Bacteria 1262
209 Ga0501067_0024294 3300049583 Bacteria 3362
210 Ga0501067_0044939 3300049583 Bacteria 2454
211 Ga0501069_0103430 3300049585 Bacteria 1618
212 Ga0501070_0062599 3300049586 Bacteria 3082
213 Ga0501070_0213443 3300049586 Bacteria 1584
214 Ga0501071_0028285 3300049587 Bacteria 3950
215 Ga0501071_0144116 3300049587 Bacteria 1775
216 Ga0501071_0155282 3300049587 Bacteria 1708
217 Ga0501071_0169666 3300049587 Bacteria 1633
218 Ga0501072_0032634 3300049588 Bacteria 4078
219 Ga0501072_0091860 3300049588 Bacteria 2410
220 Ga0501072_0220508 3300049588 Bacteria 1511
221 Ga0501072_0241210 3300049588 Bacteria 1439
222 Ga0501073_0069949 3300049589 Bacteria 2445
223 Ga0501073_0221842 3300049589 Bacteria 1306
224 Ga0501074_0045446 3300049590 Bacteria 3178
225 Ga0501074_0098415 3300049590 Bacteria 2093
226 Ga0501075_0023538 3300049591 Bacteria 4511
227 Ga0501075_0052292 3300049591 Bacteria 3072
228 Ga0501075_0079837 3300049591 Bacteria 2476
229 Ga0501075_0084071 3300049591 Bacteria 2410
230 Ga0501075_0110107 3300049591 Bacteria 2094
231 Ga0501075_0125817 3300049591 Bacteria 1951
232 Ga0501076_0079915 3300049592 Bacteria 2624
233 Ga0501076_0125640 3300049592 Bacteria 2078
234 Ga0501076_0244851 3300049592 Bacteria 1467
235 Ga0501076_0310379 3300049592 Bacteria 1293
236 Ga0501076_0428470 3300049592 Bacteria 1089
237 Ga0501077_0062462 3300049593 Bacteria 2363
238 Ga0501077_0067331 3300049593 Bacteria 2271
239 Ga0501077_0080627 3300049593 Bacteria 2062
240 Ga0501077_0141932 3300049593 Bacteria 1523
241 Ga0501077_0173598 3300049593 Bacteria 1369
242 Ga0501079_0042146 3300049741 Bacteria 3526
243 Ga0501079_0054822 3300049741 Bacteria 3075
244 Ga0501079_0059150 3300049741 Bacteria 2956
245 Ga0501080_0093776 3300049742 Bacteria 2787
246 Ga0501080_0143171 3300049742 Bacteria 2210
247 Ga0501080_0288188 3300049742 Bacteria 1491
248 Ga0501081_0005509 3300049743 Bacteria 8174
249 Ga0501081_0011444 3300049743 Bacteria 5806
250 Ga0501081_0058968 3300049743 Bacteria 2656
251 Ga0501081_0146205 3300049743 Bacteria 1696
252 Ga0501081_0219193 3300049743 Bacteria 1383
253 Ga0501035_0081578 3300049822 Bacteria 2854
254 Ga0501035_0320774 3300049822 Bacteria 1302
255 Ga0501045_0179078 3300049824 Bacteria 1579
256 nmdc:mga00v17_124933_c1 3300050491 Bacteria 1641
257 nmdc:mga05p37_104603_c1 3300050507 Bacteria 3483
258 nmdc:mga05p37_137403_c1 3300050507 Bacteria 2996
259 nmdc:mga05p37_637_c1 3300050507 Bacteria 38821
260 nmdc:mga09592_164962_c1 3300050508 Bacteria 1914
261 nmdc:mga06r32_51506_c1 3300050510 Bacteria 3940
262 nmdc:mga08y16_77761_c1 3300050511 Bacteria 3460
263 nmdc:mga0n895_71075_c1 3300050512 Bacteria 3450
264 nmdc:mga0rr50_111751_c1 3300050513 Bacteria 2163
265 nmdc:mga0rr50_73512_c1 3300050513 Bacteria 2614
266 nmdc:mga0a205_136692_c1 3300050515 Bacteria 2351
267 nmdc:mga0a205_15148_c1 3300050515 Bacteria 7203
268 Ga0495612_0000194 3300053078 Bacteria 25906
269 Ga0495595_0041088 3300053084 Bacteria 2115
270 Ga0500616_0000960 3300053153 Bacteria 31268
271 Ga0501084_0037972 3300054114 Bacteria 4025
272 Ga0501084_0131188 3300054114 Bacteria 2109
273 Ga0501084_0266837 3300054114 Bacteria 1445
274 Ga0590075_012328 3300059424 Bacteria 2075
275 Ga0501082_0041222 3300060353 Bacteria 3981
276 Ga0501082_0075181 3300060353 Bacteria 2910
277 Ga0501082_0077238 3300060353 Bacteria 2871
278 Ga0501082_0092272 3300060353 Bacteria 2616
279 Ga0501082_0140776 3300060353 Bacteria 2094
280 Ga0501082_0291052 3300060353 Bacteria 1422
281 Ga0530510_0018435 3300061734 Bacteria 4949
282 Ga0530510_0027355 3300061734 Bacteria 4085
283 Ga0530510_0027895 3300061734 Bacteria 4047
284 Ga0530510_0114908 3300061734 Bacteria 1973
285 2889795946 2889790730 Bacteria 5689708
286 2889915498 2889914905 Bacteria 5702301
287 2937844867 2937843397 Bacteria 5256375
288 Ga0207643_10035005
289 Ga0070683_100159864
290 Ga0070660_100134219
291 Ga0070689_100062683
292 Ga0070675_100297956
293 Ga0070674_100008831
294 Ga0070688_100002486
295 Ga0070659_100016571
296 Ga0070700_100005890
297 Ga0070708_100014098
298 Ga0070708_100033654
299 Ga0070708_100033742
300 Ga0070708_100053940
301 Ga0070708_100060539
302 Ga0070708_100109286
303 Ga0070678_100274280
304 Ga0070678_100285567
305 Ga0070681_10179698
306 Ga0070706_100133382
307 Ga0070706_100135456
308 Ga0070707_100000163
309 Ga0070707_100038400
310 Ga0070707_100127875
311 Ga0070707_100260020
312 Ga0070707_100343471
313 Ga0070698_100016770
314 Ga0070698_100025807
315 Ga0070698_100046835
316 Ga0070698_100067001
317 Ga0070698_100089780
318 Ga0070699_100001077
319 Ga0070699_100001296
320 Ga0070699_100008469
321 Ga0070679_100119293
322 Ga0070684_100135795
323 Ga0070697_100019829
324 Ga0070697_100020155
325 Ga0070697_100027101
326 Ga0070697_100183020
327 Ga0070672_100039035
328 Ga0070695_100005199
329 Ga0070695_100054472
330 Ga0070695_100067500
331 Ga0070696_100017275
332 Ga0070696_100038006
333 Ga0070696_100062353
334 Ga0068857_100182549
335 Ga0068854_100164764
336 Ga0070702_100034667
337 Ga0068864_100016751
338 Ga0068861_100212842
339 Ga0068860_100176503
340 Ga0068860_100380372
341 Ga0081455_10058099
342 Ga0081539_10004486
343 Ga0081539_10004682
344 Ga0097621_100301652
345 Ga0075428_100006306
346 Ga0075433_10059339
347 Ga0075434_100015697
348 Ga0075435_100052947
349 Ga0075435_100137613
350 Ga0075435_100150934
351 Ga0111539_10135015
352 Ga0111539_10157175
353 Ga0105245_10027477
354 Ga0105245_10239095
355 Ga0114129_10017170
356 Ga0114129_10097211
357 Ga0114129_10248139
358 Ga0105243_10171889
359 Ga0105242_10057001
360 Ga0105248_10038404
361 Ga0105248_10301311
362 Ga0105249_10036190
363 Ga0105249_10099722
364 Ga0105249_10135021
365 Ga0105249_10550196
366 Ga0105239_10147968
367 Ga0157375_10375183
368 Ga0163163_10017138
369 Ga0163163_10367957
370 Ga0157380_10060906
371 Ga0157380_10540795
372 Ga0182008_10087312
373 Ga0157379_10141828
374 Ga0157376_10631789
375 Ga0207653_10021013
376 Ga0207642_10058051
377 Ga0207684_10004490
378 Ga0207684_10008896
379 Ga0207684_10089109
380 Ga0207684_10113687
381 Ga0207684_10129009
382 Ga0207662_10014832
383 Ga0207657_10145349
384 Ga0207646_10003272
385 Ga0207646_10005854
386 Ga0207646_10011891
387 Ga0207646_10027694
388 Ga0207646_10149853
389 Ga0207646_10298475
390 Ga0207659_10057721
391 Ga0207659_10178897
392 Ga0207687_10035408
393 Ga0207687_10062822
394 Ga0207706_10066331
395 Ga0207686_10097973
396 Ga0207691_10117201
397 Ga0207712_10026386
398 Ga0207712_10048916
399 Ga0207708_10011851
400 Ga0207648_10005758
401 Ga0207676_10077572
402 Ga0207674_10007027
403 Ga0207675_100031518
404 Ga0207683_10019227
405 Ga0209998_10001268
406 Ga0209974_10008789
407 Ga0209974_10020266
408 Ga0207428_10157301
409 Ga0268265_10127521
410 Ga0268264_10100428
411 Ga0268264_10194957
412 Ga0316576_10017439
413 Ga0316576_10025722
414 Ga0316578_10014005
415 Ga0316578_10042552
416 Ga0307405_10078001
417 Ga0307406_10042430
418 Ga0307412_10065649
419 Ga0307409_100247218
420 Ga0307416_100001078
421 Ga0307415_100004695
422 Ga0307415_100219547
423 Ga0316580_10022249
424 Ga0373961_0012744
425 Ga0316574_0032316
426 Ga0373927_0092659
427 Ga0373937_0199127
428 Ga0316584_0109954
429 Ga0395899_0079732
430 Ga0395900_0001943
431 Ga0395898_0002954
432 Ga0395905_0024193
433 Ga0395901_0021940
434 Ga0439431_0032468
435 Ga0451577_0006499
436 Ga0451577_0073911
437 Ga0451577_0138756
438 Ga0451577_0382907
439 Ga0453683_0014226
440 Ga0453684_0204212
441 Ga0453684_0244823
442 Ga0453684_0279250
443 Ga0453684_0394185
444 Ga0451576_0016356
445 Ga0451576_0086258
446 Ga0495603_0073293
447 Ga0495641_0050750
448 Ga0495651_0029801
449 Ga0495664_0106495
450 Ga0495602_0120966
451 Ga0496101_0141076
452 Ga0496102_0017689
453 Ga0496104_0150429
454 Ga0496104_0237778
455 Ga0496105_0039248
456 Ga0496106_0320994
457 Ga0496108_0013593
458 Ga0496108_0019610
459 Ga0496108_0047955
460 Ga0496109_0006101
461 Ga0496109_0107892
462 Ga0496111_0031279
463 Ga0496111_0218188
464 Ga0496112_0046518
465 Ga0496112_0433518
466 Ga0496113_0118933
467 Ga0496113_0126616
468 Ga0496114_0151488
469 Ga0496114_0296553
470 Ga0501031_0047618
471 Ga0501031_0053428
472 Ga0501033_0095133
473 Ga0501034_0041412
474 Ga0501036_0028962
475 Ga0501036_0095903
476 Ga0501037_0052726
477 Ga0501038_0031097
478 Ga0501039_0064750
479 Ga0501039_0165214
480 Ga0501039_0210475
481 Ga0501040_0008798
482 Ga0501040_0025260
483 Ga0501040_0130327
484 Ga0501040_0162344
485 Ga0501041_0024232
486 Ga0501041_0074691
487 Ga0501042_0010349
488 Ga0501042_0036977
489 Ga0501042_0049489
490 Ga0501043_0049108
491 Ga0501043_0135383
492 Ga0501046_0077808
493 Ga0501048_0042886
494 Ga0501048_0088987
495 Ga0501048_0248515
496 Ga0501067_0024294
497 Ga0501067_0044939
498 Ga0501069_0103430
499 Ga0501070_0062599
500 Ga0501070_0213443
501 Ga0501071_0028285
502 Ga0501071_0144116
503 Ga0501071_0155282
504 Ga0501071_0169666
505 Ga0501072_0032634
506 Ga0501072_0091860
507 Ga0501072_0220508
508 Ga0501072_0241210
509 Ga0501073_0069949
510 Ga0501073_0221842
511 Ga0501074_0045446
512 Ga0501074_0098415
513 Ga0501075_0023538
514 Ga0501075_0052292
515 Ga0501075_0079837
516 Ga0501075_0084071
517 Ga0501075_0110107
518 Ga0501075_0125817
519 Ga0501076_0079915
520 Ga0501076_0125640
521 Ga0501076_0244851
522 Ga0501076_0310379
523 Ga0501076_0428470
524 Ga0501077_0062462
525 Ga0501077_0067331
526 Ga0501077_0080627
527 Ga0501077_0141932
528 Ga0501077_0173598
529 Ga0501079_0042146
530 Ga0501079_0054822
531 Ga0501079_0059150
532 Ga0501080_0093776
533 Ga0501080_0143171
534 Ga0501080_0288188
535 Ga0501081_0005509
536 Ga0501081_0011444
537 Ga0501081_0058968
538 Ga0501081_0146205
539 Ga0501081_0219193
540 Ga0501035_0081578
541 Ga0501035_0320774
542 Ga0501045_0179078
543 nmdc:mga00v17_124933_c1
544 nmdc:mga05p37_104603_c1
545 nmdc:mga05p37_137403_c1
546 nmdc:mga05p37_637_c1
547 nmdc:mga09592_164962_c1
548 nmdc:mga06r32_51506_c1
549 nmdc:mga08y16_77761_c1
550 nmdc:mga0n895_71075_c1
551 nmdc:mga0rr50_111751_c1
552 nmdc:mga0rr50_73512_c1
553 nmdc:mga0a205_136692_c1
554 nmdc:mga0a205_15148_c1
555 Ga0495612_0000194
556 Ga0495595_0041088
557 Ga0500616_0000960
558 Ga0501084_0037972
559 Ga0501084_0131188
560 Ga0501084_0266837
561 Ga0590075_012328
562 Ga0501082_0041222
563 Ga0501082_0075181
564 Ga0501082_0077238
565 Ga0501082_0092272
566 Ga0501082_0140776
567 Ga0501082_0291052
568 Ga0530510_0018435
569 Ga0530510_0027355
570 Ga0530510_0027895
571 Ga0530510_0114908
572 2889795946
573 2889915498
574 2937844867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00850

Hist_deacetyl

Histone deacetylase domain

26

330

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pht-assembly1.cif.gz_A crystal structure of marinobacter subterrani acetylpolyamine amidohydrolase (msapah) complexed with 5-[(3-aminopropyl)amino]pentylboronic acid 0.9694 1 355
3q9c-assembly1.cif.gz_I crystal structure of h159a apah complexed with n8-acetylspermidine 0.968 1 352
3q9c-assembly1.cif.gz_I crystal structure of h159a apah complexed with n8-acetylspermidine 0.9624 1 352
3q9b-assembly3.cif.gz_C crystal structure of apah complexed with m344 0.961 1 352
6pht-assembly1.cif.gz_A crystal structure of marinobacter subterrani acetylpolyamine amidohydrolase (msapah) complexed with 5-[(3-aminopropyl)amino]pentylboronic acid 0.9584 1 355
ID Description Score Start End Superfamily
3q9bC00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.961 1 352 3.40.800.20
3q9bC00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9555 1 352 3.40.800.20
3menC00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9448 1 350 3.40.800.20
3menC00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9366 1 350 3.40.800.20
af_A0A0R0JIQ9_1_158_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.904 227 358 3.40.800.20
ID Description Score Start End GO Terms
AF-A0A6L6CU01-F1-model_v4 Histone deacetylase family protein 0.9926 152 352 GO:0004407
GO:0040029
AF-X1VWX7-F1-model_v4 Histone deacetylase domain-containing protein 0.9925 218 353 GO:0004407
GO:0040029
AF-A0A4S0JLK9-F1-model_v4 Histone deacetylase family protein 0.9915 212 313 GO:0004407
GO:0040029
AF-A0A4S0IFJ3-F1-model_v4 Histone deacetylase family protein 0.9902 216 325 GO:0004407
GO:0040029
AF-A0A7Y8E0R0-F1-model_v4 deleted 0.9898 152 298

Map