F387999

General Info

Members Datasets Scaffolds Average Seq Length
287 180 272 354

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10342811|Ga0105237_103428111
Length 396
Sequence LTLPVRERGVETGGLMFGYFKGSFAFTALCLAIGAWVGWTLTHDVMGTLGVLWIVFVLGVLEVSLSFDNAVVNATVLREMNPVWRQRFLTWGIVIAVFGMRIVFPLVIVAIAAKLGPIDAITLAATDPVAYERIITGAHVGISGFGGAFLAMVGLTFFLDEDKDLHWIGVIERPFAGLSRISGLAIGIVLLVLYAISRQIDPAEAVTFLTAGMFGLVAYIAVQSIAKSGLAAFLYLEVLDASFSFDGVIGAFALSNNLFVIALGLGIGAMFVRSMTVMLVDRGTLTEYRYLEHGAFYAIVALAAIMLISVRIEVPEAVTGLIGAAFIGLAFLTSVRANRNEPDHEMALAEASPVAPTGEHLNLQSRVLQEQEACLSVYPRAATSAFPRKNPISRRY

Samples

Sample ID Description Type Environment
1 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
2 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
3 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
4 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
5 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
6 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
7 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
8 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
9 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
10 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
11 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
12 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
13 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
114 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
128 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
134 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
139 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
140 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
141 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
172 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
173 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
174 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
175 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
176 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
177 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
178 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
179 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
180 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.77
Metatranscriptomes 0
Isolates 5.23

Biome Distribution

Category Percentage (%)
Aerial Root 1.74
Bulb 0
Endosphere 9.76
Nodule 0
Rhizoplane 6.27
Rhizosphere 70.38
Stem 0
Stem Tuber 0
Unclassified 11.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10003348 3300002239 Bacteria 2233
2 JGI24751J29686_10000267 3300002459 Bacteria 20291
3 Ga0055526_1000882 3300003771 Bacteria 22303
4 Ga0055536_1007983 3300003781 Bacteria 4632
5 Ga0055530_10001271 3300003791 Bacteria 19049
6 Ga0055540_1000667 3300003792 Bacteria 23816
7 Ga0055531_10001272 3300003794 Bacteria 19049
8 Ga0065165_1010734 3300005262 Bacteria 3914
9 Ga0065704_10000389 3300005289 Bacteria 54266
10 Ga0065704_10002225 3300005289 Bacteria 5600
11 Ga0065707_10113583 3300005295 Bacteria 2323
12 Ga0070658_10000673 3300005327 Bacteria 29560
13 Ga0070658_10017018 3300005327 Bacteria 5818
14 Ga0070658_10097750 3300005327 Bacteria 2424
15 Ga0070658_10102191 3300005327 Bacteria 2370
16 Ga0070683_100012897 3300005329 Bacteria 7274
17 Ga0070683_100074427 3300005329 Bacteria 3172
18 Ga0070690_100123326 3300005330 Bacteria 1741
19 Ga0070670_100167247 3300005331 Bacteria 1907
20 Ga0070666_10129298 3300005335 Bacteria 1754
21 Ga0070680_100059333 3300005336 Bacteria 3129
22 Ga0070660_100010543 3300005339 Bacteria 6531
23 Ga0070660_100016196 3300005339 Bacteria 5406
24 Ga0070661_100007672 3300005344 Bacteria 7451
25 Ga0070661_100156433 3300005344 Bacteria 1725
26 Ga0070668_100006012 3300005347 Bacteria 9005
27 Ga0070669_100000882 3300005353 Bacteria 21822
28 Ga0070669_100001091 3300005353 Bacteria 19871
29 Ga0070671_100000054 3300005355 Bacteria 77908
30 Ga0070671_100005836 3300005355 Bacteria 9807
31 Ga0070671_100049351 3300005355 Bacteria 3502
32 Ga0070659_100003170 3300005366 Bacteria 11711
33 Ga0070659_100004337 3300005366 Bacteria 10130
34 Ga0070659_100115778 3300005366 Bacteria 2167
35 Ga0070667_100000970 3300005367 Bacteria 26343
36 Ga0070667_100075006 3300005367 Bacteria 2887
37 Ga0070662_100002006 3300005457 Bacteria 12477
38 Ga0070662_100002144 3300005457 Bacteria 12094
39 Ga0070662_100009844 3300005457 Bacteria 6264
40 Ga0070681_10014699 3300005458 Bacteria 7785
41 Ga0070679_100003661 3300005530 Bacteria 14071
42 Ga0070679_100018775 3300005530 Bacteria 6713
43 Ga0070679_100059400 3300005530 Bacteria 3811
44 Ga0070684_100288356 3300005535 Bacteria 1505
45 Ga0068853_100002316 3300005539 Bacteria 14258
46 Ga0070665_100002793 3300005548 Bacteria 18929
47 Ga0070665_100007495 3300005548 Bacteria 11096
48 Ga0070665_100109164 3300005548 Bacteria 2769
49 Ga0068855_100002587 3300005563 Bacteria 22297
50 Ga0068855_100031013 3300005563 Bacteria 6388
51 Ga0068855_100032889 3300005563 Bacteria 6192
52 Ga0068855_100087820 3300005563 Bacteria 3593
53 Ga0068855_100153017 3300005563 Bacteria 2622
54 Ga0070664_100001260 3300005564 Bacteria 20291
55 Ga0070664_100050410 3300005564 Bacteria 3523
56 Ga0068854_100070661 3300005578 Bacteria 2552
57 Ga0068856_100031883 3300005614 Bacteria 5156
58 Ga0068852_100002376 3300005616 Bacteria 12962
59 Ga0068852_100052313 3300005616 Bacteria 3510
60 Ga0068852_100111630 3300005616 Bacteria 2486
61 Ga0068852_100181962 3300005616 Bacteria 1977
62 Ga0068852_100206664 3300005616 Bacteria 1860
63 Ga0068859_100050406 3300005617 Bacteria 4182
64 Ga0068859_100260832 3300005617 Bacteria 1824
65 Ga0068864_100009358 3300005618 Bacteria 8083
66 Ga0068864_100186557 3300005618 Bacteria 1899
67 Ga0068864_100191989 3300005618 Bacteria 1873
68 Ga0068863_100000072 3300005841 Bacteria 113996
69 Ga0068863_100002049 3300005841 Bacteria 19961
70 Ga0068858_100002462 3300005842 Bacteria 18688
71 Ga0068858_100023278 3300005842 Bacteria 5773
72 Ga0068858_100115855 3300005842 Bacteria 2504
73 Ga0068858_100150228 3300005842 Bacteria 2190
74 Ga0068860_100000549 3300005843 Bacteria 45722
75 Ga0068860_100005471 3300005843 Bacteria 12871
76 Ga0068860_100008385 3300005843 Bacteria 10292
77 Ga0068860_100050267 3300005843 Bacteria 3969
78 Ga0068862_100000465 3300005844 Bacteria 43692
79 Ga0068862_100302705 3300005844 Bacteria 1471
80 Ga0075432_10006404 3300006058 Bacteria 4006
81 Ga0075366_10061397 3300006195 Bacteria 2234
82 Ga0075370_10012050 3300006353 Bacteria 4560
83 Ga0097620_100050406 3300006931 Bacteria 4182
84 Ga0097620_100260825 3300006931 Bacteria 1824
85 Ga0105251_10094132 3300009011 Bacteria 1374
86 Ga0105250_10008549 3300009092 Bacteria 4340
87 Ga0105247_10004202 3300009101 Bacteria 9239
88 Ga0105241_10034283 3300009174 Bacteria 3813
89 Ga0105248_10097591 3300009177 Bacteria 3310
90 Ga0105237_10342811 3300009545 Bacteria 1498
91 Ga0105249_10000015 3300009553 Bacteria 282138
92 Ga0105246_10000315 3300011119 Bacteria 25642
93 Ga0157371_10000802 3300013102 Bacteria 36039
94 Ga0157370_10003507 3300013104 Bacteria 18393
95 Ga0157370_10135864 3300013104 Bacteria 2292
96 Ga0157369_10012823 3300013105 Bacteria 9503
97 Ga0163162_10003379 3300013306 Bacteria 15268
98 Ga0157372_10000426 3300013307 Bacteria 46310
99 Ga0157372_10108821 3300013307 Bacteria 3173
100 Ga0157379_10110406 3300014968 Bacteria 2470
101 Ga0213873_10000020 3300021358 Bacteria 119758
102 Ga0213876_10000004 3300021384 Bacteria 943822
103 Ga0213876_10000739 3300021384 Bacteria 22677
104 Ga0209676_1001454 3300025292 Bacteria 22208
105 Ga0209564_1001572 3300025295 Bacteria 22355
106 Ga0209050_1000001 3300025298 Bacteria 3563507
107 Ga0209051_1000193 3300025303 Bacteria 108391
108 Ga0209257_1001950 3300025304 Bacteria 22274
109 Ga0207696_1003498 3300025711 Bacteria 7115
110 Ga0207713_1024184 3300025735 Bacteria 2839
111 Ga0207682_10025556 3300025893 Bacteria 2343
112 Ga0207710_10011527 3300025900 Bacteria 3720
113 Ga0207680_10094899 3300025903 Bacteria 1905
114 Ga0207647_10016221 3300025904 Bacteria 5086
115 Ga0207705_10000023 3300025909 Bacteria 301755
116 Ga0207705_10007551 3300025909 Bacteria 7989
117 Ga0207705_10036989 3300025909 Bacteria 3493
118 Ga0207705_10044611 3300025909 Bacteria 3186
119 Ga0207707_10065942 3300025912 Bacteria 3153
120 Ga0207657_10000453 3300025919 Bacteria 43584
121 Ga0207657_10022486 3300025919 Bacteria 5896
122 Ga0207649_10013852 3300025920 Bacteria 4509
123 Ga0207652_10001425 3300025921 Bacteria 21196
124 Ga0207652_10018246 3300025921 Bacteria 5754
125 Ga0207681_10003930 3300025923 Bacteria 9215
126 Ga0207644_10000003 3300025931 Bacteria 585905
127 Ga0207644_10027080 3300025931 Bacteria 3957
128 Ga0207644_10037248 3300025931 Bacteria 3421
129 Ga0207690_10003723 3300025932 Bacteria 9061
130 Ga0207690_10129809 3300025932 Bacteria 1843
131 Ga0207706_10000420 3300025933 Bacteria 45587
132 Ga0207706_10002157 3300025933 Bacteria 19220
133 Ga0207706_10007650 3300025933 Bacteria 9983
134 Ga0207661_10008524 3300025944 Bacteria 7325
135 Ga0207661_10143389 3300025944 Bacteria 2058
136 Ga0207679_10017042 3300025945 Bacteria 4835
137 Ga0207667_10002181 3300025949 Bacteria 24562
138 Ga0207667_10020198 3300025949 Bacteria 7414
139 Ga0207667_10056980 3300025949 Bacteria 4103
140 Ga0207712_10000023 3300025961 Bacteria 282081
141 Ga0207668_10003535 3300025972 Bacteria 9184
142 Ga0207640_10006569 3300025981 Bacteria 6384
143 Ga0207640_10095111 3300025981 Bacteria 2074
144 Ga0207658_10022361 3300025986 Bacteria 4402
145 Ga0207658_10056023 3300025986 Bacteria 2924
146 Ga0207658_10184017 3300025986 Bacteria 1731
147 Ga0207703_10001871 3300026035 Bacteria 18720
148 Ga0207703_10071195 3300026035 Bacteria 2872
149 Ga0207703_10335352 3300026035 Bacteria 1388
150 Ga0207639_10001180 3300026041 Bacteria 17752
151 Ga0207678_10341609 3300026067 Bacteria 1290
152 Ga0207702_10005487 3300026078 Bacteria 11088
153 Ga0207702_10037676 3300026078 Bacteria 4049
154 Ga0207702_10205817 3300026078 Bacteria 1827
155 Ga0207641_10000084 3300026088 Bacteria 133555
156 Ga0207641_10001955 3300026088 Bacteria 19748
157 Ga0207676_10126243 3300026095 Bacteria 2167
158 Ga0207676_10197804 3300026095 Bacteria 1773
159 Ga0207698_10000141 3300026142 Bacteria 45510
160 Ga0207698_10010703 3300026142 Bacteria 5916
161 Ga0207698_10065604 3300026142 Bacteria 2853
162 Ga0207698_10075591 3300026142 Bacteria 2693
163 Ga0207698_10247580 3300026142 Bacteria 1629
164 Ga0209974_10003936 3300027876 Bacteria 5313
165 Ga0209974_10005592 3300027876 Bacteria 4413
166 Ga0207428_10031237 3300027907 Bacteria 4398
167 Ga0268265_10000049 3300028380 Bacteria 177242
168 Ga0268265_10039779 3300028380 Bacteria 3467
169 Ga0268265_10288988 3300028380 Bacteria 1471
170 Ga0268264_10000291 3300028381 Bacteria 84105
171 Ga0268264_10000662 3300028381 Bacteria 40438
172 Ga0268264_10006251 3300028381 Bacteria 10046
173 Ga0268264_10109373 3300028381 Bacteria 2418
174 Ga0307513_10017979 3300031456 Bacteria 8464
175 Ga0307508_10070721 3300031616 Bacteria 3063
176 Ga0316579_10023610 3300031691 Bacteria 2762
177 Ga0307405_10002825 3300031731 Bacteria 7795
178 Ga0307413_10060451 3300031824 Bacteria 2333
179 Ga0307412_10012911 3300031911 Bacteria 4881
180 Ga0307412_10041539 3300031911 Bacteria 2981
181 Ga0307409_100240083 3300031995 Bacteria 1649
182 Ga0307416_100114784 3300032002 Bacteria 2383
183 Ga0307414_10035317 3300032004 Bacteria 3325
184 Ga0307414_10066078 3300032004 Bacteria 2583
185 Ga0307414_10074875 3300032004 Bacteria 2455
186 Ga0307414_10126989 3300032004 Bacteria 1972
187 Ga0307411_10087141 3300032005 Bacteria 2168
188 Ga0307411_10118677 3300032005 Bacteria 1909
189 Ga0316583_10000438 3300032133 Bacteria 12212
190 Ga0436365_0876968 3300039437 Bacteria 38690
191 Ga0436365_1460153 3300039437 Bacteria 77405
192 Ga0436362_0634959 3300039453 Bacteria 65311
193 Ga0451577_0004300 3300042876 Bacteria 15124
194 Ga0451576_0000007 3300045051 Bacteria 782228
195 Ga0495627_001076 3300046453 Bacteria 17964
196 Ga0495650_0001990 3300046471 Bacteria 17944
197 Ga0495610_0001009 3300046512 Bacteria 25934
198 Ga0495632_0000001 3300046519 Bacteria 873295
199 Ga0495637_0000360 3300046520 Bacteria 34584
200 Ga0495643_0000020 3300046522 Bacteria 294973
201 Ga0495643_0000080 3300046522 Bacteria 161872
202 Ga0495643_0015211 3300046522 Bacteria 4555
203 Ga0495663_0000002 3300046525 Bacteria 495384
204 Ga0495598_0044470 3300046537 Bacteria 1312
205 Ga0495621_0062894 3300046539 Bacteria 1351
206 Ga0495633_0010511 3300046558 Bacteria 5045
207 Ga0495625_0000404 3300046660 Bacteria 65897
208 Ga0495625_0209993 3300046660 Bacteria 1280
209 Ga0495670_0000003 3300046691 Bacteria 326779
210 Ga0495671_0000016 3300046692 Bacteria 294821
211 Ga0495681_0001397 3300047470 Bacteria 18193
212 Ga0495615_0005119 3300048090 Bacteria 2337
213 Ga0496100_0000656 3300048903 Bacteria 16401
214 Ga0496101_0032048 3300048904 Bacteria 3697
215 Ga0496101_0079380 3300048904 Bacteria 2422
216 Ga0496102_0001222 3300048905 Bacteria 23312
217 Ga0496102_0103427 3300048905 Bacteria 2649
218 Ga0496103_0000103 3300048906 Bacteria 93232
219 Ga0496103_0057369 3300048906 Bacteria 2418
220 Ga0496104_0000108 3300048907 Bacteria 78428
221 Ga0496104_0016850 3300048907 Bacteria 6643
222 Ga0496104_0065598 3300048907 Bacteria 3445
223 Ga0496105_0000286 3300048908 Bacteria 33314
224 Ga0496105_0011290 3300048908 Bacteria 7051
225 Ga0496105_0018836 3300048908 Bacteria 5558
226 Ga0496106_0000675 3300048909 Bacteria 24457
227 Ga0496107_0008856 3300048910 Bacteria 6974
228 Ga0496108_0190920 3300048911 Bacteria 1775
229 Ga0496113_0010126 3300048916 Bacteria 6221
230 Ga0496115_0080152 3300048918 Bacteria 2658
231 Ga0496117_0000370 3300048920 Bacteria 78425
232 Ga0496117_0018029 3300048920 Bacteria 5872
233 Ga0496118_0000829 3300048921 Bacteria 49162
234 Ga0496118_0044773 3300048921 Bacteria 3461
235 Ga0496118_0055451 3300048921 Bacteria 2991
236 Ga0496118_0065049 3300048921 Bacteria 2671
237 Ga0496119_0000458 3300048922 Bacteria 55781
238 Ga0496120_0001211 3300048923 Bacteria 32604
239 Ga0496121_0000022 3300048924 Bacteria 472849
240 Ga0496121_0000934 3300048924 Bacteria 52808
241 Ga0496121_0006858 3300048924 Bacteria 13922
242 Ga0496122_0002754 3300048925 Bacteria 24268
243 Ga0496123_0005393 3300048926 Bacteria 12886
244 Ga0496123_0115632 3300048926 Bacteria 1521
245 Ga0496124_0004169 3300048927 Bacteria 17043
246 Ga0496124_0004850 3300048927 Bacteria 15471
247 Ga0496124_0131372 3300048927 Bacteria 1989
248 Ga0496125_0075135 3300048928 Bacteria 2616
249 Ga0496125_0114589 3300048928 Bacteria 1941
250 Ga0496126_0000487 3300048929 Bacteria 78519
251 Ga0496126_0000570 3300048929 Bacteria 70614
252 Ga0496126_0003370 3300048929 Bacteria 20264
253 Ga0501033_0071943 3300049570 Bacteria 2540
254 Ga0501034_0078815 3300049571 Bacteria 3298
255 Ga0501042_0080235 3300049578 Bacteria 2338
256 Ga0501047_0281683 3300049581 Bacteria 1507
257 Ga0501249_009520 3300049679 Bacteria 2022
258 nmdc:mga0k408_6945_c1 3300050493 Bacteria 6039
259 nmdc:mga0k408_96070_c1 3300050493 Bacteria 1744
260 nmdc:mga06z11_89265_c1 3300050494 Bacteria 1670
261 nmdc:mga07m45_23145_c1 3300050496 Bacteria 3394
262 nmdc:mga07m45_87833_c1 3300050496 Bacteria 1779
263 Ga0500643_000001 3300053087 Bacteria 1440111
264 Ga0500562_012490 3300053108 Bacteria 2161
265 Ga0500594_0015786 3300053118 Bacteria 1827
266 Ga0500608_000562 3300053122 Bacteria 13861
267 Ga0500618_014744 3300053125 Bacteria 1990
268 Ga0500564_001284 3300053138 Bacteria 8542
269 Ga0500588_0021498 3300053146 Bacteria 1743
270 Ga0500590_000253 3300053148 Bacteria 16547
271 Ga0500567_000365 3300053723 Bacteria 14859
272 Ga0500625_000006 3300053729 Bacteria 206258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_87833_c1 nmdc:mga07m45_87833_c1_813_1769 314
2 3300046512 Ga0495610_0001009 Ga0495610_0001009_13154_14242 326
3 3300046522 Ga0495643_0000080 Ga0495643_0000080_76081_77169 326
4 3300005344 Ga0070661_100156433 Ga0070661_1001564331 331
5 3300005355 Ga0070671_100000054 Ga0070671_10000005421 331
6 3300005457 Ga0070662_100009844 Ga0070662_1000098444 331
7 3300005564 Ga0070664_100050410 Ga0070664_1000504102 331
8 3300025903 Ga0207680_10094899 Ga0207680_100948992 331
9 3300025931 Ga0207644_10000003 Ga0207644_10000003385 331
10 3300025933 Ga0207706_10007650 Ga0207706_100076505 331
11 3300025945 Ga0207679_10017042 Ga0207679_100170423 331
12 3300025986 Ga0207658_10184017 Ga0207658_101840172 331
13 3300048906 Ga0496103_0057369 Ga0496103_0057369_32_1093 331
14 3300048907 Ga0496104_0065598 Ga0496104_0065598_1040_2101 331
15 3300048908 Ga0496105_0011290 Ga0496105_0011290_5926_6987 331
16 3300048911 Ga0496108_0190920 Ga0496108_0190920_432_1493 331
17 3300048916 Ga0496113_0010126 Ga0496113_0010126_3501_4562 331
18 3300053148 Ga0500590_000253 Ga0500590_000253_13096_14166 331
19 3300005842 Ga0068858_100150228 Ga0068858_1001502282 334
20 3300021358 Ga0213873_10000020 Ga0213873_1000002043 334
21 3300021384 Ga0213876_10000004 Ga0213876_10000004439 334
22 3300026035 Ga0207703_10071195 Ga0207703_100711952 334
23 3300039437 Ga0436365_1460153 Ga0436365_1460153_36472_37578 334
24 3300039453 Ga0436362_0634959 Ga0436362_0634959_24378_25484 334
25 3300046453 Ga0495627_001076 Ga0495627_001076_8158_9246 335
26 3300046471 Ga0495650_0001990 Ga0495650_0001990_8135_9223 335
27 3300047470 Ga0495681_0001397 Ga0495681_0001397_8722_9810 335
28 3300005366 Ga0070659_100004337 Ga0070659_1000043377 336
29 3300045051 Ga0451576_0000007 Ga0451576_0000007_186578_187645 336
30 3300025944 Ga0207661_10143389 Ga0207661_101433892 337
31 3300053125 Ga0500618_014744 Ga0500618_014744_172_1209 337
32 3300005367 Ga0070667_100000970 Ga0070667_10000097015 340
33 3300005548 Ga0070665_100007495 Ga0070665_1000074957 340
34 3300005618 Ga0068864_100009358 Ga0068864_1000093584 340
35 3300005841 Ga0068863_100000072 Ga0068863_10000007286 340
36 3300005842 Ga0068858_100023278 Ga0068858_1000232783 340
37 3300005843 Ga0068860_100000549 Ga0068860_10000054911 340
38 3300021384 Ga0213876_10000739 Ga0213876_100007393 340
39 3300025986 Ga0207658_10022361 Ga0207658_100223613 340
40 3300026035 Ga0207703_10335352 Ga0207703_103353521 340
41 3300026088 Ga0207641_10000084 Ga0207641_1000008487 340
42 3300026095 Ga0207676_10197804 Ga0207676_101978042 340
43 3300028381 Ga0268264_10000291 Ga0268264_1000029144 340
44 3300039437 Ga0436365_0876968 Ga0436365_0876968_17301_18404 340
45 3300048924 Ga0496121_0000022 Ga0496121_0000022_271072_272121 340
46 iso_pu_bacteria 2919138771 2919140211 340
47 3300031616 Ga0307508_10070721 Ga0307508_100707213 341
48 3300048905 Ga0496102_0103427 Ga0496102_0103427_175_1224 341
49 3300048907 Ga0496104_0016850 Ga0496104_0016850_5514_6563 341
50 3300048908 Ga0496105_0018836 Ga0496105_0018836_1528_2577 341
51 3300048921 Ga0496118_0055451 Ga0496118_0055451_1919_2968 341
52 3300048924 Ga0496121_0000934 Ga0496121_0000934_54_1103 341
53 iso_pu_bacteria 3000865235 3000866250 341
54 3300005327 Ga0070658_10000673 Ga0070658_1000067328 342
55 3300005457 Ga0070662_100002144 Ga0070662_1000021442 342
56 3300005563 Ga0068855_100087820 Ga0068855_1000878203 342
57 3300005563 Ga0068855_100153017 Ga0068855_1001530172 342
58 3300005614 Ga0068856_100031883 Ga0068856_1000318833 342
59 3300005616 Ga0068852_100002376 Ga0068852_10000237610 342
60 3300005616 Ga0068852_100052313 Ga0068852_1000523133 342
61 3300006058 Ga0075432_10006404 Ga0075432_100064043 342
62 3300011119 Ga0105246_10000315 Ga0105246_1000031518 342
63 3300025904 Ga0207647_10016221 Ga0207647_100162212 342
64 3300025909 Ga0207705_10000023 Ga0207705_10000023247 342
65 3300025933 Ga0207706_10002157 Ga0207706_100021578 342
66 3300025949 Ga0207667_10056980 Ga0207667_100569803 342
67 3300025981 Ga0207640_10095111 Ga0207640_100951111 342
68 3300026078 Ga0207702_10005487 Ga0207702_1000548710 342
69 3300026078 Ga0207702_10205817 Ga0207702_102058172 342
70 3300026142 Ga0207698_10000141 Ga0207698_1000014150 342
71 3300026142 Ga0207698_10010703 Ga0207698_100107034 342
72 3300027907 Ga0207428_10031237 Ga0207428_100312373 342
73 3300049679 Ga0501249_009520 Ga0501249_009520_667_1707 342
74 3300006353 Ga0075370_10012050 Ga0075370_100120503 343
75 3300013104 Ga0157370_10135864 Ga0157370_101358641 343
76 3300028381 Ga0268264_10109373 Ga0268264_101093732 343
77 3300046660 Ga0495625_0000404 Ga0495625_0000404_7898_8935 343
78 3300049571 Ga0501034_0078815 Ga0501034_0078815_348_1394 343
79 3300050496 nmdc:mga07m45_23145_c1 nmdc:mga07m45_23145_c1_1670_2716 343
80 3300005563 Ga0068855_100032889 Ga0068855_1000328892 344
81 3300005616 Ga0068852_100181962 Ga0068852_1001819622 344
82 3300026142 Ga0207698_10247580 Ga0207698_102475802 344
83 3300031691 Ga0316579_10023610 Ga0316579_100236102 344
84 3300032004 Ga0307414_10074875 Ga0307414_100748752 344
85 3300032133 Ga0316583_10000438 Ga0316583_100004386 344
86 3300053146 Ga0500588_0021498 Ga0500588_0021498_351_1400 344
87 3300003781 Ga0055536_1007983 Ga0055536_10079834 345
88 3300005289 Ga0065704_10002225 Ga0065704_100022255 345
89 3300005329 Ga0070683_100074427 Ga0070683_1000744272 345
90 3300026142 Ga0207698_10065604 Ga0207698_100656042 345
91 3300042876 Ga0451577_0004300 Ga0451577_0004300_4225_5274 345
92 3300046537 Ga0495598_0044470 Ga0495598_0044470_141_1193 345
93 3300046539 Ga0495621_0062894 Ga0495621_0062894_110_1162 345
94 3300049570 Ga0501033_0071943 Ga0501033_0071943_322_1383 345
95 3300026067 Ga0207678_10341609 Ga0207678_103416092 346
96 iso_pu_bacteria 2643221588 2643949147 346
97 3300005327 Ga0070658_10017018 Ga0070658_100170187 347
98 3300005327 Ga0070658_10097750 Ga0070658_100977501 347
99 3300005327 Ga0070658_10102191 Ga0070658_101021912 347
100 3300005329 Ga0070683_100012897 Ga0070683_1000128974 347
101 3300005336 Ga0070680_100059333 Ga0070680_1000593333 347
102 3300005339 Ga0070660_100010543 Ga0070660_1000105434 347
103 3300005339 Ga0070660_100016196 Ga0070660_1000161962 347
104 3300005344 Ga0070661_100007672 Ga0070661_1000076723 347
105 3300005366 Ga0070659_100003170 Ga0070659_1000031706 347
106 3300005366 Ga0070659_100115778 Ga0070659_1001157781 347
107 3300005457 Ga0070662_100002006 Ga0070662_1000020067 347
108 3300005458 Ga0070681_10014699 Ga0070681_100146993 347
109 3300005530 Ga0070679_100003661 Ga0070679_1000036619 347
110 3300005530 Ga0070679_100018775 Ga0070679_1000187753 347
111 3300005530 Ga0070679_100059400 Ga0070679_1000594002 347
112 3300005535 Ga0070684_100288356 Ga0070684_1002883562 347
113 3300005539 Ga0068853_100002316 Ga0068853_1000023166 347
114 3300005563 Ga0068855_100002587 Ga0068855_10000258717 347
115 3300005564 Ga0070664_100001260 Ga0070664_1000012606 347
116 3300005578 Ga0068854_100070661 Ga0068854_1000706612 347
117 3300009174 Ga0105241_10034283 Ga0105241_100342834 347
118 3300013102 Ga0157371_10000802 Ga0157371_1000080234 347
119 3300013104 Ga0157370_10003507 Ga0157370_1000350713 347
120 3300013105 Ga0157369_10012823 Ga0157369_100128237 347
121 3300013307 Ga0157372_10000426 Ga0157372_1000042644 347
122 3300013307 Ga0157372_10108821 Ga0157372_101088213 347
123 3300025909 Ga0207705_10007551 Ga0207705_100075513 347
124 3300025909 Ga0207705_10036989 Ga0207705_100369892 347
125 3300025909 Ga0207705_10044611 Ga0207705_100446112 347
126 3300025912 Ga0207707_10065942 Ga0207707_100659422 347
127 3300025919 Ga0207657_10000453 Ga0207657_1000045341 347
128 3300025919 Ga0207657_10022486 Ga0207657_100224864 347
129 3300025920 Ga0207649_10013852 Ga0207649_100138524 347
130 3300025921 Ga0207652_10001425 Ga0207652_1000142513 347
131 3300025921 Ga0207652_10018246 Ga0207652_100182463 347
132 3300025932 Ga0207690_10003723 Ga0207690_100037236 347
133 3300025932 Ga0207690_10129809 Ga0207690_101298091 347
134 3300025933 Ga0207706_10000420 Ga0207706_100004206 347
135 3300025944 Ga0207661_10008524 Ga0207661_100085243 347
136 3300025949 Ga0207667_10002181 Ga0207667_100021816 347
137 3300025981 Ga0207640_10006569 Ga0207640_100065695 347
138 3300026041 Ga0207639_10001180 Ga0207639_100011806 347
139 3300026078 Ga0207702_10037676 Ga0207702_100376761 347
140 3300031995 Ga0307409_100240083 Ga0307409_1002400832 347
141 3300049581 Ga0501047_0281683 Ga0501047_0281683_115_1173 347
142 iso_pu_bacteria 2895880812 2895882574 347
143 3300002459 JGI24751J29686_10000267 JGI24751J29686_1000026714 348
144 3300005330 Ga0070690_100123326 Ga0070690_1001233262 348
145 3300005331 Ga0070670_100167247 Ga0070670_1001672472 348
146 3300005353 Ga0070669_100000882 Ga0070669_1000008829 348
147 3300005355 Ga0070671_100049351 Ga0070671_1000493512 348
148 3300005367 Ga0070667_100075006 Ga0070667_1000750062 348
149 3300005563 Ga0068855_100031013 Ga0068855_1000310134 348
150 3300005616 Ga0068852_100206664 Ga0068852_1002066641 348
151 3300005618 Ga0068864_100186557 Ga0068864_1001865572 348
152 3300005618 Ga0068864_100191989 Ga0068864_1001919892 348
153 3300005842 Ga0068858_100002462 Ga0068858_10000246215 348
154 3300005842 Ga0068858_100115855 Ga0068858_1001158552 348
155 3300005843 Ga0068860_100050267 Ga0068860_1000502672 348
156 3300009177 Ga0105248_10097591 Ga0105248_100975912 348
157 3300014968 Ga0157379_10110406 Ga0157379_101104062 348
158 3300025931 Ga0207644_10037248 Ga0207644_100372482 348
159 3300025949 Ga0207667_10020198 Ga0207667_100201983 348
160 3300025986 Ga0207658_10056023 Ga0207658_100560233 348
161 3300026035 Ga0207703_10001871 Ga0207703_1000187115 348
162 3300026095 Ga0207676_10126243 Ga0207676_101262432 348
163 3300031731 Ga0307405_10002825 Ga0307405_100028252 348
164 3300031911 Ga0307412_10041539 Ga0307412_100415393 348
165 3300046522 Ga0495643_0015211 Ga0495643_0015211_2741_3799 348
166 3300048904 Ga0496101_0079380 Ga0496101_0079380_268_1329 348
167 3300048909 Ga0496106_0000675 Ga0496106_0000675_21392_22453 348
168 3300048910 Ga0496107_0008856 Ga0496107_0008856_5705_6766 348
169 3300048927 Ga0496124_0131372 Ga0496124_0131372_450_1532 348
170 3300049578 Ga0501042_0080235 Ga0501042_0080235_1206_2276 348
171 iso_pu_bacteria 2882806704 2882807927 348
172 3300006195 Ga0075366_10061397 Ga0075366_100613972 349
173 3300025893 Ga0207682_10025556 Ga0207682_100255563 349
174 3300027876 Ga0209974_10005592 Ga0209974_100055922 349
175 3300031824 Ga0307413_10060451 Ga0307413_100604512 349
176 3300031911 Ga0307412_10012911 Ga0307412_100129113 349
177 3300032002 Ga0307416_100114784 Ga0307416_1001147842 349
178 3300032004 Ga0307414_10035317 Ga0307414_100353172 349
179 3300032004 Ga0307414_10066078 Ga0307414_100660782 349
180 3300032004 Ga0307414_10126989 Ga0307414_101269892 349
181 3300032005 Ga0307411_10087141 Ga0307411_100871412 349
182 3300032005 Ga0307411_10118677 Ga0307411_101186772 349
183 3300048090 Ga0495615_0005119 Ga0495615_0005119_801_1865 349
184 3300050493 nmdc:mga0k408_6945_c1 nmdc:mga0k408_6945_c1_3262_4323 349
185 3300050493 nmdc:mga0k408_96070_c1 nmdc:mga0k408_96070_c1_510_1574 349
186 3300053118 Ga0500594_0015786 Ga0500594_0015786_46_1110 349
187 3300053122 Ga0500608_000562 Ga0500608_000562_11395_12459 349
188 3300053138 Ga0500564_001284 Ga0500564_001284_1878_2942 349
189 3300053723 Ga0500567_000365 Ga0500567_000365_1565_2629 349
190 3300053729 Ga0500625_000006 Ga0500625_000006_15234_16298 349
191 iso_pu_bacteria 2739367664 2739650066 349
192 iso_pu_bacteria 2739367865 2740028539 349
193 3300005335 Ga0070666_10129298 Ga0070666_101292982 350
194 3300005616 Ga0068852_100111630 Ga0068852_1001116302 350
195 3300026142 Ga0207698_10075591 Ga0207698_100755913 350
196 3300048929 Ga0496126_0003370 Ga0496126_0003370_16407_17474 350
197 3300009545 Ga0105237_10342811 Ga0105237_103428111 351
198 3300027876 Ga0209974_10003936 Ga0209974_100039363 351
199 3300046519 Ga0495632_0000001 Ga0495632_0000001_218999_220069 351
200 3300046525 Ga0495663_0000002 Ga0495663_0000002_217329_218399 351
201 3300046558 Ga0495633_0010511 Ga0495633_0010511_2938_4008 351
202 3300046660 Ga0495625_0209993 Ga0495625_0209993_47_1117 351
203 iso_pu_bacteria 2896184354 2896184728 351
204 3300003791 Ga0055530_10001271 Ga0055530_1000127113 352
205 3300003792 Ga0055540_1000667 Ga0055540_100066715 352
206 3300003794 Ga0055531_10001272 Ga0055531_1000127213 352
207 3300025292 Ga0209676_1001454 Ga0209676_100145413 352
208 3300025298 Ga0209050_1000001 Ga0209050_10000011184 352
209 3300025303 Ga0209051_1000193 Ga0209051_100019359 352
210 3300025304 Ga0209257_1001950 Ga0209257_100195013 352
211 3300046520 Ga0495637_0000360 Ga0495637_0000360_26340_27413 352
212 3300046522 Ga0495643_0000020 Ga0495643_0000020_203865_204938 352
213 3300046692 Ga0495671_0000016 Ga0495671_0000016_203865_204938 352
214 3300048920 Ga0496117_0018029 Ga0496117_0018029_4301_5401 352
215 3300048921 Ga0496118_0065049 Ga0496118_0065049_1017_2117 352
216 3300048927 Ga0496124_0004169 Ga0496124_0004169_12802_13902 352
217 3300048929 Ga0496126_0000570 Ga0496126_0000570_12802_13902 352
218 3300053087 Ga0500643_000001 Ga0500643_000001_1264894_1265964 352
219 3300053108 Ga0500562_012490 Ga0500562_012490_252_1322 352
220 3300005295 Ga0065707_10113583 Ga0065707_101135833 353
221 3300005617 Ga0068859_100050406 Ga0068859_1000504064 353
222 3300005841 Ga0068863_100002049 Ga0068863_1000020494 353
223 3300005843 Ga0068860_100005471 Ga0068860_1000054717 353
224 3300005844 Ga0068862_100000465 Ga0068862_10000046533 353
225 3300006931 Ga0097620_100050406 Ga0097620_1000504064 353
226 3300009101 Ga0105247_10004202 Ga0105247_100042026 353
227 3300009553 Ga0105249_10000015 Ga0105249_1000001585 353
228 3300025900 Ga0207710_10011527 Ga0207710_100115271 353
229 3300025961 Ga0207712_10000023 Ga0207712_10000023200 353
230 3300026088 Ga0207641_10001955 Ga0207641_1000195523 353
231 3300028380 Ga0268265_10000049 Ga0268265_1000004962 353
232 3300028381 Ga0268264_10000662 Ga0268264_1000066242 353
233 3300031456 Ga0307513_10017979 Ga0307513_100179796 353
234 3300048921 Ga0496118_0000829 Ga0496118_0000829_20294_21382 353
235 iso_pu_bacteria 2848297114 2848299801 356
236 iso_pu_bacteria 2928027323 2928028989 356
237 iso_pu_bacteria 2984555340 2984557779 356
238 iso_pu_bacteria 2984564862 2984567855 356
239 iso_pu_bacteria 2993356040 2993358906 356
240 iso_pu_bacteria 2984555340 2984555497 357
241 iso_pu_bacteria 2993356040 2993357405 357
242 3300005262 Ga0065165_1010734 Ga0065165_10107343 358
243 3300003771 Ga0055526_1000882 Ga0055526_100088213 359
244 3300025295 Ga0209564_1001572 Ga0209564_100157213 359
245 3300005844 Ga0068862_100302705 Ga0068862_1003027051 361
246 3300028380 Ga0268265_10288988 Ga0268265_102889882 361
247 3300002239 JGI24034J26672_10003348 JGI24034J26672_100033482 364
248 3300005289 Ga0065704_10000389 Ga0065704_1000038923 364
249 3300005347 Ga0070668_100006012 Ga0070668_1000060126 364
250 3300005353 Ga0070669_100001091 Ga0070669_1000010912 364
251 3300005355 Ga0070671_100005836 Ga0070671_1000058365 364
252 3300005548 Ga0070665_100002793 Ga0070665_10000279315 364
253 3300005548 Ga0070665_100109164 Ga0070665_1001091642 364
254 3300005617 Ga0068859_100260832 Ga0068859_1002608322 364
255 3300005843 Ga0068860_100008385 Ga0068860_1000083852 364
256 3300006931 Ga0097620_100260825 Ga0097620_1002608252 364
257 3300009011 Ga0105251_10094132 Ga0105251_100941322 364
258 3300009092 Ga0105250_10008549 Ga0105250_100085492 364
259 3300013306 Ga0163162_10003379 Ga0163162_1000337912 364
260 3300025711 Ga0207696_1003498 Ga0207696_10034986 364
261 3300025735 Ga0207713_1024184 Ga0207713_10241842 364
262 3300025923 Ga0207681_10003930 Ga0207681_100039302 364
263 3300025931 Ga0207644_10027080 Ga0207644_100270802 364
264 3300025972 Ga0207668_10003535 Ga0207668_100035353 364
265 3300028380 Ga0268265_10039779 Ga0268265_100397792 364
266 3300028381 Ga0268264_10006251 Ga0268264_100062514 364
267 3300046691 Ga0495670_0000003 Ga0495670_0000003_261895_262995 364
268 3300048903 Ga0496100_0000656 Ga0496100_0000656_14703_15797 364
269 3300048904 Ga0496101_0032048 Ga0496101_0032048_1811_2905 364
270 3300048905 Ga0496102_0001222 Ga0496102_0001222_13730_14824 364
271 3300048906 Ga0496103_0000103 Ga0496103_0000103_79939_81033 364
272 3300048907 Ga0496104_0000108 Ga0496104_0000108_48555_49649 364
273 3300048908 Ga0496105_0000286 Ga0496105_0000286_7192_8286 364
274 3300048918 Ga0496115_0080152 Ga0496115_0080152_1231_2325 364
275 3300048920 Ga0496117_0000370 Ga0496117_0000370_28794_29888 364
276 3300048921 Ga0496118_0044773 Ga0496118_0044773_2324_3418 364
277 3300048922 Ga0496119_0000458 Ga0496119_0000458_46338_47432 364
278 3300048923 Ga0496120_0001211 Ga0496120_0001211_23904_24998 364
279 3300048924 Ga0496121_0006858 Ga0496121_0006858_3401_4495 364
280 3300048925 Ga0496122_0002754 Ga0496122_0002754_627_1721 364
281 3300048926 Ga0496123_0005393 Ga0496123_0005393_11166_12260 364
282 3300048926 Ga0496123_0115632 Ga0496123_0115632_284_1378 364
283 3300048927 Ga0496124_0004850 Ga0496124_0004850_5620_6714 364
284 3300048928 Ga0496125_0075135 Ga0496125_0075135_627_1721 364
285 3300048928 Ga0496125_0114589 Ga0496125_0114589_634_1728 364
286 3300048929 Ga0496126_0000487 Ga0496126_0000487_48555_49649 364
287 3300050494 nmdc:mga06z11_89265_c1 nmdc:mga06z11_89265_c1_256_1422 364

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04332

DUF475

Protein of unknown function (DUF475)

67

341

0.96

PF03741

TerC

Integral membrane protein TerC family

56

310

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xpt-assembly1.cif.gz_A x-ray structure of drosophila dopamine transporter with subsiteb mutations d121g/s426m and el2 deletion of 162-201 in complex with substrate analogue 3,4 dichlorophen ethylamine 0.2948 38 331
5m8k-assembly1.cif.gz_A crystal structure of eremococcus coleocola manganese transporter mutant e129q 0.28 38 342
1aep-assembly1.cif.gz_A molecular structure of an apolipoprotein determined at 2.5-angstroms resolution 0.2684 77 248
1aep-assembly1.cif.gz_A molecular structure of an apolipoprotein determined at 2.5-angstroms resolution 0.2631 77 248
5jdl-assembly1.cif.gz_A structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 1mm sr2+ 0.2626 1 330
ID Description Score Start End Superfamily
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5826 41 305 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5723 41 305 1.20.1250.20
af_A4I6F1_110_504_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.3694 37 331 1.20.1740.10
af_Q69YG0_38_145_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.3535 123 206 1.10.3730.20
af_A0A1D6L677_1_148_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3419 123 236 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A841L3W5-F1-model_v4 DUF475 domain-containing protein 0.9775 2 340 GO:0016020
AF-A0A364NVP6-F1-model_v4 DUF475 domain-containing protein 0.974 2 340 GO:0016020
AF-A0A0H3AMW7-F1-model_v4 Putative membrane protein 0.9737 33 344 GO:0016020
AF-A0A7W6G7K3-F1-model_v4 Integral membrane protein 0.9729 2 339 GO:0016020
AF-A0A178MAB8-F1-model_v4 DUF475 domain-containing protein 0.9725 2 341 GO:0016020

Feature Viewer

pLDDT pTM Quality
78.66 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map