F387912

General Info

Members Datasets Scaffolds Average Seq Length
287 169 574 323

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100059722|Ga0070665_1000597223
Length 352
Sequence MDTSKGKTARPSLFSTETPMGHSIALVTGTTSGLGYAAAGLLADKGYKQVIVTGRSLAGVQQTAAQLAAENKKKIFTPLELDLDSPSSVQSALAELVRRGQPIDFLLLNAGMVPGKKRVLTAAGVEETQAPLIGHHQLTVGLLRANLLSPNARIVIAGAEPARGGVPMFKYTDVPAFAAKYFRGDRTAAIEALIRNGPNVKYMPNNTYADAKLIVAWWVAALARRLPSGMAVYAVSPGASNATKVARNAGPLLKYLMIPIVNLIPGMNQTPETAARRFLQASEFGTDVSGQFFASAQGKFSGPIEVQLQPNLYDRASQEAAWQAVVKVSGVDFSPVRPASPSRTPITSATQP

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
36 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
37 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
40 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
41 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
42 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
63 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
66 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
71 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
101 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
151 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
152 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
153 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
154 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
155 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
156 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
157 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
158 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
159 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
160 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
161 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
162 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
163 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
164 2884411467 Dyella sp. AD56 Isolate Rhizosphere
165 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
166 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
167 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
168 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
169 8054795415 Paenibacillus periandrae PM10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.77
Metatranscriptomes 0.7
Isolates 4.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.45
Nodule 2.09
Rhizoplane 2.44
Rhizosphere 73.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100059722 3300005548 Bacteria 3822
2 LJNas_1001789 3300000546 Bacteria 2843
3 JGI25156J39149_1010215 3300002705 Bacteria 2221
4 JGI25162J39368_1001285 3300002737 Bacteria 14229
5 JGI25162J39368_1002398 3300002737 Bacteria 7360
6 JGI25154J39366_1001186 3300002738 Bacteria 9965
7 JGI25165J46597_1000085 3300003214 Bacteria 171345
8 JGI25165J46597_1003226 3300003214 Bacteria 4260
9 JGI25165J46597_1003609 3300003214 Bacteria 3741
10 Ga0055539_1000157 3300003752 Bacteria 65224
11 Ga0055533_1000024 3300003756 Bacteria 338067
12 Ga0055525_1000829 3300003759 Bacteria 9383
13 Ga0070658_10005983 3300005327 Bacteria 9861
14 Ga0070661_100202264 3300005344 Bacteria 1518
15 Ga0070667_100161314 3300005367 Bacteria 1975
16 Ga0070713_100053554 3300005436 Bacteria 3344
17 Ga0070706_100209024 3300005467 Bacteria 1822
18 Ga0070698_100153552 3300005471 Bacteria 2248
19 Ga0070699_100115662 3300005518 Bacteria 2357
20 Ga0068853_100012538 3300005539 Bacteria 6898
21 Ga0068853_100019533 3300005539 Bacteria 5619
22 Ga0068855_100321014 3300005563 Bacteria 1712
23 Ga0068857_100030416 3300005577 Bacteria 4768
24 Ga0068856_100002402 3300005614 Bacteria 19271
25 Ga0068856_100005877 3300005614 Bacteria 12099
26 Ga0070717_10235609 3300006028 Bacteria 1613
27 Ga0105240_10000797 3300009093 Bacteria 57090
28 Ga0105240_10005112 3300009093 Bacteria 19636
29 Ga0105240_10005594 3300009093 Bacteria 18671
30 Ga0105240_10020729 3300009093 Bacteria 8758
31 Ga0105240_10033274 3300009093 Bacteria 6664
32 Ga0105240_10272911 3300009093 Bacteria 1946
33 Ga0105240_10282476 3300009093 Bacteria 1906
34 Ga0105240_10429669 3300009093 Bacteria 1482
35 Ga0105245_10019101 3300009098 Bacteria 5999
36 Ga0105248_10002178 3300009177 Bacteria 21674
37 Ga0105248_10031385 3300009177 Bacteria 5939
38 Ga0105237_10129449 3300009545 Bacteria 2519
39 Ga0105238_10000348 3300009551 Bacteria 49784
40 Ga0105238_10007434 3300009551 Bacteria 10972
41 Ga0105238_10024184 3300009551 Bacteria 6193
42 Ga0105239_10001567 3300010375 Bacteria 30193
43 Ga0105239_10002244 3300010375 Eukaryota 24694
44 Ga0105239_10014615 3300010375 Bacteria 8709
45 Ga0157370_10000020 3300013104 Bacteria 166524
46 Ga0157370_10026255 3300013104 Bacteria 5754
47 Ga0157369_10005891 3300013105 Bacteria 14245
48 Ga0157369_10059062 3300013105 Bacteria 4137
49 Ga0157374_10155235 3300013296 Bacteria 2227
50 Ga0157378_10033234 3300013297 Bacteria 4558
51 Ga0163162_10074767 3300013306 Bacteria 3447
52 Ga0163161_10001180 3300017792 Bacteria 19620
53 Ga0213872_10000492 3300021361 Bacteria 31562
54 Ga0213872_10008195 3300021361 Bacteria 5066
55 Ga0213872_10010945 3300021361 Bacteria 4304
56 Ga0213872_10013041 3300021361 Bacteria 3896
57 Ga0213872_10018402 3300021361 Bacteria 3223
58 Ga0213872_10066220 3300021361 Bacteria 1631
59 Ga0213872_10068116 3300021361 Bacteria 1606
60 Ga0213871_10001420 3300021441 Bacteria 4006
61 Ga0209435_100084 3300025206 Bacteria 45248
62 Ga0209674_100007 3300025226 Bacteria 1077082
63 Ga0209674_100249 3300025226 Bacteria 45253
64 Ga0209563_100052 3300025230 Bacteria 334307
65 Ga0207427_100723 3300025231 Bacteria 15381
66 Ga0207427_100811 3300025231 Bacteria 14119
67 Ga0209437_100250 3300025233 Bacteria 85166
68 Ga0209646_1000052 3300025246 Bacteria 286370
69 Ga0209677_100015 3300025253 Bacteria 532137
70 Ga0209677_100787 3300025253 Bacteria 15939
71 Ga0209759_1000598 3300025256 Bacteria 34907
72 Ga0209233_1000078 3300025261 Bacteria 348118
73 Ga0209233_1000238 3300025261 Bacteria 92087
74 Ga0209233_1000585 3300025261 Bacteria 19266
75 Ga0209233_1017632 3300025261 Bacteria 1941
76 Ga0207426_1003719 3300025302 Bacteria 7970
77 Ga0207705_10007760 3300025909 Bacteria 7883
78 Ga0207705_10025301 3300025909 Bacteria 4239
79 Ga0207684_10304562 3300025910 Bacteria 1374
80 Ga0207654_10047609 3300025911 Bacteria 2450
81 Ga0207695_10000740 3300025913 Bacteria 63254
82 Ga0207695_10009496 3300025913 Bacteria 12029
83 Ga0207695_10015893 3300025913 Bacteria 8839
84 Ga0207695_10025162 3300025913 Bacteria 6674
85 Ga0207695_10139448 3300025913 Bacteria 2375
86 Ga0207671_10000323 3300025914 Bacteria 70179
87 Ga0207693_10341209 3300025915 Bacteria 1172
88 Ga0207663_10144427 3300025916 Bacteria 1662
89 Ga0207694_10000223 3300025924 Bacteria 55562
90 Ga0207694_10005328 3300025924 Bacteria 9911
91 Ga0207694_10013267 3300025924 Bacteria 6205
92 Ga0207700_10060323 3300025928 Bacteria 2873
93 Ga0207700_10188070 3300025928 Bacteria 1734
94 Ga0207711_10000428 3300025941 Bacteria 44126
95 Ga0207711_10018417 3300025941 Bacteria 5805
96 Ga0207667_10243818 3300025949 Bacteria 1839
97 Ga0207651_10382357 3300025960 Bacteria 1193
98 Ga0207658_10121301 3300025986 Bacteria 2085
99 Ga0207658_10231843 3300025986 Bacteria 1559
100 Ga0207639_10000005 3300026041 Bacteria 579948
101 Ga0207639_10117555 3300026041 Bacteria 2179
102 Ga0207702_10000613 3300026078 Bacteria 39378
103 Ga0207702_10001012 3300026078 Bacteria 28870
104 Ga0207674_10040254 3300026116 Bacteria 4842
105 Ga0265354_1000058 3300028016 Bacteria 18370
106 Ga0265356_1003310 3300028017 Bacteria 2046
107 Ga0268266_10000051 3300028379 Bacteria 296231
108 Ga0268266_10043677 3300028379 Bacteria 3831
109 Ga0265334_10013900 3300028573 Bacteria 3363
110 Ga0265318_10000170 3300028577 Bacteria 57549
111 Ga0265318_10003713 3300028577 Bacteria 7620
112 Ga0265338_10009522 3300028800 Bacteria 11569
113 Ga0265770_1000543 3300030878 Bacteria 5235
114 Ga0265760_10057654 3300031090 Bacteria 1176
115 Ga0265330_10004391 3300031235 Bacteria 7162
116 Ga0265332_10000249 3300031238 Bacteria 43066
117 Ga0265332_10001684 3300031238 Bacteria 12079
118 Ga0265332_10006115 3300031238 Bacteria 5496
119 Ga0265320_10000005 3300031240 Bacteria 354422
120 Ga0265320_10012905 3300031240 Bacteria 4831
121 Ga0265325_10033026 3300031241 Bacteria 2760
122 Ga0265329_10003207 3300031242 Bacteria 7177
123 Ga0265340_10023551 3300031247 Bacteria 3138
124 Ga0265339_10029413 3300031249 Bacteria 3117
125 Ga0265339_10031138 3300031249 Bacteria 3016
126 Ga0265339_10074868 3300031249 Bacteria 1798
127 Ga0265331_10000013 3300031250 Bacteria 296011
128 Ga0265331_10010973 3300031250 Bacteria 4975
129 Ga0265331_10012079 3300031250 Bacteria 4698
130 Ga0265316_10002234 3300031344 Bacteria 20313
131 Ga0265316_10011048 3300031344 Bacteria 8181
132 Ga0265316_10100316 3300031344 Bacteria 2201
133 Ga0307408_100004262 3300031548 Bacteria 9731
134 Ga0265313_10000809 3300031595 Bacteria 31583
135 Ga0265313_10001044 3300031595 Bacteria 26985
136 Ga0265313_10001117 3300031595 Bacteria 25638
137 Ga0265314_10000024 3300031711 Bacteria 295216
138 Ga0265314_10000783 3300031711 Bacteria 37761
139 Ga0265314_10010789 3300031711 Bacteria 7595
140 Ga0265314_10023200 3300031711 Bacteria 4737
141 Ga0265314_10044586 3300031711 Bacteria 3143
142 Ga0265314_10055612 3300031711 Bacteria 2730
143 Ga0265342_10000526 3300031712 Bacteria 40764
144 Ga0265342_10009962 3300031712 Bacteria 6642
145 Ga0265342_10096941 3300031712 Bacteria 1684
146 Ga0307412_10031212 3300031911 Bacteria 3363
147 Ga0373933_0003918 3300035724 Bacteria 8210
148 Ga0373937_0024094 3300036401 Bacteria 5488
149 Ga0395905_0183417 3300037471 Bacteria 1965
150 Ga0436364_0020018 3300037853 Bacteria 1604
151 Ga0436364_0022916 3300037853 Bacteria 1083
152 Ga0395901_0167688 3300038443 Bacteria 2305
153 Ga0436365_0421313 3300039437 Bacteria 5115
154 Ga0436365_0461739 3300039437 Bacteria 1282
155 Ga0436365_1650137 3300039437 Bacteria 30374
156 Ga0436365_1874221 3300039437 Bacteria 9019
157 Ga0436360_0059249 3300039438 Bacteria 1196
158 Ga0436360_0468644 3300039438 Bacteria 1150
159 Ga0436360_0803820 3300039438 Bacteria 3994
160 Ga0436361_0057579 3300039447 Bacteria 5132
161 Ga0436361_0076715 3300039447 Bacteria 40178
162 Ga0436361_0114798 3300039447 Bacteria 5330
163 Ga0436361_0262992 3300039447 Bacteria 3835
164 Ga0436361_0391859 3300039447 Bacteria 3855
165 Ga0436361_0403583 3300039447 Bacteria 1918
166 Ga0436361_0678187 3300039447 Bacteria 1641
167 Ga0436361_0800894 3300039447 Bacteria 6019
168 Ga0436361_0825267 3300039447 Bacteria 2660
169 Ga0436361_0960717 3300039447 Bacteria 3010
170 Ga0436361_1078378 3300039447 Bacteria 4320
171 Ga0436361_1099612 3300039447 Bacteria 5221
172 Ga0436361_1184839 3300039447 Bacteria 3611
173 Ga0495603_0207089 3300046455 Bacteria 1133
174 Ga0495629_0013838 3300046459 Bacteria 5821
175 Ga0495651_0009470 3300046462 Bacteria 7479
176 Ga0495651_0049741 3300046462 Bacteria 3236
177 Ga0495653_0000627 3300046463 Bacteria 26951
178 Ga0495653_0007681 3300046463 Bacteria 8826
179 Ga0495580_0050408 3300046472 Bacteria 2944
180 Ga0495582_0016579 3300046473 Bacteria 4033
181 Ga0495662_0029499 3300046476 Bacteria 2649
182 Ga0495664_0000252 3300046477 Bacteria 25891
183 Ga0495664_0013929 3300046477 Bacteria 4556
184 Ga0495594_0002616 3300046499 Bacteria 9353
185 Ga0495607_0000038 3300046501 Bacteria 134124
186 Ga0495606_0000245 3300046507 Bacteria 95825
187 Ga0495606_0000813 3300046507 Bacteria 47485
188 Ga0495606_0065903 3300046507 Bacteria 2299
189 Ga0495606_0103353 3300046507 Bacteria 1730
190 Ga0495620_0000177 3300046515 Bacteria 49884
191 Ga0495628_0007524 3300046516 Bacteria 9423
192 Ga0495628_0035969 3300046516 Bacteria 3977
193 Ga0495630_0270127 3300046517 Bacteria 1299
194 Ga0495666_0004147 3300046526 Bacteria 7308
195 Ga0495652_0011653 3300046529 Bacteria 7947
196 Ga0495652_0020839 3300046529 Bacteria 5825
197 Ga0495665_0000205 3300046531 Bacteria 30190
198 Ga0495665_0001575 3300046531 Bacteria 12194
199 Ga0495640_0030751 3300046533 Bacteria 3840
200 Ga0495587_0022108 3300046536 Bacteria 3918
201 Ga0495645_0018831 3300046543 Bacteria 4966
202 Ga0495622_0029003 3300046557 Bacteria 2586
203 Ga0495667_0003936 3300046559 Bacteria 9955
204 Ga0495667_0104390 3300046559 Bacteria 1832
205 Ga0495634_0022807 3300046642 Bacteria 4409
206 Ga0495625_0003588 3300046660 Bacteria 15277
207 Ga0495625_0021615 3300046660 Bacteria 4949
208 Ga0495635_0002538 3300046663 Bacteria 12494
209 Ga0495635_0035214 3300046663 Bacteria 3471
210 Ga0495599_0003433 3300046678 Bacteria 9272
211 Ga0495599_0026553 3300046678 Bacteria 3629
212 Ga0495623_0011345 3300046679 Bacteria 5765
213 Ga0495623_0089326 3300046679 Bacteria 1894
214 Ga0495646_0004312 3300046680 Bacteria 8965
215 Ga0495646_0075778 3300046680 Bacteria 1971
216 Ga0495624_0000868 3300046690 Bacteria 23979
217 Ga0495624_0006260 3300046690 Bacteria 8466
218 Ga0495600_0015549 3300046809 Bacteria 4814
219 Ga0495581_0012391 3300047315 Bacteria 4939
220 Ga0495604_0063815 3300047317 Bacteria 2808
221 Ga0495604_0267916 3300047317 Bacteria 1158
222 Ga0495674_0000616 3300047319 Bacteria 33302
223 Ga0495674_0240884 3300047319 Bacteria 1490
224 Ga0495676_0007018 3300047321 Bacteria 10336
225 Ga0495680_0001763 3300047322 Bacteria 22936
226 Ga0495680_0110220 3300047322 Bacteria 2040
227 Ga0495675_0028433 3300047444 Bacteria 3563
228 Ga0495675_0038358 3300047444 Bacteria 3050
229 Ga0495675_0041765 3300047444 Bacteria 2922
230 Ga0495673_0000151 3300047469 Bacteria 122181
231 Ga0495684_0023080 3300047471 Bacteria 4785
232 Ga0495686_0000037 3300047472 Bacteria 307937
233 Ga0495686_0008434 3300047472 Bacteria 7557
234 Ga0495593_0000051 3300047673 Bacteria 47877
235 Ga0495602_0000105 3300048088 Bacteria 80480
236 Ga0495614_0003412 3300048089 Bacteria 7108
237 Ga0496102_0560021 3300048905 Bacteria 1066
238 Ga0496105_0002399 3300048908 Bacteria 13560
239 Ga0496105_0149004 3300048908 Bacteria 1924
240 Ga0496106_0031871 3300048909 Bacteria 3928
241 Ga0496107_0256576 3300048910 Bacteria 1301
242 Ga0496114_0004128 3300048917 Bacteria 11237
243 Ga0496117_0000229 3300048920 Bacteria 105861
244 Ga0496117_0003315 3300048920 Bacteria 18814
245 Ga0496118_0000016 3300048921 Bacteria 549586
246 Ga0496119_0000446 3300048922 Bacteria 56404
247 Ga0496119_0017087 3300048922 Bacteria 5483
248 Ga0496119_0084586 3300048922 Bacteria 1818
249 Ga0496120_0068353 3300048923 Bacteria 1960
250 Ga0496120_0075569 3300048923 Bacteria 1838
251 Ga0496121_0006623 3300048924 Bacteria 14270
252 Ga0496121_0019441 3300048924 Bacteria 6791
253 Ga0496121_0085593 3300048924 Bacteria 2481
254 Ga0496121_0125093 3300048924 Bacteria 1934
255 Ga0496121_0259398 3300048924 Bacteria 1201
256 Ga0496124_0106831 3300048927 Bacteria 2259
257 Ga0496125_0007077 3300048928 Bacteria 11979
258 Ga0496126_0005321 3300048929 Bacteria 14767
259 Ga0496126_0023919 3300048929 Bacteria 5908
260 Ga0496126_0093932 3300048929 Bacteria 2633
261 Ga0496126_0105914 3300048929 Bacteria 2454
262 Ga0496126_0124475 3300048929 Bacteria 2232
263 Ga0495601_0191546 3300053077 Bacteria 1336
264 Ga0495595_0061045 3300053084 Bacteria 1765
265 Ga0495619_0043702 3300053085 Bacteria 2939
266 Ga0500651_0106235 3300053093 Bacteria 1717
267 Ga0500566_0009342 3300053094 Bacteria 5798
268 Ga0500572_000854 3300053111 Bacteria 9497
269 Ga0500595_031657 3300053119 Bacteria 1772
270 Ga0500559_0000186 3300053136 Bacteria 49470
271 Ga0500559_0000430 3300053136 Bacteria 29706
272 Ga0500639_006766 3300053163 Bacteria 5928
273 Ga0500636_0009304 3300053177 Bacteria 5705
274 Ga0500596_000652 3300053735 Bacteria 6713
275 2514036230 2513237164 Bacteria 7563725
276 2587728324 2585428057 Bacteria 6737412
277 2671117223 2667528174 Bacteria 6435400
278 2842326991 2842324504 Bacteria 9364110
279 2842350596 2842348783 Bacteria 9002918
280 2842456663 2842454564 Bacteria 8730687
281 2884415814 2884411467 Bacteria 5246714
282 2958065371 2958064165 Bacteria 7158582
283 3005716552 3005710791 Bacteria 7622528
284 8018846036 8018845410 Bacteria 8933938
285 8046768835 8046767195 Bacteria 7547379
286 8054799619 8054795415 Bacteria 9785225
287 8054802237 8054795415 Bacteria 9785225
288 Ga0070665_100059722
289 LJNas_1001789
290 JGI25156J39149_1010215
291 JGI25162J39368_1001285
292 JGI25162J39368_1002398
293 JGI25154J39366_1001186
294 JGI25165J46597_1000085
295 JGI25165J46597_1003226
296 JGI25165J46597_1003609
297 Ga0055539_1000157
298 Ga0055533_1000024
299 Ga0055525_1000829
300 Ga0070658_10005983
301 Ga0070661_100202264
302 Ga0070667_100161314
303 Ga0070713_100053554
304 Ga0070706_100209024
305 Ga0070698_100153552
306 Ga0070699_100115662
307 Ga0068853_100012538
308 Ga0068853_100019533
309 Ga0068855_100321014
310 Ga0068857_100030416
311 Ga0068856_100002402
312 Ga0068856_100005877
313 Ga0070717_10235609
314 Ga0105240_10000797
315 Ga0105240_10005112
316 Ga0105240_10005594
317 Ga0105240_10020729
318 Ga0105240_10033274
319 Ga0105240_10272911
320 Ga0105240_10282476
321 Ga0105240_10429669
322 Ga0105245_10019101
323 Ga0105248_10002178
324 Ga0105248_10031385
325 Ga0105237_10129449
326 Ga0105238_10000348
327 Ga0105238_10007434
328 Ga0105238_10024184
329 Ga0105239_10001567
330 Ga0105239_10002244
331 Ga0105239_10014615
332 Ga0157370_10000020
333 Ga0157370_10026255
334 Ga0157369_10005891
335 Ga0157369_10059062
336 Ga0157374_10155235
337 Ga0157378_10033234
338 Ga0163162_10074767
339 Ga0163161_10001180
340 Ga0213872_10000492
341 Ga0213872_10008195
342 Ga0213872_10010945
343 Ga0213872_10013041
344 Ga0213872_10018402
345 Ga0213872_10066220
346 Ga0213872_10068116
347 Ga0213871_10001420
348 Ga0209435_100084
349 Ga0209674_100007
350 Ga0209674_100249
351 Ga0209563_100052
352 Ga0207427_100723
353 Ga0207427_100811
354 Ga0209437_100250
355 Ga0209646_1000052
356 Ga0209677_100015
357 Ga0209677_100787
358 Ga0209759_1000598
359 Ga0209233_1000078
360 Ga0209233_1000238
361 Ga0209233_1000585
362 Ga0209233_1017632
363 Ga0207426_1003719
364 Ga0207705_10007760
365 Ga0207705_10025301
366 Ga0207684_10304562
367 Ga0207654_10047609
368 Ga0207695_10000740
369 Ga0207695_10009496
370 Ga0207695_10015893
371 Ga0207695_10025162
372 Ga0207695_10139448
373 Ga0207671_10000323
374 Ga0207693_10341209
375 Ga0207663_10144427
376 Ga0207694_10000223
377 Ga0207694_10005328
378 Ga0207694_10013267
379 Ga0207700_10060323
380 Ga0207700_10188070
381 Ga0207711_10000428
382 Ga0207711_10018417
383 Ga0207667_10243818
384 Ga0207651_10382357
385 Ga0207658_10121301
386 Ga0207658_10231843
387 Ga0207639_10000005
388 Ga0207639_10117555
389 Ga0207702_10000613
390 Ga0207702_10001012
391 Ga0207674_10040254
392 Ga0265354_1000058
393 Ga0265356_1003310
394 Ga0268266_10000051
395 Ga0268266_10043677
396 Ga0265334_10013900
397 Ga0265318_10000170
398 Ga0265318_10003713
399 Ga0265338_10009522
400 Ga0265770_1000543
401 Ga0265760_10057654
402 Ga0265330_10004391
403 Ga0265332_10000249
404 Ga0265332_10001684
405 Ga0265332_10006115
406 Ga0265320_10000005
407 Ga0265320_10012905
408 Ga0265325_10033026
409 Ga0265329_10003207
410 Ga0265340_10023551
411 Ga0265339_10029413
412 Ga0265339_10031138
413 Ga0265339_10074868
414 Ga0265331_10000013
415 Ga0265331_10010973
416 Ga0265331_10012079
417 Ga0265316_10002234
418 Ga0265316_10011048
419 Ga0265316_10100316
420 Ga0307408_100004262
421 Ga0265313_10000809
422 Ga0265313_10001044
423 Ga0265313_10001117
424 Ga0265314_10000024
425 Ga0265314_10000783
426 Ga0265314_10010789
427 Ga0265314_10023200
428 Ga0265314_10044586
429 Ga0265314_10055612
430 Ga0265342_10000526
431 Ga0265342_10009962
432 Ga0265342_10096941
433 Ga0307412_10031212
434 Ga0373933_0003918
435 Ga0373937_0024094
436 Ga0395905_0183417
437 Ga0436364_0020018
438 Ga0436364_0022916
439 Ga0395901_0167688
440 Ga0436365_0421313
441 Ga0436365_0461739
442 Ga0436365_1650137
443 Ga0436365_1874221
444 Ga0436360_0059249
445 Ga0436360_0468644
446 Ga0436360_0803820
447 Ga0436361_0057579
448 Ga0436361_0076715
449 Ga0436361_0114798
450 Ga0436361_0262992
451 Ga0436361_0391859
452 Ga0436361_0403583
453 Ga0436361_0678187
454 Ga0436361_0800894
455 Ga0436361_0825267
456 Ga0436361_0960717
457 Ga0436361_1078378
458 Ga0436361_1099612
459 Ga0436361_1184839
460 Ga0495603_0207089
461 Ga0495629_0013838
462 Ga0495651_0009470
463 Ga0495651_0049741
464 Ga0495653_0000627
465 Ga0495653_0007681
466 Ga0495580_0050408
467 Ga0495582_0016579
468 Ga0495662_0029499
469 Ga0495664_0000252
470 Ga0495664_0013929
471 Ga0495594_0002616
472 Ga0495607_0000038
473 Ga0495606_0000245
474 Ga0495606_0000813
475 Ga0495606_0065903
476 Ga0495606_0103353
477 Ga0495620_0000177
478 Ga0495628_0007524
479 Ga0495628_0035969
480 Ga0495630_0270127
481 Ga0495666_0004147
482 Ga0495652_0011653
483 Ga0495652_0020839
484 Ga0495665_0000205
485 Ga0495665_0001575
486 Ga0495640_0030751
487 Ga0495587_0022108
488 Ga0495645_0018831
489 Ga0495622_0029003
490 Ga0495667_0003936
491 Ga0495667_0104390
492 Ga0495634_0022807
493 Ga0495625_0003588
494 Ga0495625_0021615
495 Ga0495635_0002538
496 Ga0495635_0035214
497 Ga0495599_0003433
498 Ga0495599_0026553
499 Ga0495623_0011345
500 Ga0495623_0089326
501 Ga0495646_0004312
502 Ga0495646_0075778
503 Ga0495624_0000868
504 Ga0495624_0006260
505 Ga0495600_0015549
506 Ga0495581_0012391
507 Ga0495604_0063815
508 Ga0495604_0267916
509 Ga0495674_0000616
510 Ga0495674_0240884
511 Ga0495676_0007018
512 Ga0495680_0001763
513 Ga0495680_0110220
514 Ga0495675_0028433
515 Ga0495675_0038358
516 Ga0495675_0041765
517 Ga0495673_0000151
518 Ga0495684_0023080
519 Ga0495686_0000037
520 Ga0495686_0008434
521 Ga0495593_0000051
522 Ga0495602_0000105
523 Ga0495614_0003412
524 Ga0496102_0560021
525 Ga0496105_0002399
526 Ga0496105_0149004
527 Ga0496106_0031871
528 Ga0496107_0256576
529 Ga0496114_0004128
530 Ga0496117_0000229
531 Ga0496117_0003315
532 Ga0496118_0000016
533 Ga0496119_0000446
534 Ga0496119_0017087
535 Ga0496119_0084586
536 Ga0496120_0068353
537 Ga0496120_0075569
538 Ga0496121_0006623
539 Ga0496121_0019441
540 Ga0496121_0085593
541 Ga0496121_0125093
542 Ga0496121_0259398
543 Ga0496124_0106831
544 Ga0496125_0007077
545 Ga0496126_0005321
546 Ga0496126_0023919
547 Ga0496126_0093932
548 Ga0496126_0105914
549 Ga0496126_0124475
550 Ga0495601_0191546
551 Ga0495595_0061045
552 Ga0495619_0043702
553 Ga0500651_0106235
554 Ga0500566_0009342
555 Ga0500572_000854
556 Ga0500595_031657
557 Ga0500559_0000186
558 Ga0500559_0000430
559 Ga0500639_006766
560 Ga0500636_0009304
561 Ga0500596_000652
562 2514036230
563 2587728324
564 2671117223
565 2842326991
566 2842350596
567 2842456663
568 2884415814
569 2958065371
570 3005716552
571 8018846036
572 8046768835
573 8054799619
574 8054802237

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

29

170

0.88

PF00106

adh_short

short chain dehydrogenase

23

169

0.83

PF08659

KR

KR domain

23

132

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.8386 7 318
2p68-assembly1.cif.gz_B-2 crystal structure of aq_1716 from aquifex aeolicus vf5 0.8077 7 276
6l1h-assembly2.cif.gz_B crystal structure of light-dependent protochlorophyllide oxidoreductase from thermosynechococcus elongatus 0.8058 6 315
7jk9-assembly1.cif.gz_A helical filaments of plant light-dependent protochlorophyllide oxidoreductase (lpor) bound to nadph, pchlide, and membrane 0.805 4 316
3guc-assembly1.cif.gz_B human ubiquitin-activating enzyme 5 in complex with amppnp 0.8042 3 91
ID Description Score Start End Superfamily
af_A0A1D6F4K7_21_149_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9073 6 90 3.40.50.720
af_A0A0P0WC51_15_133_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9048 5 90 3.40.50.720
af_A0A368UI72_22_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9046 7 79 3.40.50.720
af_A0A1D6Q5V8_5_224_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8723 2 94 3.40.50.720
af_A0A0R0IJI3_1_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8707 9 90 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A523F2V1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9671 7 314
AF-A0A6C7EC77-F1-model_v4 Putative oxidoreductase 0.9489 5 317 GO:0016491
AF-A0A523F2V1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9344 7 314
AF-A0A6C7EC77-F1-model_v4 Putative oxidoreductase 0.9316 5 317 GO:0016491
AF-A0A7X7D8S7-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9246 7 138 GO:0016491

Map