F387839
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 287 | 189 | 287 | 96 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100718802|Ga0068868_1007188022 |
| Length | 116 |
| Sequence | MRGAFSFSGPDWPPRHPTSIAAMIDRDQVLHVARLARLRLSDEEIDNMSRELSSVLDHIEKISELDLSNVEPTSHVVAVENVLRPDEPRPSWPKERVLESAPDSSHGGFRVPTPGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 2 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 50 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 124 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 125 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 127 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 128 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 129 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 130 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 131 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 132 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 134 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 135 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 136 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 137 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 138 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 139 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 140 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 141 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 142 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 143 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 157 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 158 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 159 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 160 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 161 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 162 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 165 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 166 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 167 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 168 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 169 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 179 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 180 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.74 |
| Nodule | 0 |
| Rhizoplane | 8.71 |
| Rhizosphere | 89.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24745J21846_1017501 | 3300002073 | Bacteria | 834 |
| 2 | JGI24749J21850_1079703 | 3300002076 | Bacteria | 513 |
| 3 | JGI24744J21845_10085623 | 3300002077 | Bacteria | 577 |
| 4 | Ga0070658_10399021 | 3300005327 | Bacteria | 1181 |
| 5 | Ga0070683_100017579 | 3300005329 | Bacteria | 6321 |
| 6 | Ga0070683_100897528 | 3300005329 | Bacteria | 850 |
| 7 | Ga0070690_101150223 | 3300005330 | Bacteria | 617 |
| 8 | Ga0070670_100212136 | 3300005331 | Bacteria | 1684 |
| 9 | Ga0070682_100001883 | 3300005337 | Bacteria | 11719 |
| 10 | Ga0068868_100018909 | 3300005338 | Bacteria | 5156 |
| 11 | Ga0068868_100718802 | 3300005338 | Bacteria | 895 |
| 12 | Ga0070660_101490488 | 3300005339 | Bacteria | 575 |
| 13 | Ga0070689_100643348 | 3300005340 | Bacteria | 922 |
| 14 | Ga0070689_100946969 | 3300005340 | Bacteria | 764 |
| 15 | Ga0070691_10068952 | 3300005341 | Bacteria | 1713 |
| 16 | Ga0070691_10735835 | 3300005341 | Bacteria | 595 |
| 17 | Ga0070661_100124990 | 3300005344 | Bacteria | 1929 |
| 18 | Ga0070692_10476426 | 3300005345 | Bacteria | 804 |
| 19 | Ga0070692_10519503 | 3300005345 | Bacteria | 775 |
| 20 | Ga0070668_100137426 | 3300005347 | Bacteria | 1967 |
| 21 | Ga0070668_100338439 | 3300005347 | Bacteria | 1271 |
| 22 | Ga0070668_100445582 | 3300005347 | Bacteria | 1112 |
| 23 | Ga0070675_100272664 | 3300005354 | Bacteria | 1485 |
| 24 | Ga0070675_102102181 | 3300005354 | Unclassified | 520 |
| 25 | Ga0070674_100226676 | 3300005356 | Bacteria | 1456 |
| 26 | Ga0070674_100730776 | 3300005356 | Bacteria | 849 |
| 27 | Ga0070673_100086323 | 3300005364 | Bacteria | 2557 |
| 28 | Ga0070688_100089185 | 3300005365 | Bacteria | 2012 |
| 29 | Ga0070688_100571700 | 3300005365 | Bacteria | 862 |
| 30 | Ga0070659_100934898 | 3300005366 | Bacteria | 759 |
| 31 | Ga0070714_101222992 | 3300005435 | Bacteria | 733 |
| 32 | Ga0070710_10059449 | 3300005437 | Bacteria | 2171 |
| 33 | Ga0070711_100018337 | 3300005439 | Bacteria | 4466 |
| 34 | Ga0070711_101136571 | 3300005439 | Bacteria | 674 |
| 35 | Ga0070711_101438916 | 3300005439 | Bacteria | 600 |
| 36 | Ga0070705_100142921 | 3300005440 | Bacteria | 1577 |
| 37 | Ga0070700_100066992 | 3300005441 | Bacteria | 2280 |
| 38 | Ga0070694_100121921 | 3300005444 | Bacteria | 1872 |
| 39 | Ga0070678_100057118 | 3300005456 | Bacteria | 2857 |
| 40 | Ga0070662_100528825 | 3300005457 | Bacteria | 986 |
| 41 | Ga0068867_100123730 | 3300005459 | Bacteria | 2002 |
| 42 | Ga0068867_101592943 | 3300005459 | Unclassified | 610 |
| 43 | Ga0068867_102380855 | 3300005459 | Bacteria | 504 |
| 44 | Ga0070685_10910843 | 3300005466 | Unclassified | 655 |
| 45 | Ga0070706_101428272 | 3300005467 | Bacteria | 633 |
| 46 | Ga0070706_101737030 | 3300005467 | Unclassified | 568 |
| 47 | Ga0070699_100607284 | 3300005518 | Bacteria | 998 |
| 48 | Ga0070684_100004775 | 3300005535 | Bacteria | 10352 |
| 49 | Ga0068853_100127390 | 3300005539 | Bacteria | 2276 |
| 50 | Ga0070686_101661426 | 3300005544 | Unclassified | 541 |
| 51 | Ga0070695_100159954 | 3300005545 | Bacteria | 1580 |
| 52 | Ga0070704_102185246 | 3300005549 | Bacteria | 515 |
| 53 | Ga0068855_100418408 | 3300005563 | Bacteria | 1466 |
| 54 | Ga0070664_100309724 | 3300005564 | Bacteria | 1428 |
| 55 | Ga0068857_100495521 | 3300005577 | Bacteria | 1146 |
| 56 | Ga0068856_100014289 | 3300005614 | Bacteria | 7678 |
| 57 | Ga0070702_100175146 | 3300005615 | Bacteria | 1399 |
| 58 | Ga0068852_100156657 | 3300005616 | Bacteria | 2122 |
| 59 | Ga0068864_100007268 | 3300005618 | Bacteria | 9107 |
| 60 | Ga0068861_100157871 | 3300005719 | Bacteria | 1868 |
| 61 | Ga0068861_100524617 | 3300005719 | Bacteria | 1075 |
| 62 | Ga0068861_100691226 | 3300005719 | Bacteria | 947 |
| 63 | Ga0068858_100818528 | 3300005842 | Bacteria | 909 |
| 64 | Ga0068860_101320687 | 3300005843 | Bacteria | 742 |
| 65 | Ga0075365_10005759 | 3300006038 | Bacteria | 6726 |
| 66 | Ga0075365_11124033 | 3300006038 | Bacteria | 553 |
| 67 | Ga0075364_10320210 | 3300006051 | Bacteria | 1056 |
| 68 | Ga0075432_10090437 | 3300006058 | Bacteria | 1120 |
| 69 | Ga0070715_10431776 | 3300006163 | Bacteria | 739 |
| 70 | Ga0070716_101027757 | 3300006173 | Bacteria | 653 |
| 71 | Ga0070712_100000050 | 3300006175 | Bacteria | 63870 |
| 72 | Ga0070712_100041267 | 3300006175 | Bacteria | 3168 |
| 73 | Ga0068871_100335519 | 3300006358 | Bacteria | 1334 |
| 74 | Ga0075428_100120631 | 3300006844 | Bacteria | 2855 |
| 75 | Ga0075430_100098260 | 3300006846 | Bacteria | 2446 |
| 76 | Ga0075430_100487050 | 3300006846 | Bacteria | 1018 |
| 77 | Ga0075431_100010449 | 3300006847 | Bacteria | 9333 |
| 78 | Ga0075431_100737949 | 3300006847 | Bacteria | 961 |
| 79 | Ga0075433_10855908 | 3300006852 | Bacteria | 794 |
| 80 | Ga0075434_100005013 | 3300006871 | Bacteria | 12021 |
| 81 | Ga0075434_101155992 | 3300006871 | Bacteria | 787 |
| 82 | Ga0075429_100002784 | 3300006880 | Bacteria | 14782 |
| 83 | Ga0068865_100162298 | 3300006881 | Bacteria | 1706 |
| 84 | Ga0068865_101454522 | 3300006881 | Bacteria | 613 |
| 85 | Ga0075436_100045428 | 3300006914 | Bacteria | 3030 |
| 86 | Ga0075435_100446187 | 3300007076 | Bacteria | 1115 |
| 87 | Ga0111539_10011916 | 3300009094 | Bacteria | 10899 |
| 88 | Ga0111539_10674497 | 3300009094 | Bacteria | 1203 |
| 89 | Ga0105245_10016242 | 3300009098 | Bacteria | 6489 |
| 90 | Ga0105245_11118735 | 3300009098 | Bacteria | 834 |
| 91 | Ga0114129_10003763 | 3300009147 | Bacteria | 21387 |
| 92 | Ga0114129_10252855 | 3300009147 | Bacteria | 2365 |
| 93 | Ga0114129_10579990 | 3300009147 | Bacteria | 1455 |
| 94 | Ga0114129_10673303 | 3300009147 | Unclassified | 1333 |
| 95 | Ga0105243_10021911 | 3300009148 | Bacteria | 4852 |
| 96 | Ga0105243_10038425 | 3300009148 | Bacteria | 3728 |
| 97 | Ga0105243_10278439 | 3300009148 | Bacteria | 1506 |
| 98 | Ga0105243_10568880 | 3300009148 | Bacteria | 1086 |
| 99 | Ga0105243_10602135 | 3300009148 | Bacteria | 1058 |
| 100 | Ga0105243_11215969 | 3300009148 | Bacteria | 767 |
| 101 | Ga0105243_13002947 | 3300009148 | Unclassified | 512 |
| 102 | Ga0105242_10162020 | 3300009176 | Bacteria | 1959 |
| 103 | Ga0105242_10307056 | 3300009176 | Bacteria | 1450 |
| 104 | Ga0105242_11601424 | 3300009176 | Bacteria | 685 |
| 105 | Ga0105248_10267863 | 3300009177 | Bacteria | 1923 |
| 106 | Ga0105248_12090450 | 3300009177 | Bacteria | 644 |
| 107 | Ga0105249_10392548 | 3300009553 | Bacteria | 1416 |
| 108 | Ga0105249_10523790 | 3300009553 | Bacteria | 1233 |
| 109 | Ga0105239_10505599 | 3300010375 | Bacteria | 1374 |
| 110 | Ga0105239_10924381 | 3300010375 | Bacteria | 1002 |
| 111 | Ga0105239_11590588 | 3300010375 | Bacteria | 756 |
| 112 | Ga0105239_12236062 | 3300010375 | Bacteria | 636 |
| 113 | Ga0105246_10027744 | 3300011119 | Bacteria | 3714 |
| 114 | Ga0105246_10544985 | 3300011119 | Bacteria | 993 |
| 115 | Ga0105246_12176309 | 3300011119 | Unclassified | 539 |
| 116 | Ga0157374_10039021 | 3300013296 | Bacteria | 4369 |
| 117 | Ga0157378_10270849 | 3300013297 | Bacteria | 1633 |
| 118 | Ga0157378_12277820 | 3300013297 | Bacteria | 593 |
| 119 | Ga0163162_10234231 | 3300013306 | Bacteria | 1967 |
| 120 | Ga0163162_10257020 | 3300013306 | Bacteria | 1878 |
| 121 | Ga0163162_10332932 | 3300013306 | Bacteria | 1651 |
| 122 | Ga0163162_10778976 | 3300013306 | Bacteria | 1075 |
| 123 | Ga0157372_10023795 | 3300013307 | Bacteria | 6645 |
| 124 | Ga0157375_11690695 | 3300013308 | Bacteria | 749 |
| 125 | Ga0163163_10076731 | 3300014325 | Bacteria | 3337 |
| 126 | Ga0163163_10162900 | 3300014325 | Bacteria | 2276 |
| 127 | Ga0157380_10351661 | 3300014326 | Bacteria | 1379 |
| 128 | Ga0157380_10380368 | 3300014326 | Bacteria | 1332 |
| 129 | Ga0182008_10503892 | 3300014497 | Unclassified | 666 |
| 130 | Ga0157379_10375836 | 3300014968 | Bacteria | 1303 |
| 131 | Ga0157376_10068481 | 3300014969 | Bacteria | 3006 |
| 132 | Ga0157376_10549831 | 3300014969 | Bacteria | 1142 |
| 133 | Ga0163161_10396491 | 3300017792 | Bacteria | 1106 |
| 134 | Ga0207692_10042755 | 3300025898 | Bacteria | 2251 |
| 135 | Ga0207688_10004983 | 3300025901 | Bacteria | 7227 |
| 136 | Ga0207705_10335341 | 3300025909 | Bacteria | 1164 |
| 137 | Ga0207684_11242181 | 3300025910 | Bacteria | 615 |
| 138 | Ga0207693_10000151 | 3300025915 | Bacteria | 64033 |
| 139 | Ga0207693_10008782 | 3300025915 | Bacteria | 8259 |
| 140 | Ga0207663_10200493 | 3300025916 | Bacteria | 1439 |
| 141 | Ga0207660_10873526 | 3300025917 | Archaea | 734 |
| 142 | Ga0207657_10434362 | 3300025919 | Bacteria | 1031 |
| 143 | Ga0207649_10279978 | 3300025920 | Bacteria | 1212 |
| 144 | Ga0207650_10274644 | 3300025925 | Bacteria | 1371 |
| 145 | Ga0207659_11108608 | 3300025926 | Bacteria | 681 |
| 146 | Ga0207659_11741244 | 3300025926 | Bacteria | 530 |
| 147 | Ga0207687_10014607 | 3300025927 | Bacteria | 5140 |
| 148 | Ga0207687_10938342 | 3300025927 | Unclassified | 741 |
| 149 | Ga0207687_11655716 | 3300025927 | Unclassified | 549 |
| 150 | Ga0207644_10194912 | 3300025931 | Bacteria | 1595 |
| 151 | Ga0207690_11298501 | 3300025932 | Bacteria | 608 |
| 152 | Ga0207706_10175192 | 3300025933 | Bacteria | 1884 |
| 153 | Ga0207706_10391451 | 3300025933 | Bacteria | 1205 |
| 154 | Ga0207709_10359827 | 3300025935 | Bacteria | 1101 |
| 155 | Ga0207709_10621673 | 3300025935 | Bacteria | 857 |
| 156 | Ga0207709_11175292 | 3300025935 | Bacteria | 632 |
| 157 | Ga0207670_10190102 | 3300025936 | Bacteria | 1553 |
| 158 | Ga0207669_10032858 | 3300025937 | Bacteria | 2920 |
| 159 | Ga0207704_10660075 | 3300025938 | Bacteria | 862 |
| 160 | Ga0207665_11033665 | 3300025939 | Bacteria | 654 |
| 161 | Ga0207711_10473781 | 3300025941 | Bacteria | 1166 |
| 162 | Ga0207661_10874578 | 3300025944 | Bacteria | 828 |
| 163 | Ga0207661_10917918 | 3300025944 | Bacteria | 806 |
| 164 | Ga0207679_11279765 | 3300025945 | Bacteria | 673 |
| 165 | Ga0207651_10062847 | 3300025960 | Bacteria | 2590 |
| 166 | Ga0207712_10405243 | 3300025961 | Bacteria | 1147 |
| 167 | Ga0207712_10630028 | 3300025961 | Bacteria | 930 |
| 168 | Ga0207712_11393905 | 3300025961 | Bacteria | 627 |
| 169 | Ga0207668_10086974 | 3300025972 | Bacteria | 2285 |
| 170 | Ga0207668_10117008 | 3300025972 | Bacteria | 2011 |
| 171 | Ga0207668_11560415 | 3300025972 | Unclassified | 596 |
| 172 | Ga0207640_10132009 | 3300025981 | Bacteria | 1807 |
| 173 | Ga0207677_10328788 | 3300026023 | Bacteria | 1273 |
| 174 | Ga0207677_11700528 | 3300026023 | Bacteria | 585 |
| 175 | Ga0207703_10350725 | 3300026035 | Bacteria | 1358 |
| 176 | Ga0207639_10057073 | 3300026041 | Bacteria | 2996 |
| 177 | Ga0207678_10842548 | 3300026067 | Bacteria | 810 |
| 178 | Ga0207708_10001807 | 3300026075 | Bacteria | 15773 |
| 179 | Ga0207708_10356057 | 3300026075 | Bacteria | 1202 |
| 180 | Ga0207702_10035146 | 3300026078 | Bacteria | 4190 |
| 181 | Ga0207648_10298709 | 3300026089 | Bacteria | 1444 |
| 182 | Ga0207648_11480215 | 3300026089 | Unclassified | 638 |
| 183 | Ga0207676_10652665 | 3300026095 | Bacteria | 1015 |
| 184 | Ga0207676_10943595 | 3300026095 | Bacteria | 848 |
| 185 | Ga0207674_10468419 | 3300026116 | Bacteria | 1218 |
| 186 | Ga0207675_100237542 | 3300026118 | Bacteria | 1760 |
| 187 | Ga0207675_100451233 | 3300026118 | Bacteria | 1274 |
| 188 | Ga0207675_100471335 | 3300026118 | Bacteria | 1247 |
| 189 | Ga0207675_100570830 | 3300026118 | Bacteria | 1132 |
| 190 | Ga0207675_100814720 | 3300026118 | Bacteria | 947 |
| 191 | Ga0207683_10050815 | 3300026121 | Bacteria | 3632 |
| 192 | Ga0207698_10026795 | 3300026142 | Bacteria | 4082 |
| 193 | Ga0207428_10024640 | 3300027907 | Bacteria | 5052 |
| 194 | Ga0307408_100150931 | 3300031548 | Bacteria | 1834 |
| 195 | Ga0307408_101498901 | 3300031548 | Bacteria | 638 |
| 196 | Ga0307405_10109269 | 3300031731 | Bacteria | 1870 |
| 197 | Ga0307413_10030813 | 3300031824 | Bacteria | 3018 |
| 198 | Ga0307409_100012707 | 3300031995 | Bacteria | 5379 |
| 199 | Ga0307409_102393655 | 3300031995 | Bacteria | 557 |
| 200 | Ga0307416_101188268 | 3300032002 | Bacteria | 868 |
| 201 | Ga0307414_10119968 | 3300032004 | Bacteria | 2020 |
| 202 | Ga0307415_100020799 | 3300032126 | Bacteria | 4016 |
| 203 | Ga0373953_0148075 | 3300035117 | Bacteria | 1005 |
| 204 | Ga0373937_0005520 | 3300036401 | Bacteria | 10841 |
| 205 | Ga0395899_0482439 | 3300037312 | Bacteria | 807 |
| 206 | Ga0395900_1373631 | 3300037418 | Bacteria | 620 |
| 207 | Ga0395898_0438577 | 3300037466 | Bacteria | 1244 |
| 208 | Ga0395905_0825968 | 3300037471 | Bacteria | 830 |
| 209 | Ga0395905_1135637 | 3300037471 | Bacteria | 685 |
| 210 | Ga0395901_0076864 | 3300038443 | Bacteria | 3484 |
| 211 | Ga0395901_0495702 | 3300038443 | Bacteria | 1244 |
| 212 | Ga0395901_1560280 | 3300038443 | Bacteria | 615 |
| 213 | Ga0466966_0826794 | 3300044684 | Unclassified | 558 |
| 214 | Ga0466961_0135703 | 3300044693 | Bacteria | 1542 |
| 215 | Ga0466970_0450334 | 3300044765 | Bacteria | 738 |
| 216 | Ga0466959_0279445 | 3300045049 | Bacteria | 1146 |
| 217 | Ga0466967_1693746 | 3300045976 | Bacteria | 630 |
| 218 | Ga0495629_0448848 | 3300046459 | Unclassified | 873 |
| 219 | Ga0495641_0219090 | 3300046461 | Bacteria | 854 |
| 220 | Ga0495651_0656885 | 3300046462 | Unclassified | 657 |
| 221 | Ga0495582_0489095 | 3300046473 | Bacteria | 711 |
| 222 | Ga0495596_0140187 | 3300046500 | Bacteria | 939 |
| 223 | Ga0495609_0256766 | 3300046538 | Bacteria | 719 |
| 224 | Ga0495634_0218850 | 3300046642 | Bacteria | 1176 |
| 225 | Ga0495635_1073388 | 3300046663 | Bacteria | 510 |
| 226 | Ga0495658_0862469 | 3300046683 | Unclassified | 579 |
| 227 | Ga0495600_0293783 | 3300046809 | Bacteria | 1026 |
| 228 | Ga0495600_0541708 | 3300046809 | Bacteria | 712 |
| 229 | Ga0495614_0048732 | 3300048089 | Bacteria | 1816 |
| 230 | Ga0496100_0450501 | 3300048903 | Bacteria | 986 |
| 231 | Ga0496101_0578757 | 3300048904 | Bacteria | 888 |
| 232 | Ga0496101_1240194 | 3300048904 | Bacteria | 584 |
| 233 | Ga0496102_0092998 | 3300048905 | Bacteria | 2793 |
| 234 | Ga0496103_0212470 | 3300048906 | Bacteria | 1244 |
| 235 | Ga0496104_0006532 | 3300048907 | Bacteria | 10253 |
| 236 | Ga0496104_0891012 | 3300048907 | Bacteria | 795 |
| 237 | Ga0496105_0059456 | 3300048908 | Bacteria | 3153 |
| 238 | Ga0496106_0018681 | 3300048909 | Bacteria | 5133 |
| 239 | Ga0496107_0028453 | 3300048910 | Bacteria | 3972 |
| 240 | Ga0496108_0005519 | 3300048911 | Bacteria | 10230 |
| 241 | Ga0496109_0060632 | 3300048912 | Bacteria | 3457 |
| 242 | Ga0496110_0297751 | 3300048913 | Bacteria | 1469 |
| 243 | Ga0496111_0082729 | 3300048914 | Bacteria | 2345 |
| 244 | Ga0496111_0254026 | 3300048914 | Bacteria | 1304 |
| 245 | Ga0496111_0312572 | 3300048914 | Bacteria | 1164 |
| 246 | Ga0496112_0000837 | 3300048915 | Bacteria | 21923 |
| 247 | Ga0496112_0015668 | 3300048915 | Bacteria | 7080 |
| 248 | Ga0496112_0141972 | 3300048915 | Bacteria | 2371 |
| 249 | Ga0496112_0219202 | 3300048915 | Bacteria | 1859 |
| 250 | Ga0496112_0799264 | 3300048915 | Bacteria | 868 |
| 251 | Ga0496112_0938978 | 3300048915 | Bacteria | 786 |
| 252 | Ga0496113_0013998 | 3300048916 | Bacteria | 5458 |
| 253 | Ga0496113_0284239 | 3300048916 | Bacteria | 1323 |
| 254 | Ga0496114_0454184 | 3300048917 | Bacteria | 1135 |
| 255 | Ga0501039_0301453 | 3300049575 | Bacteria | 1260 |
| 256 | Ga0501040_0453591 | 3300049576 | Unclassified | 923 |
| 257 | Ga0501041_0357175 | 3300049577 | Bacteria | 924 |
| 258 | Ga0501068_0529532 | 3300049584 | Bacteria | 765 |
| 259 | Ga0501068_0931782 | 3300049584 | Unclassified | 572 |
| 260 | Ga0501069_0915420 | 3300049585 | Bacteria | 534 |
| 261 | Ga0501070_0805927 | 3300049586 | Bacteria | 737 |
| 262 | Ga0501075_0150836 | 3300049591 | Bacteria | 1772 |
| 263 | Ga0501081_0594343 | 3300049743 | Bacteria | 828 |
| 264 | Ga0501081_0718267 | 3300049743 | Bacteria | 750 |
| 265 | Ga0501081_1071759 | 3300049743 | Bacteria | 610 |
| 266 | Ga0501045_0552045 | 3300049824 | Bacteria | 854 |
| 267 | nmdc:mga00v17_90481_c1 | 3300050491 | Bacteria | 1921 |
| 268 | nmdc:mga0yw44_1268_c1 | 3300050492 | Bacteria | 9942 |
| 269 | nmdc:mga05p37_172420_c1 | 3300050507 | Bacteria | 2638 |
| 270 | nmdc:mga05p37_176985_c1 | 3300050507 | Bacteria | 2598 |
| 271 | nmdc:mga05p37_610879_c1 | 3300050507 | Bacteria | 1229 |
| 272 | nmdc:mga09592_108523_c1 | 3300050508 | Bacteria | 2381 |
| 273 | nmdc:mga0qj67_168459_c1 | 3300050509 | Bacteria | 1779 |
| 274 | nmdc:mga06r32_1244365_c1 | 3300050510 | Bacteria | 690 |
| 275 | nmdc:mga06r32_164473_c1 | 3300050510 | Bacteria | 2201 |
| 276 | nmdc:mga06r32_165045_c1 | 3300050510 | Bacteria | 2198 |
| 277 | nmdc:mga08y16_337028_c1 | 3300050511 | Bacteria | 1551 |
| 278 | nmdc:mga0n895_10516_c1 | 3300050512 | Bacteria | 8184 |
| 279 | nmdc:mga0n895_89281_c1 | 3300050512 | Bacteria | 3083 |
| 280 | nmdc:mga0rr50_200131_c1 | 3300050513 | Bacteria | 1641 |
| 281 | nmdc:mga0rr50_567452_c1 | 3300050513 | Bacteria | 967 |
| 282 | nmdc:mga0a205_117089_c1 | 3300050515 | Bacteria | 2563 |
| 283 | nmdc:mga0a205_364435_c1 | 3300050515 | Bacteria | 1311 |
| 284 | nmdc:mga0a205_8632_c1 | 3300050515 | Bacteria | 9272 |
| 285 | nmdc:mga0a205_934_c2 | 3300050515 | Bacteria | 7669 |
| 286 | Ga0495655_0122438 | 3300053083 | Bacteria | 793 |
| 287 | Ga0466962_0177441 | 3300061719 | Bacteria | 1038 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009148 | Ga0105243_13002947 | Ga0105243_130029471 | 90 |
| 2 | 3300005338 | Ga0068868_100718802 | Ga0068868_1007188022 | 94 |
| 3 | 3300005340 | Ga0070689_100946969 | Ga0070689_1009469691 | 94 |
| 4 | 3300005341 | Ga0070691_10735835 | Ga0070691_107358352 | 94 |
| 5 | 3300005345 | Ga0070692_10476426 | Ga0070692_104764261 | 94 |
| 6 | 3300005345 | Ga0070692_10519503 | Ga0070692_105195032 | 94 |
| 7 | 3300005354 | Ga0070675_102102181 | Ga0070675_1021021811 | 94 |
| 8 | 3300005356 | Ga0070674_100730776 | Ga0070674_1007307762 | 94 |
| 9 | 3300005439 | Ga0070711_101136571 | Ga0070711_1011365711 | 94 |
| 10 | 3300005444 | Ga0070694_100121921 | Ga0070694_1001219212 | 94 |
| 11 | 3300005459 | Ga0068867_100123730 | Ga0068867_1001237304 | 94 |
| 12 | 3300005459 | Ga0068867_101592943 | Ga0068867_1015929431 | 94 |
| 13 | 3300005459 | Ga0068867_102380855 | Ga0068867_1023808551 | 94 |
| 14 | 3300005467 | Ga0070706_101428272 | Ga0070706_1014282722 | 94 |
| 15 | 3300005467 | Ga0070706_101737030 | Ga0070706_1017370302 | 94 |
| 16 | 3300005518 | Ga0070699_100607284 | Ga0070699_1006072842 | 94 |
| 17 | 3300005544 | Ga0070686_101661426 | Ga0070686_1016614261 | 94 |
| 18 | 3300005719 | Ga0068861_100524617 | Ga0068861_1005246172 | 94 |
| 19 | 3300005719 | Ga0068861_100691226 | Ga0068861_1006912262 | 94 |
| 20 | 3300006038 | Ga0075365_10005759 | Ga0075365_100057593 | 94 |
| 21 | 3300006038 | Ga0075365_11124033 | Ga0075365_111240331 | 94 |
| 22 | 3300006051 | Ga0075364_10320210 | Ga0075364_103202102 | 94 |
| 23 | 3300006844 | Ga0075428_100120631 | Ga0075428_1001206312 | 94 |
| 24 | 3300006846 | Ga0075430_100098260 | Ga0075430_1000982604 | 94 |
| 25 | 3300006847 | Ga0075431_100010449 | Ga0075431_1000104493 | 94 |
| 26 | 3300006847 | Ga0075431_100737949 | Ga0075431_1007379492 | 94 |
| 27 | 3300006880 | Ga0075429_100002784 | Ga0075429_10000278416 | 94 |
| 28 | 3300006881 | Ga0068865_101454522 | Ga0068865_1014545221 | 94 |
| 29 | 3300009098 | Ga0105245_11118735 | Ga0105245_111187352 | 94 |
| 30 | 3300009147 | Ga0114129_10003763 | Ga0114129_1000376316 | 94 |
| 31 | 3300009147 | Ga0114129_10579990 | Ga0114129_105799903 | 94 |
| 32 | 3300009147 | Ga0114129_10673303 | Ga0114129_106733032 | 94 |
| 33 | 3300009148 | Ga0105243_10038425 | Ga0105243_100384255 | 94 |
| 34 | 3300009148 | Ga0105243_10278439 | Ga0105243_102784392 | 94 |
| 35 | 3300009148 | Ga0105243_10568880 | Ga0105243_105688802 | 94 |
| 36 | 3300009148 | Ga0105243_10602135 | Ga0105243_106021352 | 94 |
| 37 | 3300009148 | Ga0105243_11215969 | Ga0105243_112159692 | 94 |
| 38 | 3300009176 | Ga0105242_10162020 | Ga0105242_101620204 | 94 |
| 39 | 3300009176 | Ga0105242_10307056 | Ga0105242_103070563 | 94 |
| 40 | 3300009176 | Ga0105242_11601424 | Ga0105242_116014242 | 94 |
| 41 | 3300009177 | Ga0105248_12090450 | Ga0105248_120904502 | 94 |
| 42 | 3300009553 | Ga0105249_10523790 | Ga0105249_105237902 | 94 |
| 43 | 3300010375 | Ga0105239_10924381 | Ga0105239_109243813 | 94 |
| 44 | 3300010375 | Ga0105239_11590588 | Ga0105239_115905881 | 94 |
| 45 | 3300010375 | Ga0105239_12236062 | Ga0105239_122360622 | 94 |
| 46 | 3300011119 | Ga0105246_10544985 | Ga0105246_105449852 | 94 |
| 47 | 3300011119 | Ga0105246_12176309 | Ga0105246_121763091 | 94 |
| 48 | 3300013297 | Ga0157378_10270849 | Ga0157378_102708492 | 94 |
| 49 | 3300013306 | Ga0163162_10778976 | Ga0163162_107789763 | 94 |
| 50 | 3300013308 | Ga0157375_11690695 | Ga0157375_116906952 | 94 |
| 51 | 3300014325 | Ga0163163_10162900 | Ga0163163_101629002 | 94 |
| 52 | 3300014497 | Ga0182008_10503892 | Ga0182008_105038922 | 94 |
| 53 | 3300025910 | Ga0207684_11242181 | Ga0207684_112421812 | 94 |
| 54 | 3300025926 | Ga0207659_11108608 | Ga0207659_111086081 | 94 |
| 55 | 3300025927 | Ga0207687_10938342 | Ga0207687_109383422 | 94 |
| 56 | 3300025927 | Ga0207687_11655716 | Ga0207687_116557162 | 94 |
| 57 | 3300025935 | Ga0207709_10359827 | Ga0207709_103598272 | 94 |
| 58 | 3300025935 | Ga0207709_10621673 | Ga0207709_106216732 | 94 |
| 59 | 3300025937 | Ga0207669_10032858 | Ga0207669_100328582 | 94 |
| 60 | 3300025939 | Ga0207665_11033665 | Ga0207665_110336652 | 94 |
| 61 | 3300025961 | Ga0207712_10630028 | Ga0207712_106300282 | 94 |
| 62 | 3300025972 | Ga0207668_11560415 | Ga0207668_115604152 | 94 |
| 63 | 3300026023 | Ga0207677_11700528 | Ga0207677_117005282 | 94 |
| 64 | 3300026067 | Ga0207678_10842548 | Ga0207678_108425482 | 94 |
| 65 | 3300026075 | Ga0207708_10356057 | Ga0207708_103560572 | 94 |
| 66 | 3300026089 | Ga0207648_10298709 | Ga0207648_102987092 | 94 |
| 67 | 3300026089 | Ga0207648_11480215 | Ga0207648_114802152 | 94 |
| 68 | 3300026095 | Ga0207676_10943595 | Ga0207676_109435952 | 94 |
| 69 | 3300026118 | Ga0207675_100814720 | Ga0207675_1008147202 | 94 |
| 70 | 3300031548 | Ga0307408_100150931 | Ga0307408_1001509313 | 94 |
| 71 | 3300031548 | Ga0307408_101498901 | Ga0307408_1014989012 | 94 |
| 72 | 3300031731 | Ga0307405_10109269 | Ga0307405_101092692 | 94 |
| 73 | 3300031824 | Ga0307413_10030813 | Ga0307413_100308135 | 94 |
| 74 | 3300031995 | Ga0307409_100012707 | Ga0307409_1000127073 | 94 |
| 75 | 3300031995 | Ga0307409_102393655 | Ga0307409_1023936552 | 94 |
| 76 | 3300032004 | Ga0307414_10119968 | Ga0307414_101199685 | 94 |
| 77 | 3300032126 | Ga0307415_100020799 | Ga0307415_1000207996 | 94 |
| 78 | 3300037418 | Ga0395900_1373631 | Ga0395900_1373631_296_580 | 94 |
| 79 | 3300038443 | Ga0395901_0495702 | Ga0395901_0495702_158_442 | 94 |
| 80 | 3300038443 | Ga0395901_1560280 | Ga0395901_1560280_87_371 | 94 |
| 81 | 3300046461 | Ga0495641_0219090 | Ga0495641_0219090_497_781 | 94 |
| 82 | 3300046473 | Ga0495582_0489095 | Ga0495582_0489095_275_559 | 94 |
| 83 | 3300048904 | Ga0496101_0578757 | Ga0496101_0578757_327_611 | 94 |
| 84 | 3300048904 | Ga0496101_1240194 | Ga0496101_1240194_129_413 | 94 |
| 85 | 3300048907 | Ga0496104_0891012 | Ga0496104_0891012_126_410 | 94 |
| 86 | 3300048912 | Ga0496109_0060632 | Ga0496109_0060632_2169_2453 | 94 |
| 87 | 3300048914 | Ga0496111_0082729 | Ga0496111_0082729_1467_1751 | 94 |
| 88 | 3300048914 | Ga0496111_0312572 | Ga0496111_0312572_215_499 | 94 |
| 89 | 3300048915 | Ga0496112_0141972 | Ga0496112_0141972_1997_2281 | 94 |
| 90 | 3300048915 | Ga0496112_0219202 | Ga0496112_0219202_742_1026 | 94 |
| 91 | 3300048915 | Ga0496112_0799264 | Ga0496112_0799264_396_680 | 94 |
| 92 | 3300048915 | Ga0496112_0938978 | Ga0496112_0938978_103_387 | 94 |
| 93 | 3300048916 | Ga0496113_0284239 | Ga0496113_0284239_432_716 | 94 |
| 94 | 3300049575 | Ga0501039_0301453 | Ga0501039_0301453_746_1030 | 94 |
| 95 | 3300049576 | Ga0501040_0453591 | Ga0501040_0453591_566_850 | 94 |
| 96 | 3300049577 | Ga0501041_0357175 | Ga0501041_0357175_58_342 | 94 |
| 97 | 3300049584 | Ga0501068_0529532 | Ga0501068_0529532_426_710 | 94 |
| 98 | 3300049584 | Ga0501068_0931782 | Ga0501068_0931782_77_361 | 94 |
| 99 | 3300049586 | Ga0501070_0805927 | Ga0501070_0805927_422_706 | 94 |
| 100 | 3300049591 | Ga0501075_0150836 | Ga0501075_0150836_958_1242 | 94 |
| 101 | 3300049743 | Ga0501081_0594343 | Ga0501081_0594343_421_705 | 94 |
| 102 | 3300049743 | Ga0501081_0718267 | Ga0501081_0718267_210_494 | 94 |
| 103 | 3300049743 | Ga0501081_1071759 | Ga0501081_1071759_121_405 | 94 |
| 104 | 3300049824 | Ga0501045_0552045 | Ga0501045_0552045_448_732 | 94 |
| 105 | 3300050491 | nmdc:mga00v17_90481_c1 | nmdc:mga00v17_90481_c1_784_1068 | 94 |
| 106 | 3300050492 | nmdc:mga0yw44_1268_c1 | nmdc:mga0yw44_1268_c1_8000_8284 | 94 |
| 107 | 3300050507 | nmdc:mga05p37_172420_c1 | nmdc:mga05p37_172420_c1_2258_2545 | 94 |
| 108 | 3300050507 | nmdc:mga05p37_176985_c1 | nmdc:mga05p37_176985_c1_1157_1441 | 94 |
| 109 | 3300050508 | nmdc:mga09592_108523_c1 | nmdc:mga09592_108523_c1_819_1103 | 94 |
| 110 | 3300050509 | nmdc:mga0qj67_168459_c1 | nmdc:mga0qj67_168459_c1_61_345 | 94 |
| 111 | 3300050510 | nmdc:mga06r32_164473_c1 | nmdc:mga06r32_164473_c1_1708_1992 | 94 |
| 112 | 3300050510 | nmdc:mga06r32_165045_c1 | nmdc:mga06r32_165045_c1_1872_2156 | 94 |
| 113 | 3300050512 | nmdc:mga0n895_10516_c1 | nmdc:mga0n895_10516_c1_1596_1883 | 94 |
| 114 | 3300050513 | nmdc:mga0rr50_567452_c1 | nmdc:mga0rr50_567452_c1_624_911 | 94 |
| 115 | 3300050515 | nmdc:mga0a205_364435_c1 | nmdc:mga0a205_364435_c1_248_532 | 94 |
| 116 | 3300050515 | nmdc:mga0a205_8632_c1 | nmdc:mga0a205_8632_c1_901_1188 | 94 |
| 117 | 3300053083 | Ga0495655_0122438 | Ga0495655_0122438_117_401 | 94 |
| 118 | 3300005329 | Ga0070683_100897528 | Ga0070683_1008975282 | 95 |
| 119 | 3300005347 | Ga0070668_100445582 | Ga0070668_1004455822 | 95 |
| 120 | 3300005435 | Ga0070714_101222992 | Ga0070714_1012229922 | 95 |
| 121 | 3300005439 | Ga0070711_101438916 | Ga0070711_1014389162 | 95 |
| 122 | 3300006175 | Ga0070712_100000050 | Ga0070712_10000005041 | 95 |
| 123 | 3300014969 | Ga0157376_10068481 | Ga0157376_100684814 | 95 |
| 124 | 3300025915 | Ga0207693_10000151 | Ga0207693_1000015140 | 95 |
| 125 | 3300025917 | Ga0207660_10873526 | Ga0207660_108735262 | 95 |
| 126 | 3300025944 | Ga0207661_10874578 | Ga0207661_108745782 | 95 |
| 127 | 3300026118 | Ga0207675_100451233 | Ga0207675_1004512332 | 95 |
| 128 | 3300035117 | Ga0373953_0148075 | Ga0373953_0148075_387_674 | 95 |
| 129 | 3300036401 | Ga0373937_0005520 | Ga0373937_0005520_2771_3058 | 95 |
| 130 | 3300044684 | Ga0466966_0826794 | Ga0466966_0826794_141_431 | 95 |
| 131 | 3300044693 | Ga0466961_0135703 | Ga0466961_0135703_234_521 | 95 |
| 132 | 3300044765 | Ga0466970_0450334 | Ga0466970_0450334_158_448 | 95 |
| 133 | 3300045049 | Ga0466959_0279445 | Ga0466959_0279445_333_623 | 95 |
| 134 | 3300045976 | Ga0466967_1693746 | Ga0466967_1693746_53_340 | 95 |
| 135 | 3300046459 | Ga0495629_0448848 | Ga0495629_0448848_308_595 | 95 |
| 136 | 3300046462 | Ga0495651_0656885 | Ga0495651_0656885_55_342 | 95 |
| 137 | 3300046642 | Ga0495634_0218850 | Ga0495634_0218850_401_688 | 95 |
| 138 | 3300046663 | Ga0495635_1073388 | Ga0495635_1073388_38_325 | 95 |
| 139 | 3300046683 | Ga0495658_0862469 | Ga0495658_0862469_126_413 | 95 |
| 140 | 3300046809 | Ga0495600_0293783 | Ga0495600_0293783_582_869 | 95 |
| 141 | 3300046809 | Ga0495600_0541708 | Ga0495600_0541708_373_660 | 95 |
| 142 | 3300048915 | Ga0496112_0000837 | Ga0496112_0000837_20490_20777 | 95 |
| 143 | 3300049585 | Ga0501069_0915420 | Ga0501069_0915420_36_323 | 95 |
| 144 | 3300061719 | Ga0466962_0177441 | Ga0466962_0177441_321_608 | 95 |
| 145 | 3300005365 | Ga0070688_100571700 | Ga0070688_1005717002 | 96 |
| 146 | 3300005466 | Ga0070685_10910843 | Ga0070685_109108432 | 96 |
| 147 | 3300046500 | Ga0495596_0140187 | Ga0495596_0140187_57_347 | 96 |
| 148 | 3300046538 | Ga0495609_0256766 | Ga0495609_0256766_413_703 | 96 |
| 149 | 3300048089 | Ga0495614_0048732 | Ga0495614_0048732_1209_1499 | 96 |
| 150 | 3300050515 | nmdc:mga0a205_934_c2 | nmdc:mga0a205_934_c2_3960_4250 | 96 |
| 151 | 3300002073 | JGI24745J21846_1017501 | JGI24745J21846_10175012 | 97 |
| 152 | 3300002076 | JGI24749J21850_1079703 | JGI24749J21850_10797032 | 97 |
| 153 | 3300002077 | JGI24744J21845_10085623 | JGI24744J21845_100856232 | 97 |
| 154 | 3300005327 | Ga0070658_10399021 | Ga0070658_103990212 | 97 |
| 155 | 3300005329 | Ga0070683_100017579 | Ga0070683_1000175791 | 97 |
| 156 | 3300005330 | Ga0070690_101150223 | Ga0070690_1011502232 | 97 |
| 157 | 3300005331 | Ga0070670_100212136 | Ga0070670_1002121362 | 97 |
| 158 | 3300005337 | Ga0070682_100001883 | Ga0070682_10000188314 | 97 |
| 159 | 3300005338 | Ga0068868_100018909 | Ga0068868_1000189096 | 97 |
| 160 | 3300005339 | Ga0070660_101490488 | Ga0070660_1014904882 | 97 |
| 161 | 3300005340 | Ga0070689_100643348 | Ga0070689_1006433482 | 97 |
| 162 | 3300005341 | Ga0070691_10068952 | Ga0070691_100689522 | 97 |
| 163 | 3300005344 | Ga0070661_100124990 | Ga0070661_1001249903 | 97 |
| 164 | 3300005347 | Ga0070668_100137426 | Ga0070668_1001374263 | 97 |
| 165 | 3300005347 | Ga0070668_100338439 | Ga0070668_1003384393 | 97 |
| 166 | 3300005354 | Ga0070675_100272664 | Ga0070675_1002726642 | 97 |
| 167 | 3300005356 | Ga0070674_100226676 | Ga0070674_1002266762 | 97 |
| 168 | 3300005364 | Ga0070673_100086323 | Ga0070673_1000863232 | 97 |
| 169 | 3300005365 | Ga0070688_100089185 | Ga0070688_1000891852 | 97 |
| 170 | 3300005366 | Ga0070659_100934898 | Ga0070659_1009348982 | 97 |
| 171 | 3300005437 | Ga0070710_10059449 | Ga0070710_100594492 | 97 |
| 172 | 3300005439 | Ga0070711_100018337 | Ga0070711_1000183372 | 97 |
| 173 | 3300005440 | Ga0070705_100142921 | Ga0070705_1001429213 | 97 |
| 174 | 3300005441 | Ga0070700_100066992 | Ga0070700_1000669921 | 97 |
| 175 | 3300005456 | Ga0070678_100057118 | Ga0070678_1000571182 | 97 |
| 176 | 3300005457 | Ga0070662_100528825 | Ga0070662_1005288252 | 97 |
| 177 | 3300005535 | Ga0070684_100004775 | Ga0070684_1000047757 | 97 |
| 178 | 3300005539 | Ga0068853_100127390 | Ga0068853_1001273902 | 97 |
| 179 | 3300005545 | Ga0070695_100159954 | Ga0070695_1001599542 | 97 |
| 180 | 3300005549 | Ga0070704_102185246 | Ga0070704_1021852462 | 97 |
| 181 | 3300005563 | Ga0068855_100418408 | Ga0068855_1004184083 | 97 |
| 182 | 3300005564 | Ga0070664_100309724 | Ga0070664_1003097242 | 97 |
| 183 | 3300005577 | Ga0068857_100495521 | Ga0068857_1004955212 | 97 |
| 184 | 3300005614 | Ga0068856_100014289 | Ga0068856_1000142896 | 97 |
| 185 | 3300005615 | Ga0070702_100175146 | Ga0070702_1001751462 | 97 |
| 186 | 3300005616 | Ga0068852_100156657 | Ga0068852_1001566572 | 97 |
| 187 | 3300005618 | Ga0068864_100007268 | Ga0068864_1000072686 | 97 |
| 188 | 3300005719 | Ga0068861_100157871 | Ga0068861_1001578713 | 97 |
| 189 | 3300005842 | Ga0068858_100818528 | Ga0068858_1008185282 | 97 |
| 190 | 3300005843 | Ga0068860_101320687 | Ga0068860_1013206872 | 97 |
| 191 | 3300006058 | Ga0075432_10090437 | Ga0075432_100904373 | 97 |
| 192 | 3300006163 | Ga0070715_10431776 | Ga0070715_104317762 | 97 |
| 193 | 3300006173 | Ga0070716_101027757 | Ga0070716_1010277572 | 97 |
| 194 | 3300006175 | Ga0070712_100041267 | Ga0070712_1000412673 | 97 |
| 195 | 3300006358 | Ga0068871_100335519 | Ga0068871_1003355192 | 97 |
| 196 | 3300006846 | Ga0075430_100487050 | Ga0075430_1004870502 | 97 |
| 197 | 3300006852 | Ga0075433_10855908 | Ga0075433_108559082 | 97 |
| 198 | 3300006871 | Ga0075434_100005013 | Ga0075434_1000050137 | 97 |
| 199 | 3300006871 | Ga0075434_101155992 | Ga0075434_1011559922 | 97 |
| 200 | 3300006881 | Ga0068865_100162298 | Ga0068865_1001622983 | 97 |
| 201 | 3300006914 | Ga0075436_100045428 | Ga0075436_1000454282 | 97 |
| 202 | 3300007076 | Ga0075435_100446187 | Ga0075435_1004461873 | 97 |
| 203 | 3300009094 | Ga0111539_10011916 | Ga0111539_100119163 | 97 |
| 204 | 3300009094 | Ga0111539_10674497 | Ga0111539_106744972 | 97 |
| 205 | 3300009098 | Ga0105245_10016242 | Ga0105245_100162426 | 97 |
| 206 | 3300009147 | Ga0114129_10252855 | Ga0114129_102528554 | 97 |
| 207 | 3300009148 | Ga0105243_10021911 | Ga0105243_100219113 | 97 |
| 208 | 3300009177 | Ga0105248_10267863 | Ga0105248_102678633 | 97 |
| 209 | 3300009553 | Ga0105249_10392548 | Ga0105249_103925483 | 97 |
| 210 | 3300010375 | Ga0105239_10505599 | Ga0105239_105055993 | 97 |
| 211 | 3300011119 | Ga0105246_10027744 | Ga0105246_100277446 | 97 |
| 212 | 3300013296 | Ga0157374_10039021 | Ga0157374_100390213 | 97 |
| 213 | 3300013297 | Ga0157378_12277820 | Ga0157378_122778201 | 97 |
| 214 | 3300013306 | Ga0163162_10234231 | Ga0163162_102342312 | 97 |
| 215 | 3300013306 | Ga0163162_10257020 | Ga0163162_102570203 | 97 |
| 216 | 3300013306 | Ga0163162_10332932 | Ga0163162_103329321 | 97 |
| 217 | 3300013307 | Ga0157372_10023795 | Ga0157372_100237956 | 97 |
| 218 | 3300014325 | Ga0163163_10076731 | Ga0163163_100767316 | 97 |
| 219 | 3300014326 | Ga0157380_10351661 | Ga0157380_103516612 | 97 |
| 220 | 3300014326 | Ga0157380_10380368 | Ga0157380_103803682 | 97 |
| 221 | 3300014968 | Ga0157379_10375836 | Ga0157379_103758362 | 97 |
| 222 | 3300014969 | Ga0157376_10549831 | Ga0157376_105498311 | 97 |
| 223 | 3300017792 | Ga0163161_10396491 | Ga0163161_103964912 | 97 |
| 224 | 3300025898 | Ga0207692_10042755 | Ga0207692_100427553 | 97 |
| 225 | 3300025901 | Ga0207688_10004983 | Ga0207688_100049836 | 97 |
| 226 | 3300025909 | Ga0207705_10335341 | Ga0207705_103353412 | 97 |
| 227 | 3300025915 | Ga0207693_10008782 | Ga0207693_100087826 | 97 |
| 228 | 3300025916 | Ga0207663_10200493 | Ga0207663_102004932 | 97 |
| 229 | 3300025919 | Ga0207657_10434362 | Ga0207657_104343622 | 97 |
| 230 | 3300025920 | Ga0207649_10279978 | Ga0207649_102799782 | 97 |
| 231 | 3300025925 | Ga0207650_10274644 | Ga0207650_102746442 | 97 |
| 232 | 3300025926 | Ga0207659_11741244 | Ga0207659_117412442 | 97 |
| 233 | 3300025927 | Ga0207687_10014607 | Ga0207687_100146076 | 97 |
| 234 | 3300025931 | Ga0207644_10194912 | Ga0207644_101949122 | 97 |
| 235 | 3300025932 | Ga0207690_11298501 | Ga0207690_112985012 | 97 |
| 236 | 3300025933 | Ga0207706_10175192 | Ga0207706_101751924 | 97 |
| 237 | 3300025933 | Ga0207706_10391451 | Ga0207706_103914512 | 97 |
| 238 | 3300025935 | Ga0207709_11175292 | Ga0207709_111752922 | 97 |
| 239 | 3300025936 | Ga0207670_10190102 | Ga0207670_101901022 | 97 |
| 240 | 3300025938 | Ga0207704_10660075 | Ga0207704_106600752 | 97 |
| 241 | 3300025941 | Ga0207711_10473781 | Ga0207711_104737812 | 97 |
| 242 | 3300025944 | Ga0207661_10917918 | Ga0207661_109179182 | 97 |
| 243 | 3300025945 | Ga0207679_11279765 | Ga0207679_112797652 | 97 |
| 244 | 3300025960 | Ga0207651_10062847 | Ga0207651_100628473 | 97 |
| 245 | 3300025961 | Ga0207712_10405243 | Ga0207712_104052432 | 97 |
| 246 | 3300025961 | Ga0207712_11393905 | Ga0207712_113939052 | 97 |
| 247 | 3300025972 | Ga0207668_10086974 | Ga0207668_100869743 | 97 |
| 248 | 3300025972 | Ga0207668_10117008 | Ga0207668_101170083 | 97 |
| 249 | 3300025981 | Ga0207640_10132009 | Ga0207640_101320092 | 97 |
| 250 | 3300026023 | Ga0207677_10328788 | Ga0207677_103287882 | 97 |
| 251 | 3300026035 | Ga0207703_10350725 | Ga0207703_103507252 | 97 |
| 252 | 3300026041 | Ga0207639_10057073 | Ga0207639_100570733 | 97 |
| 253 | 3300026075 | Ga0207708_10001807 | Ga0207708_100018079 | 97 |
| 254 | 3300026078 | Ga0207702_10035146 | Ga0207702_100351463 | 97 |
| 255 | 3300026095 | Ga0207676_10652665 | Ga0207676_106526652 | 97 |
| 256 | 3300026116 | Ga0207674_10468419 | Ga0207674_104684192 | 97 |
| 257 | 3300026118 | Ga0207675_100237542 | Ga0207675_1002375423 | 97 |
| 258 | 3300026118 | Ga0207675_100471335 | Ga0207675_1004713353 | 97 |
| 259 | 3300026118 | Ga0207675_100570830 | Ga0207675_1005708302 | 97 |
| 260 | 3300026121 | Ga0207683_10050815 | Ga0207683_100508153 | 97 |
| 261 | 3300026142 | Ga0207698_10026795 | Ga0207698_100267954 | 97 |
| 262 | 3300027907 | Ga0207428_10024640 | Ga0207428_100246403 | 97 |
| 263 | 3300032002 | Ga0307416_101188268 | Ga0307416_1011882682 | 97 |
| 264 | 3300037312 | Ga0395899_0482439 | Ga0395899_0482439_213_506 | 97 |
| 265 | 3300037466 | Ga0395898_0438577 | Ga0395898_0438577_634_927 | 97 |
| 266 | 3300037471 | Ga0395905_0825968 | Ga0395905_0825968_146_439 | 97 |
| 267 | 3300037471 | Ga0395905_1135637 | Ga0395905_1135637_297_590 | 97 |
| 268 | 3300038443 | Ga0395901_0076864 | Ga0395901_0076864_2321_2614 | 97 |
| 269 | 3300048903 | Ga0496100_0450501 | Ga0496100_0450501_229_522 | 97 |
| 270 | 3300048905 | Ga0496102_0092998 | Ga0496102_0092998_447_740 | 97 |
| 271 | 3300048906 | Ga0496103_0212470 | Ga0496103_0212470_225_518 | 97 |
| 272 | 3300048907 | Ga0496104_0006532 | Ga0496104_0006532_412_705 | 97 |
| 273 | 3300048908 | Ga0496105_0059456 | Ga0496105_0059456_2152_2445 | 97 |
| 274 | 3300048909 | Ga0496106_0018681 | Ga0496106_0018681_1317_1610 | 97 |
| 275 | 3300048910 | Ga0496107_0028453 | Ga0496107_0028453_3142_3435 | 97 |
| 276 | 3300048911 | Ga0496108_0005519 | Ga0496108_0005519_706_999 | 97 |
| 277 | 3300048913 | Ga0496110_0297751 | Ga0496110_0297751_819_1112 | 97 |
| 278 | 3300048914 | Ga0496111_0254026 | Ga0496111_0254026_783_1076 | 97 |
| 279 | 3300048915 | Ga0496112_0015668 | Ga0496112_0015668_2701_2994 | 97 |
| 280 | 3300048916 | Ga0496113_0013998 | Ga0496113_0013998_308_601 | 97 |
| 281 | 3300048917 | Ga0496114_0454184 | Ga0496114_0454184_225_518 | 97 |
| 282 | 3300050507 | nmdc:mga05p37_610879_c1 | nmdc:mga05p37_610879_c1_540_833 | 97 |
| 283 | 3300050510 | nmdc:mga06r32_1244365_c1 | nmdc:mga06r32_1244365_c1_217_510 | 97 |
| 284 | 3300050511 | nmdc:mga08y16_337028_c1 | nmdc:mga08y16_337028_c1_320_613 | 97 |
| 285 | 3300050512 | nmdc:mga0n895_89281_c1 | nmdc:mga0n895_89281_c1_2538_2831 | 97 |
| 286 | 3300050513 | nmdc:mga0rr50_200131_c1 | nmdc:mga0rr50_200131_c1_372_665 | 97 |
| 287 | 3300050515 | nmdc:mga0a205_117089_c1 | nmdc:mga0a205_117089_c1_271_564 | 97 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar