F387839

General Info

Members Datasets Scaffolds Average Seq Length
287 189 287 96

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100718802|Ga0068868_1007188022
Length 116
Sequence MRGAFSFSGPDWPPRHPTSIAAMIDRDQVLHVARLARLRLSDEEIDNMSRELSSVLDHIEKISELDLSNVEPTSHVVAVENVLRPDEPRPSWPKERVLESAPDSSHGGFRVPTPGG

Samples

Sample ID Description Type Environment
1 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 8.71
Rhizosphere 89.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1017501 3300002073 Bacteria 834
2 JGI24749J21850_1079703 3300002076 Bacteria 513
3 JGI24744J21845_10085623 3300002077 Bacteria 577
4 Ga0070658_10399021 3300005327 Bacteria 1181
5 Ga0070683_100017579 3300005329 Bacteria 6321
6 Ga0070683_100897528 3300005329 Bacteria 850
7 Ga0070690_101150223 3300005330 Bacteria 617
8 Ga0070670_100212136 3300005331 Bacteria 1684
9 Ga0070682_100001883 3300005337 Bacteria 11719
10 Ga0068868_100018909 3300005338 Bacteria 5156
11 Ga0068868_100718802 3300005338 Bacteria 895
12 Ga0070660_101490488 3300005339 Bacteria 575
13 Ga0070689_100643348 3300005340 Bacteria 922
14 Ga0070689_100946969 3300005340 Bacteria 764
15 Ga0070691_10068952 3300005341 Bacteria 1713
16 Ga0070691_10735835 3300005341 Bacteria 595
17 Ga0070661_100124990 3300005344 Bacteria 1929
18 Ga0070692_10476426 3300005345 Bacteria 804
19 Ga0070692_10519503 3300005345 Bacteria 775
20 Ga0070668_100137426 3300005347 Bacteria 1967
21 Ga0070668_100338439 3300005347 Bacteria 1271
22 Ga0070668_100445582 3300005347 Bacteria 1112
23 Ga0070675_100272664 3300005354 Bacteria 1485
24 Ga0070675_102102181 3300005354 Unclassified 520
25 Ga0070674_100226676 3300005356 Bacteria 1456
26 Ga0070674_100730776 3300005356 Bacteria 849
27 Ga0070673_100086323 3300005364 Bacteria 2557
28 Ga0070688_100089185 3300005365 Bacteria 2012
29 Ga0070688_100571700 3300005365 Bacteria 862
30 Ga0070659_100934898 3300005366 Bacteria 759
31 Ga0070714_101222992 3300005435 Bacteria 733
32 Ga0070710_10059449 3300005437 Bacteria 2171
33 Ga0070711_100018337 3300005439 Bacteria 4466
34 Ga0070711_101136571 3300005439 Bacteria 674
35 Ga0070711_101438916 3300005439 Bacteria 600
36 Ga0070705_100142921 3300005440 Bacteria 1577
37 Ga0070700_100066992 3300005441 Bacteria 2280
38 Ga0070694_100121921 3300005444 Bacteria 1872
39 Ga0070678_100057118 3300005456 Bacteria 2857
40 Ga0070662_100528825 3300005457 Bacteria 986
41 Ga0068867_100123730 3300005459 Bacteria 2002
42 Ga0068867_101592943 3300005459 Unclassified 610
43 Ga0068867_102380855 3300005459 Bacteria 504
44 Ga0070685_10910843 3300005466 Unclassified 655
45 Ga0070706_101428272 3300005467 Bacteria 633
46 Ga0070706_101737030 3300005467 Unclassified 568
47 Ga0070699_100607284 3300005518 Bacteria 998
48 Ga0070684_100004775 3300005535 Bacteria 10352
49 Ga0068853_100127390 3300005539 Bacteria 2276
50 Ga0070686_101661426 3300005544 Unclassified 541
51 Ga0070695_100159954 3300005545 Bacteria 1580
52 Ga0070704_102185246 3300005549 Bacteria 515
53 Ga0068855_100418408 3300005563 Bacteria 1466
54 Ga0070664_100309724 3300005564 Bacteria 1428
55 Ga0068857_100495521 3300005577 Bacteria 1146
56 Ga0068856_100014289 3300005614 Bacteria 7678
57 Ga0070702_100175146 3300005615 Bacteria 1399
58 Ga0068852_100156657 3300005616 Bacteria 2122
59 Ga0068864_100007268 3300005618 Bacteria 9107
60 Ga0068861_100157871 3300005719 Bacteria 1868
61 Ga0068861_100524617 3300005719 Bacteria 1075
62 Ga0068861_100691226 3300005719 Bacteria 947
63 Ga0068858_100818528 3300005842 Bacteria 909
64 Ga0068860_101320687 3300005843 Bacteria 742
65 Ga0075365_10005759 3300006038 Bacteria 6726
66 Ga0075365_11124033 3300006038 Bacteria 553
67 Ga0075364_10320210 3300006051 Bacteria 1056
68 Ga0075432_10090437 3300006058 Bacteria 1120
69 Ga0070715_10431776 3300006163 Bacteria 739
70 Ga0070716_101027757 3300006173 Bacteria 653
71 Ga0070712_100000050 3300006175 Bacteria 63870
72 Ga0070712_100041267 3300006175 Bacteria 3168
73 Ga0068871_100335519 3300006358 Bacteria 1334
74 Ga0075428_100120631 3300006844 Bacteria 2855
75 Ga0075430_100098260 3300006846 Bacteria 2446
76 Ga0075430_100487050 3300006846 Bacteria 1018
77 Ga0075431_100010449 3300006847 Bacteria 9333
78 Ga0075431_100737949 3300006847 Bacteria 961
79 Ga0075433_10855908 3300006852 Bacteria 794
80 Ga0075434_100005013 3300006871 Bacteria 12021
81 Ga0075434_101155992 3300006871 Bacteria 787
82 Ga0075429_100002784 3300006880 Bacteria 14782
83 Ga0068865_100162298 3300006881 Bacteria 1706
84 Ga0068865_101454522 3300006881 Bacteria 613
85 Ga0075436_100045428 3300006914 Bacteria 3030
86 Ga0075435_100446187 3300007076 Bacteria 1115
87 Ga0111539_10011916 3300009094 Bacteria 10899
88 Ga0111539_10674497 3300009094 Bacteria 1203
89 Ga0105245_10016242 3300009098 Bacteria 6489
90 Ga0105245_11118735 3300009098 Bacteria 834
91 Ga0114129_10003763 3300009147 Bacteria 21387
92 Ga0114129_10252855 3300009147 Bacteria 2365
93 Ga0114129_10579990 3300009147 Bacteria 1455
94 Ga0114129_10673303 3300009147 Unclassified 1333
95 Ga0105243_10021911 3300009148 Bacteria 4852
96 Ga0105243_10038425 3300009148 Bacteria 3728
97 Ga0105243_10278439 3300009148 Bacteria 1506
98 Ga0105243_10568880 3300009148 Bacteria 1086
99 Ga0105243_10602135 3300009148 Bacteria 1058
100 Ga0105243_11215969 3300009148 Bacteria 767
101 Ga0105243_13002947 3300009148 Unclassified 512
102 Ga0105242_10162020 3300009176 Bacteria 1959
103 Ga0105242_10307056 3300009176 Bacteria 1450
104 Ga0105242_11601424 3300009176 Bacteria 685
105 Ga0105248_10267863 3300009177 Bacteria 1923
106 Ga0105248_12090450 3300009177 Bacteria 644
107 Ga0105249_10392548 3300009553 Bacteria 1416
108 Ga0105249_10523790 3300009553 Bacteria 1233
109 Ga0105239_10505599 3300010375 Bacteria 1374
110 Ga0105239_10924381 3300010375 Bacteria 1002
111 Ga0105239_11590588 3300010375 Bacteria 756
112 Ga0105239_12236062 3300010375 Bacteria 636
113 Ga0105246_10027744 3300011119 Bacteria 3714
114 Ga0105246_10544985 3300011119 Bacteria 993
115 Ga0105246_12176309 3300011119 Unclassified 539
116 Ga0157374_10039021 3300013296 Bacteria 4369
117 Ga0157378_10270849 3300013297 Bacteria 1633
118 Ga0157378_12277820 3300013297 Bacteria 593
119 Ga0163162_10234231 3300013306 Bacteria 1967
120 Ga0163162_10257020 3300013306 Bacteria 1878
121 Ga0163162_10332932 3300013306 Bacteria 1651
122 Ga0163162_10778976 3300013306 Bacteria 1075
123 Ga0157372_10023795 3300013307 Bacteria 6645
124 Ga0157375_11690695 3300013308 Bacteria 749
125 Ga0163163_10076731 3300014325 Bacteria 3337
126 Ga0163163_10162900 3300014325 Bacteria 2276
127 Ga0157380_10351661 3300014326 Bacteria 1379
128 Ga0157380_10380368 3300014326 Bacteria 1332
129 Ga0182008_10503892 3300014497 Unclassified 666
130 Ga0157379_10375836 3300014968 Bacteria 1303
131 Ga0157376_10068481 3300014969 Bacteria 3006
132 Ga0157376_10549831 3300014969 Bacteria 1142
133 Ga0163161_10396491 3300017792 Bacteria 1106
134 Ga0207692_10042755 3300025898 Bacteria 2251
135 Ga0207688_10004983 3300025901 Bacteria 7227
136 Ga0207705_10335341 3300025909 Bacteria 1164
137 Ga0207684_11242181 3300025910 Bacteria 615
138 Ga0207693_10000151 3300025915 Bacteria 64033
139 Ga0207693_10008782 3300025915 Bacteria 8259
140 Ga0207663_10200493 3300025916 Bacteria 1439
141 Ga0207660_10873526 3300025917 Archaea 734
142 Ga0207657_10434362 3300025919 Bacteria 1031
143 Ga0207649_10279978 3300025920 Bacteria 1212
144 Ga0207650_10274644 3300025925 Bacteria 1371
145 Ga0207659_11108608 3300025926 Bacteria 681
146 Ga0207659_11741244 3300025926 Bacteria 530
147 Ga0207687_10014607 3300025927 Bacteria 5140
148 Ga0207687_10938342 3300025927 Unclassified 741
149 Ga0207687_11655716 3300025927 Unclassified 549
150 Ga0207644_10194912 3300025931 Bacteria 1595
151 Ga0207690_11298501 3300025932 Bacteria 608
152 Ga0207706_10175192 3300025933 Bacteria 1884
153 Ga0207706_10391451 3300025933 Bacteria 1205
154 Ga0207709_10359827 3300025935 Bacteria 1101
155 Ga0207709_10621673 3300025935 Bacteria 857
156 Ga0207709_11175292 3300025935 Bacteria 632
157 Ga0207670_10190102 3300025936 Bacteria 1553
158 Ga0207669_10032858 3300025937 Bacteria 2920
159 Ga0207704_10660075 3300025938 Bacteria 862
160 Ga0207665_11033665 3300025939 Bacteria 654
161 Ga0207711_10473781 3300025941 Bacteria 1166
162 Ga0207661_10874578 3300025944 Bacteria 828
163 Ga0207661_10917918 3300025944 Bacteria 806
164 Ga0207679_11279765 3300025945 Bacteria 673
165 Ga0207651_10062847 3300025960 Bacteria 2590
166 Ga0207712_10405243 3300025961 Bacteria 1147
167 Ga0207712_10630028 3300025961 Bacteria 930
168 Ga0207712_11393905 3300025961 Bacteria 627
169 Ga0207668_10086974 3300025972 Bacteria 2285
170 Ga0207668_10117008 3300025972 Bacteria 2011
171 Ga0207668_11560415 3300025972 Unclassified 596
172 Ga0207640_10132009 3300025981 Bacteria 1807
173 Ga0207677_10328788 3300026023 Bacteria 1273
174 Ga0207677_11700528 3300026023 Bacteria 585
175 Ga0207703_10350725 3300026035 Bacteria 1358
176 Ga0207639_10057073 3300026041 Bacteria 2996
177 Ga0207678_10842548 3300026067 Bacteria 810
178 Ga0207708_10001807 3300026075 Bacteria 15773
179 Ga0207708_10356057 3300026075 Bacteria 1202
180 Ga0207702_10035146 3300026078 Bacteria 4190
181 Ga0207648_10298709 3300026089 Bacteria 1444
182 Ga0207648_11480215 3300026089 Unclassified 638
183 Ga0207676_10652665 3300026095 Bacteria 1015
184 Ga0207676_10943595 3300026095 Bacteria 848
185 Ga0207674_10468419 3300026116 Bacteria 1218
186 Ga0207675_100237542 3300026118 Bacteria 1760
187 Ga0207675_100451233 3300026118 Bacteria 1274
188 Ga0207675_100471335 3300026118 Bacteria 1247
189 Ga0207675_100570830 3300026118 Bacteria 1132
190 Ga0207675_100814720 3300026118 Bacteria 947
191 Ga0207683_10050815 3300026121 Bacteria 3632
192 Ga0207698_10026795 3300026142 Bacteria 4082
193 Ga0207428_10024640 3300027907 Bacteria 5052
194 Ga0307408_100150931 3300031548 Bacteria 1834
195 Ga0307408_101498901 3300031548 Bacteria 638
196 Ga0307405_10109269 3300031731 Bacteria 1870
197 Ga0307413_10030813 3300031824 Bacteria 3018
198 Ga0307409_100012707 3300031995 Bacteria 5379
199 Ga0307409_102393655 3300031995 Bacteria 557
200 Ga0307416_101188268 3300032002 Bacteria 868
201 Ga0307414_10119968 3300032004 Bacteria 2020
202 Ga0307415_100020799 3300032126 Bacteria 4016
203 Ga0373953_0148075 3300035117 Bacteria 1005
204 Ga0373937_0005520 3300036401 Bacteria 10841
205 Ga0395899_0482439 3300037312 Bacteria 807
206 Ga0395900_1373631 3300037418 Bacteria 620
207 Ga0395898_0438577 3300037466 Bacteria 1244
208 Ga0395905_0825968 3300037471 Bacteria 830
209 Ga0395905_1135637 3300037471 Bacteria 685
210 Ga0395901_0076864 3300038443 Bacteria 3484
211 Ga0395901_0495702 3300038443 Bacteria 1244
212 Ga0395901_1560280 3300038443 Bacteria 615
213 Ga0466966_0826794 3300044684 Unclassified 558
214 Ga0466961_0135703 3300044693 Bacteria 1542
215 Ga0466970_0450334 3300044765 Bacteria 738
216 Ga0466959_0279445 3300045049 Bacteria 1146
217 Ga0466967_1693746 3300045976 Bacteria 630
218 Ga0495629_0448848 3300046459 Unclassified 873
219 Ga0495641_0219090 3300046461 Bacteria 854
220 Ga0495651_0656885 3300046462 Unclassified 657
221 Ga0495582_0489095 3300046473 Bacteria 711
222 Ga0495596_0140187 3300046500 Bacteria 939
223 Ga0495609_0256766 3300046538 Bacteria 719
224 Ga0495634_0218850 3300046642 Bacteria 1176
225 Ga0495635_1073388 3300046663 Bacteria 510
226 Ga0495658_0862469 3300046683 Unclassified 579
227 Ga0495600_0293783 3300046809 Bacteria 1026
228 Ga0495600_0541708 3300046809 Bacteria 712
229 Ga0495614_0048732 3300048089 Bacteria 1816
230 Ga0496100_0450501 3300048903 Bacteria 986
231 Ga0496101_0578757 3300048904 Bacteria 888
232 Ga0496101_1240194 3300048904 Bacteria 584
233 Ga0496102_0092998 3300048905 Bacteria 2793
234 Ga0496103_0212470 3300048906 Bacteria 1244
235 Ga0496104_0006532 3300048907 Bacteria 10253
236 Ga0496104_0891012 3300048907 Bacteria 795
237 Ga0496105_0059456 3300048908 Bacteria 3153
238 Ga0496106_0018681 3300048909 Bacteria 5133
239 Ga0496107_0028453 3300048910 Bacteria 3972
240 Ga0496108_0005519 3300048911 Bacteria 10230
241 Ga0496109_0060632 3300048912 Bacteria 3457
242 Ga0496110_0297751 3300048913 Bacteria 1469
243 Ga0496111_0082729 3300048914 Bacteria 2345
244 Ga0496111_0254026 3300048914 Bacteria 1304
245 Ga0496111_0312572 3300048914 Bacteria 1164
246 Ga0496112_0000837 3300048915 Bacteria 21923
247 Ga0496112_0015668 3300048915 Bacteria 7080
248 Ga0496112_0141972 3300048915 Bacteria 2371
249 Ga0496112_0219202 3300048915 Bacteria 1859
250 Ga0496112_0799264 3300048915 Bacteria 868
251 Ga0496112_0938978 3300048915 Bacteria 786
252 Ga0496113_0013998 3300048916 Bacteria 5458
253 Ga0496113_0284239 3300048916 Bacteria 1323
254 Ga0496114_0454184 3300048917 Bacteria 1135
255 Ga0501039_0301453 3300049575 Bacteria 1260
256 Ga0501040_0453591 3300049576 Unclassified 923
257 Ga0501041_0357175 3300049577 Bacteria 924
258 Ga0501068_0529532 3300049584 Bacteria 765
259 Ga0501068_0931782 3300049584 Unclassified 572
260 Ga0501069_0915420 3300049585 Bacteria 534
261 Ga0501070_0805927 3300049586 Bacteria 737
262 Ga0501075_0150836 3300049591 Bacteria 1772
263 Ga0501081_0594343 3300049743 Bacteria 828
264 Ga0501081_0718267 3300049743 Bacteria 750
265 Ga0501081_1071759 3300049743 Bacteria 610
266 Ga0501045_0552045 3300049824 Bacteria 854
267 nmdc:mga00v17_90481_c1 3300050491 Bacteria 1921
268 nmdc:mga0yw44_1268_c1 3300050492 Bacteria 9942
269 nmdc:mga05p37_172420_c1 3300050507 Bacteria 2638
270 nmdc:mga05p37_176985_c1 3300050507 Bacteria 2598
271 nmdc:mga05p37_610879_c1 3300050507 Bacteria 1229
272 nmdc:mga09592_108523_c1 3300050508 Bacteria 2381
273 nmdc:mga0qj67_168459_c1 3300050509 Bacteria 1779
274 nmdc:mga06r32_1244365_c1 3300050510 Bacteria 690
275 nmdc:mga06r32_164473_c1 3300050510 Bacteria 2201
276 nmdc:mga06r32_165045_c1 3300050510 Bacteria 2198
277 nmdc:mga08y16_337028_c1 3300050511 Bacteria 1551
278 nmdc:mga0n895_10516_c1 3300050512 Bacteria 8184
279 nmdc:mga0n895_89281_c1 3300050512 Bacteria 3083
280 nmdc:mga0rr50_200131_c1 3300050513 Bacteria 1641
281 nmdc:mga0rr50_567452_c1 3300050513 Bacteria 967
282 nmdc:mga0a205_117089_c1 3300050515 Bacteria 2563
283 nmdc:mga0a205_364435_c1 3300050515 Bacteria 1311
284 nmdc:mga0a205_8632_c1 3300050515 Bacteria 9272
285 nmdc:mga0a205_934_c2 3300050515 Bacteria 7669
286 Ga0495655_0122438 3300053083 Bacteria 793
287 Ga0466962_0177441 3300061719 Bacteria 1038

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_13002947 Ga0105243_130029471 90
2 3300005338 Ga0068868_100718802 Ga0068868_1007188022 94
3 3300005340 Ga0070689_100946969 Ga0070689_1009469691 94
4 3300005341 Ga0070691_10735835 Ga0070691_107358352 94
5 3300005345 Ga0070692_10476426 Ga0070692_104764261 94
6 3300005345 Ga0070692_10519503 Ga0070692_105195032 94
7 3300005354 Ga0070675_102102181 Ga0070675_1021021811 94
8 3300005356 Ga0070674_100730776 Ga0070674_1007307762 94
9 3300005439 Ga0070711_101136571 Ga0070711_1011365711 94
10 3300005444 Ga0070694_100121921 Ga0070694_1001219212 94
11 3300005459 Ga0068867_100123730 Ga0068867_1001237304 94
12 3300005459 Ga0068867_101592943 Ga0068867_1015929431 94
13 3300005459 Ga0068867_102380855 Ga0068867_1023808551 94
14 3300005467 Ga0070706_101428272 Ga0070706_1014282722 94
15 3300005467 Ga0070706_101737030 Ga0070706_1017370302 94
16 3300005518 Ga0070699_100607284 Ga0070699_1006072842 94
17 3300005544 Ga0070686_101661426 Ga0070686_1016614261 94
18 3300005719 Ga0068861_100524617 Ga0068861_1005246172 94
19 3300005719 Ga0068861_100691226 Ga0068861_1006912262 94
20 3300006038 Ga0075365_10005759 Ga0075365_100057593 94
21 3300006038 Ga0075365_11124033 Ga0075365_111240331 94
22 3300006051 Ga0075364_10320210 Ga0075364_103202102 94
23 3300006844 Ga0075428_100120631 Ga0075428_1001206312 94
24 3300006846 Ga0075430_100098260 Ga0075430_1000982604 94
25 3300006847 Ga0075431_100010449 Ga0075431_1000104493 94
26 3300006847 Ga0075431_100737949 Ga0075431_1007379492 94
27 3300006880 Ga0075429_100002784 Ga0075429_10000278416 94
28 3300006881 Ga0068865_101454522 Ga0068865_1014545221 94
29 3300009098 Ga0105245_11118735 Ga0105245_111187352 94
30 3300009147 Ga0114129_10003763 Ga0114129_1000376316 94
31 3300009147 Ga0114129_10579990 Ga0114129_105799903 94
32 3300009147 Ga0114129_10673303 Ga0114129_106733032 94
33 3300009148 Ga0105243_10038425 Ga0105243_100384255 94
34 3300009148 Ga0105243_10278439 Ga0105243_102784392 94
35 3300009148 Ga0105243_10568880 Ga0105243_105688802 94
36 3300009148 Ga0105243_10602135 Ga0105243_106021352 94
37 3300009148 Ga0105243_11215969 Ga0105243_112159692 94
38 3300009176 Ga0105242_10162020 Ga0105242_101620204 94
39 3300009176 Ga0105242_10307056 Ga0105242_103070563 94
40 3300009176 Ga0105242_11601424 Ga0105242_116014242 94
41 3300009177 Ga0105248_12090450 Ga0105248_120904502 94
42 3300009553 Ga0105249_10523790 Ga0105249_105237902 94
43 3300010375 Ga0105239_10924381 Ga0105239_109243813 94
44 3300010375 Ga0105239_11590588 Ga0105239_115905881 94
45 3300010375 Ga0105239_12236062 Ga0105239_122360622 94
46 3300011119 Ga0105246_10544985 Ga0105246_105449852 94
47 3300011119 Ga0105246_12176309 Ga0105246_121763091 94
48 3300013297 Ga0157378_10270849 Ga0157378_102708492 94
49 3300013306 Ga0163162_10778976 Ga0163162_107789763 94
50 3300013308 Ga0157375_11690695 Ga0157375_116906952 94
51 3300014325 Ga0163163_10162900 Ga0163163_101629002 94
52 3300014497 Ga0182008_10503892 Ga0182008_105038922 94
53 3300025910 Ga0207684_11242181 Ga0207684_112421812 94
54 3300025926 Ga0207659_11108608 Ga0207659_111086081 94
55 3300025927 Ga0207687_10938342 Ga0207687_109383422 94
56 3300025927 Ga0207687_11655716 Ga0207687_116557162 94
57 3300025935 Ga0207709_10359827 Ga0207709_103598272 94
58 3300025935 Ga0207709_10621673 Ga0207709_106216732 94
59 3300025937 Ga0207669_10032858 Ga0207669_100328582 94
60 3300025939 Ga0207665_11033665 Ga0207665_110336652 94
61 3300025961 Ga0207712_10630028 Ga0207712_106300282 94
62 3300025972 Ga0207668_11560415 Ga0207668_115604152 94
63 3300026023 Ga0207677_11700528 Ga0207677_117005282 94
64 3300026067 Ga0207678_10842548 Ga0207678_108425482 94
65 3300026075 Ga0207708_10356057 Ga0207708_103560572 94
66 3300026089 Ga0207648_10298709 Ga0207648_102987092 94
67 3300026089 Ga0207648_11480215 Ga0207648_114802152 94
68 3300026095 Ga0207676_10943595 Ga0207676_109435952 94
69 3300026118 Ga0207675_100814720 Ga0207675_1008147202 94
70 3300031548 Ga0307408_100150931 Ga0307408_1001509313 94
71 3300031548 Ga0307408_101498901 Ga0307408_1014989012 94
72 3300031731 Ga0307405_10109269 Ga0307405_101092692 94
73 3300031824 Ga0307413_10030813 Ga0307413_100308135 94
74 3300031995 Ga0307409_100012707 Ga0307409_1000127073 94
75 3300031995 Ga0307409_102393655 Ga0307409_1023936552 94
76 3300032004 Ga0307414_10119968 Ga0307414_101199685 94
77 3300032126 Ga0307415_100020799 Ga0307415_1000207996 94
78 3300037418 Ga0395900_1373631 Ga0395900_1373631_296_580 94
79 3300038443 Ga0395901_0495702 Ga0395901_0495702_158_442 94
80 3300038443 Ga0395901_1560280 Ga0395901_1560280_87_371 94
81 3300046461 Ga0495641_0219090 Ga0495641_0219090_497_781 94
82 3300046473 Ga0495582_0489095 Ga0495582_0489095_275_559 94
83 3300048904 Ga0496101_0578757 Ga0496101_0578757_327_611 94
84 3300048904 Ga0496101_1240194 Ga0496101_1240194_129_413 94
85 3300048907 Ga0496104_0891012 Ga0496104_0891012_126_410 94
86 3300048912 Ga0496109_0060632 Ga0496109_0060632_2169_2453 94
87 3300048914 Ga0496111_0082729 Ga0496111_0082729_1467_1751 94
88 3300048914 Ga0496111_0312572 Ga0496111_0312572_215_499 94
89 3300048915 Ga0496112_0141972 Ga0496112_0141972_1997_2281 94
90 3300048915 Ga0496112_0219202 Ga0496112_0219202_742_1026 94
91 3300048915 Ga0496112_0799264 Ga0496112_0799264_396_680 94
92 3300048915 Ga0496112_0938978 Ga0496112_0938978_103_387 94
93 3300048916 Ga0496113_0284239 Ga0496113_0284239_432_716 94
94 3300049575 Ga0501039_0301453 Ga0501039_0301453_746_1030 94
95 3300049576 Ga0501040_0453591 Ga0501040_0453591_566_850 94
96 3300049577 Ga0501041_0357175 Ga0501041_0357175_58_342 94
97 3300049584 Ga0501068_0529532 Ga0501068_0529532_426_710 94
98 3300049584 Ga0501068_0931782 Ga0501068_0931782_77_361 94
99 3300049586 Ga0501070_0805927 Ga0501070_0805927_422_706 94
100 3300049591 Ga0501075_0150836 Ga0501075_0150836_958_1242 94
101 3300049743 Ga0501081_0594343 Ga0501081_0594343_421_705 94
102 3300049743 Ga0501081_0718267 Ga0501081_0718267_210_494 94
103 3300049743 Ga0501081_1071759 Ga0501081_1071759_121_405 94
104 3300049824 Ga0501045_0552045 Ga0501045_0552045_448_732 94
105 3300050491 nmdc:mga00v17_90481_c1 nmdc:mga00v17_90481_c1_784_1068 94
106 3300050492 nmdc:mga0yw44_1268_c1 nmdc:mga0yw44_1268_c1_8000_8284 94
107 3300050507 nmdc:mga05p37_172420_c1 nmdc:mga05p37_172420_c1_2258_2545 94
108 3300050507 nmdc:mga05p37_176985_c1 nmdc:mga05p37_176985_c1_1157_1441 94
109 3300050508 nmdc:mga09592_108523_c1 nmdc:mga09592_108523_c1_819_1103 94
110 3300050509 nmdc:mga0qj67_168459_c1 nmdc:mga0qj67_168459_c1_61_345 94
111 3300050510 nmdc:mga06r32_164473_c1 nmdc:mga06r32_164473_c1_1708_1992 94
112 3300050510 nmdc:mga06r32_165045_c1 nmdc:mga06r32_165045_c1_1872_2156 94
113 3300050512 nmdc:mga0n895_10516_c1 nmdc:mga0n895_10516_c1_1596_1883 94
114 3300050513 nmdc:mga0rr50_567452_c1 nmdc:mga0rr50_567452_c1_624_911 94
115 3300050515 nmdc:mga0a205_364435_c1 nmdc:mga0a205_364435_c1_248_532 94
116 3300050515 nmdc:mga0a205_8632_c1 nmdc:mga0a205_8632_c1_901_1188 94
117 3300053083 Ga0495655_0122438 Ga0495655_0122438_117_401 94
118 3300005329 Ga0070683_100897528 Ga0070683_1008975282 95
119 3300005347 Ga0070668_100445582 Ga0070668_1004455822 95
120 3300005435 Ga0070714_101222992 Ga0070714_1012229922 95
121 3300005439 Ga0070711_101438916 Ga0070711_1014389162 95
122 3300006175 Ga0070712_100000050 Ga0070712_10000005041 95
123 3300014969 Ga0157376_10068481 Ga0157376_100684814 95
124 3300025915 Ga0207693_10000151 Ga0207693_1000015140 95
125 3300025917 Ga0207660_10873526 Ga0207660_108735262 95
126 3300025944 Ga0207661_10874578 Ga0207661_108745782 95
127 3300026118 Ga0207675_100451233 Ga0207675_1004512332 95
128 3300035117 Ga0373953_0148075 Ga0373953_0148075_387_674 95
129 3300036401 Ga0373937_0005520 Ga0373937_0005520_2771_3058 95
130 3300044684 Ga0466966_0826794 Ga0466966_0826794_141_431 95
131 3300044693 Ga0466961_0135703 Ga0466961_0135703_234_521 95
132 3300044765 Ga0466970_0450334 Ga0466970_0450334_158_448 95
133 3300045049 Ga0466959_0279445 Ga0466959_0279445_333_623 95
134 3300045976 Ga0466967_1693746 Ga0466967_1693746_53_340 95
135 3300046459 Ga0495629_0448848 Ga0495629_0448848_308_595 95
136 3300046462 Ga0495651_0656885 Ga0495651_0656885_55_342 95
137 3300046642 Ga0495634_0218850 Ga0495634_0218850_401_688 95
138 3300046663 Ga0495635_1073388 Ga0495635_1073388_38_325 95
139 3300046683 Ga0495658_0862469 Ga0495658_0862469_126_413 95
140 3300046809 Ga0495600_0293783 Ga0495600_0293783_582_869 95
141 3300046809 Ga0495600_0541708 Ga0495600_0541708_373_660 95
142 3300048915 Ga0496112_0000837 Ga0496112_0000837_20490_20777 95
143 3300049585 Ga0501069_0915420 Ga0501069_0915420_36_323 95
144 3300061719 Ga0466962_0177441 Ga0466962_0177441_321_608 95
145 3300005365 Ga0070688_100571700 Ga0070688_1005717002 96
146 3300005466 Ga0070685_10910843 Ga0070685_109108432 96
147 3300046500 Ga0495596_0140187 Ga0495596_0140187_57_347 96
148 3300046538 Ga0495609_0256766 Ga0495609_0256766_413_703 96
149 3300048089 Ga0495614_0048732 Ga0495614_0048732_1209_1499 96
150 3300050515 nmdc:mga0a205_934_c2 nmdc:mga0a205_934_c2_3960_4250 96
151 3300002073 JGI24745J21846_1017501 JGI24745J21846_10175012 97
152 3300002076 JGI24749J21850_1079703 JGI24749J21850_10797032 97
153 3300002077 JGI24744J21845_10085623 JGI24744J21845_100856232 97
154 3300005327 Ga0070658_10399021 Ga0070658_103990212 97
155 3300005329 Ga0070683_100017579 Ga0070683_1000175791 97
156 3300005330 Ga0070690_101150223 Ga0070690_1011502232 97
157 3300005331 Ga0070670_100212136 Ga0070670_1002121362 97
158 3300005337 Ga0070682_100001883 Ga0070682_10000188314 97
159 3300005338 Ga0068868_100018909 Ga0068868_1000189096 97
160 3300005339 Ga0070660_101490488 Ga0070660_1014904882 97
161 3300005340 Ga0070689_100643348 Ga0070689_1006433482 97
162 3300005341 Ga0070691_10068952 Ga0070691_100689522 97
163 3300005344 Ga0070661_100124990 Ga0070661_1001249903 97
164 3300005347 Ga0070668_100137426 Ga0070668_1001374263 97
165 3300005347 Ga0070668_100338439 Ga0070668_1003384393 97
166 3300005354 Ga0070675_100272664 Ga0070675_1002726642 97
167 3300005356 Ga0070674_100226676 Ga0070674_1002266762 97
168 3300005364 Ga0070673_100086323 Ga0070673_1000863232 97
169 3300005365 Ga0070688_100089185 Ga0070688_1000891852 97
170 3300005366 Ga0070659_100934898 Ga0070659_1009348982 97
171 3300005437 Ga0070710_10059449 Ga0070710_100594492 97
172 3300005439 Ga0070711_100018337 Ga0070711_1000183372 97
173 3300005440 Ga0070705_100142921 Ga0070705_1001429213 97
174 3300005441 Ga0070700_100066992 Ga0070700_1000669921 97
175 3300005456 Ga0070678_100057118 Ga0070678_1000571182 97
176 3300005457 Ga0070662_100528825 Ga0070662_1005288252 97
177 3300005535 Ga0070684_100004775 Ga0070684_1000047757 97
178 3300005539 Ga0068853_100127390 Ga0068853_1001273902 97
179 3300005545 Ga0070695_100159954 Ga0070695_1001599542 97
180 3300005549 Ga0070704_102185246 Ga0070704_1021852462 97
181 3300005563 Ga0068855_100418408 Ga0068855_1004184083 97
182 3300005564 Ga0070664_100309724 Ga0070664_1003097242 97
183 3300005577 Ga0068857_100495521 Ga0068857_1004955212 97
184 3300005614 Ga0068856_100014289 Ga0068856_1000142896 97
185 3300005615 Ga0070702_100175146 Ga0070702_1001751462 97
186 3300005616 Ga0068852_100156657 Ga0068852_1001566572 97
187 3300005618 Ga0068864_100007268 Ga0068864_1000072686 97
188 3300005719 Ga0068861_100157871 Ga0068861_1001578713 97
189 3300005842 Ga0068858_100818528 Ga0068858_1008185282 97
190 3300005843 Ga0068860_101320687 Ga0068860_1013206872 97
191 3300006058 Ga0075432_10090437 Ga0075432_100904373 97
192 3300006163 Ga0070715_10431776 Ga0070715_104317762 97
193 3300006173 Ga0070716_101027757 Ga0070716_1010277572 97
194 3300006175 Ga0070712_100041267 Ga0070712_1000412673 97
195 3300006358 Ga0068871_100335519 Ga0068871_1003355192 97
196 3300006846 Ga0075430_100487050 Ga0075430_1004870502 97
197 3300006852 Ga0075433_10855908 Ga0075433_108559082 97
198 3300006871 Ga0075434_100005013 Ga0075434_1000050137 97
199 3300006871 Ga0075434_101155992 Ga0075434_1011559922 97
200 3300006881 Ga0068865_100162298 Ga0068865_1001622983 97
201 3300006914 Ga0075436_100045428 Ga0075436_1000454282 97
202 3300007076 Ga0075435_100446187 Ga0075435_1004461873 97
203 3300009094 Ga0111539_10011916 Ga0111539_100119163 97
204 3300009094 Ga0111539_10674497 Ga0111539_106744972 97
205 3300009098 Ga0105245_10016242 Ga0105245_100162426 97
206 3300009147 Ga0114129_10252855 Ga0114129_102528554 97
207 3300009148 Ga0105243_10021911 Ga0105243_100219113 97
208 3300009177 Ga0105248_10267863 Ga0105248_102678633 97
209 3300009553 Ga0105249_10392548 Ga0105249_103925483 97
210 3300010375 Ga0105239_10505599 Ga0105239_105055993 97
211 3300011119 Ga0105246_10027744 Ga0105246_100277446 97
212 3300013296 Ga0157374_10039021 Ga0157374_100390213 97
213 3300013297 Ga0157378_12277820 Ga0157378_122778201 97
214 3300013306 Ga0163162_10234231 Ga0163162_102342312 97
215 3300013306 Ga0163162_10257020 Ga0163162_102570203 97
216 3300013306 Ga0163162_10332932 Ga0163162_103329321 97
217 3300013307 Ga0157372_10023795 Ga0157372_100237956 97
218 3300014325 Ga0163163_10076731 Ga0163163_100767316 97
219 3300014326 Ga0157380_10351661 Ga0157380_103516612 97
220 3300014326 Ga0157380_10380368 Ga0157380_103803682 97
221 3300014968 Ga0157379_10375836 Ga0157379_103758362 97
222 3300014969 Ga0157376_10549831 Ga0157376_105498311 97
223 3300017792 Ga0163161_10396491 Ga0163161_103964912 97
224 3300025898 Ga0207692_10042755 Ga0207692_100427553 97
225 3300025901 Ga0207688_10004983 Ga0207688_100049836 97
226 3300025909 Ga0207705_10335341 Ga0207705_103353412 97
227 3300025915 Ga0207693_10008782 Ga0207693_100087826 97
228 3300025916 Ga0207663_10200493 Ga0207663_102004932 97
229 3300025919 Ga0207657_10434362 Ga0207657_104343622 97
230 3300025920 Ga0207649_10279978 Ga0207649_102799782 97
231 3300025925 Ga0207650_10274644 Ga0207650_102746442 97
232 3300025926 Ga0207659_11741244 Ga0207659_117412442 97
233 3300025927 Ga0207687_10014607 Ga0207687_100146076 97
234 3300025931 Ga0207644_10194912 Ga0207644_101949122 97
235 3300025932 Ga0207690_11298501 Ga0207690_112985012 97
236 3300025933 Ga0207706_10175192 Ga0207706_101751924 97
237 3300025933 Ga0207706_10391451 Ga0207706_103914512 97
238 3300025935 Ga0207709_11175292 Ga0207709_111752922 97
239 3300025936 Ga0207670_10190102 Ga0207670_101901022 97
240 3300025938 Ga0207704_10660075 Ga0207704_106600752 97
241 3300025941 Ga0207711_10473781 Ga0207711_104737812 97
242 3300025944 Ga0207661_10917918 Ga0207661_109179182 97
243 3300025945 Ga0207679_11279765 Ga0207679_112797652 97
244 3300025960 Ga0207651_10062847 Ga0207651_100628473 97
245 3300025961 Ga0207712_10405243 Ga0207712_104052432 97
246 3300025961 Ga0207712_11393905 Ga0207712_113939052 97
247 3300025972 Ga0207668_10086974 Ga0207668_100869743 97
248 3300025972 Ga0207668_10117008 Ga0207668_101170083 97
249 3300025981 Ga0207640_10132009 Ga0207640_101320092 97
250 3300026023 Ga0207677_10328788 Ga0207677_103287882 97
251 3300026035 Ga0207703_10350725 Ga0207703_103507252 97
252 3300026041 Ga0207639_10057073 Ga0207639_100570733 97
253 3300026075 Ga0207708_10001807 Ga0207708_100018079 97
254 3300026078 Ga0207702_10035146 Ga0207702_100351463 97
255 3300026095 Ga0207676_10652665 Ga0207676_106526652 97
256 3300026116 Ga0207674_10468419 Ga0207674_104684192 97
257 3300026118 Ga0207675_100237542 Ga0207675_1002375423 97
258 3300026118 Ga0207675_100471335 Ga0207675_1004713353 97
259 3300026118 Ga0207675_100570830 Ga0207675_1005708302 97
260 3300026121 Ga0207683_10050815 Ga0207683_100508153 97
261 3300026142 Ga0207698_10026795 Ga0207698_100267954 97
262 3300027907 Ga0207428_10024640 Ga0207428_100246403 97
263 3300032002 Ga0307416_101188268 Ga0307416_1011882682 97
264 3300037312 Ga0395899_0482439 Ga0395899_0482439_213_506 97
265 3300037466 Ga0395898_0438577 Ga0395898_0438577_634_927 97
266 3300037471 Ga0395905_0825968 Ga0395905_0825968_146_439 97
267 3300037471 Ga0395905_1135637 Ga0395905_1135637_297_590 97
268 3300038443 Ga0395901_0076864 Ga0395901_0076864_2321_2614 97
269 3300048903 Ga0496100_0450501 Ga0496100_0450501_229_522 97
270 3300048905 Ga0496102_0092998 Ga0496102_0092998_447_740 97
271 3300048906 Ga0496103_0212470 Ga0496103_0212470_225_518 97
272 3300048907 Ga0496104_0006532 Ga0496104_0006532_412_705 97
273 3300048908 Ga0496105_0059456 Ga0496105_0059456_2152_2445 97
274 3300048909 Ga0496106_0018681 Ga0496106_0018681_1317_1610 97
275 3300048910 Ga0496107_0028453 Ga0496107_0028453_3142_3435 97
276 3300048911 Ga0496108_0005519 Ga0496108_0005519_706_999 97
277 3300048913 Ga0496110_0297751 Ga0496110_0297751_819_1112 97
278 3300048914 Ga0496111_0254026 Ga0496111_0254026_783_1076 97
279 3300048915 Ga0496112_0015668 Ga0496112_0015668_2701_2994 97
280 3300048916 Ga0496113_0013998 Ga0496113_0013998_308_601 97
281 3300048917 Ga0496114_0454184 Ga0496114_0454184_225_518 97
282 3300050507 nmdc:mga05p37_610879_c1 nmdc:mga05p37_610879_c1_540_833 97
283 3300050510 nmdc:mga06r32_1244365_c1 nmdc:mga06r32_1244365_c1_217_510 97
284 3300050511 nmdc:mga08y16_337028_c1 nmdc:mga08y16_337028_c1_320_613 97
285 3300050512 nmdc:mga0n895_89281_c1 nmdc:mga0n895_89281_c1_2538_2831 97
286 3300050513 nmdc:mga0rr50_200131_c1 nmdc:mga0rr50_200131_c1_372_665 97
287 3300050515 nmdc:mga0a205_117089_c1 nmdc:mga0a205_117089_c1_271_564 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02686

GatC

Glu-tRNAGln amidotransferase C subunit

40

111

0.95

Feature Viewer

pLDDT pTM Quality
83.81 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map