F387722

General Info

Members Datasets Scaffolds Average Seq Length
286 195 562 206

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2554235005|2554257851
Length 225
Sequence RSRRRTARALVTGGATAALVGGTLLAPGAAQAGGSGIFAPPDKIVIEIATVNGSGCPAGTAAVAVAPDNTAFTVTYSQYLAQVGVGSKPTDFRKNCQLNLIVHVPHGFTYAVASADYRGYAHLEHGAWATQKASYYFQGSPDTAARQHPFRGPYDNNWQVTDETDWGQLVWAPCGVKRNFNINTELRVSGGTSDTARTNSFIAMDSTDGDIRTVYRLAWKECPGR

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
8 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
9 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
10 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
11 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
25 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
26 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
27 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
30 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
31 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
32 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
41 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
43 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
44 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
45 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
46 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
47 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
48 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
49 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
50 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
51 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
52 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
57 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
68 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
85 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
86 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
87 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
88 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
89 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
90 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
91 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
92 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
93 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
98 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
99 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
105 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
152 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
153 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
154 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
155 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
171 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
172 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
173 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
174 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
175 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
176 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
177 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
178 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
179 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
180 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
181 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
182 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
183 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
184 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
185 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
186 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
187 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
188 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
189 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
190 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
191 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
192 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
193 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
194 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
195 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.42
Metatranscriptomes 9.09
Isolates 10.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.9
Nodule 0
Rhizoplane 1.05
Rhizosphere 82.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10080840 3300002067 Bacteria 931
2 rootH2_10017785 3300003320 Bacteria 4265
3 rootL2_10030594 3300003322 Bacteria 4063
4 rootL2_10125079 3300003322 Bacteria 2630
5 Ga0068869_100423156 3300005334 Bacteria 1099
6 Ga0068869_100471881 3300005334 Bacteria 1043
7 Ga0070668_100003885 3300005347 Bacteria 11032
8 Ga0070710_10000032 3300005437 Bacteria 64514
9 Ga0070710_10000412 3300005437 Bacteria 20127
10 Ga0070710_10000984 3300005437 Bacteria 13537
11 Ga0068854_100573180 3300005578 Bacteria 960
12 Ga0068864_100425879 3300005618 Bacteria 1265
13 Ga0068870_10125034 3300005840 Bacteria 1486
14 Ga0068863_100010973 3300005841 Bacteria 8785
15 Ga0068863_100039324 3300005841 Bacteria 4501
16 Ga0068863_100071060 3300005841 Bacteria 3293
17 Ga0068862_100281352 3300005844 Bacteria 1525
18 Ga0081455_10084431 3300005937 Bacteria 2591
19 Ga0081539_10001344 3300005985 Bacteria 42867
20 Ga0075368_10010842 3300006042 Bacteria 3305
21 Ga0075367_10010713 3300006178 Bacteria 4827
22 Ga0075370_10279739 3300006353 Bacteria 991
23 Ga0075433_10428652 3300006852 Bacteria 1166
24 Ga0105244_10028762 3300009036 Bacteria 2978
25 Ga0105250_10031118 3300009092 Bacteria 2143
26 Ga0111539_11167441 3300009094 Bacteria 895
27 Ga0105245_10124462 3300009098 Bacteria 2412
28 Ga0105245_11253368 3300009098 Bacteria 790
29 Ga0114129_10388232 3300009147 Bacteria 1842
30 Ga0105246_10008531 3300011119 Bacteria 6302
31 Ga0182008_10003747 3300014497 Bacteria 9054
32 Ga0182006_1028314 3300015261 Bacteria 2279
33 Ga0182007_10004421 3300015262 Bacteria 6371
34 Ga0206356_11871427 3300020070 Bacteria 844
35 Ga0206352_10926214 3300020078 Bacteria 831
36 Ga0256743_117593 3300023436 Bacteria 1950
37 Ga0209758_1015966 3300025297 Bacteria 3845
38 Ga0207426_1033243 3300025302 Bacteria 1664
39 Ga0207692_10000256 3300025898 Bacteria 18282
40 Ga0207692_10002748 3300025898 Bacteria 6780
41 Ga0207692_10024033 3300025898 Bacteria 2827
42 Ga0207692_10049265 3300025898 Bacteria 2125
43 Ga0207647_10150898 3300025904 Bacteria 1358
44 Ga0207643_10158257 3300025908 Bacteria 1362
45 Ga0207687_10011474 3300025927 Bacteria 5791
46 Ga0207687_10102105 3300025927 Bacteria 2112
47 Ga0207687_10682173 3300025927 Bacteria 871
48 Ga0207689_10431525 3300025942 Bacteria 1100
49 Ga0207668_10006122 3300025972 Bacteria 7097
50 Ga0207641_10005001 3300026088 Bacteria 11364
51 Ga0207641_10058992 3300026088 Bacteria 3267
52 Ga0207641_10173695 3300026088 Bacteria 1969
53 Ga0207676_10918411 3300026095 Bacteria 859
54 Ga0209813_10004593 3300027866 Bacteria 3305
55 Ga0268265_10262465 3300028380 Bacteria 1536
56 Ga0307517_10006947 3300028786 Bacteria 16634
57 Ga0307515_10000262 3300028794 Bacteria 130525
58 Ga0311001_1022939 3300029277 Bacteria 1195
59 Ga0310981_1051348 3300029285 Bacteria 1382
60 Ga0307512_10030270 3300030522 Bacteria 4713
61 Ga0307512_10264387 3300030522 Bacteria 841
62 Ga0316177_1073527 3300030731 Bacteria 1052
63 Ga0316176_1013856 3300030732 Bacteria 2017
64 Ga0316176_1063144 3300030732 Bacteria 4211
65 Ga0316176_1102700 3300030732 Bacteria 2515
66 Ga0316176_1122087 3300030732 Bacteria 1701
67 Ga0314311_1043240 3300030733 Bacteria 5659
68 Ga0314311_1048258 3300030733 Bacteria 11996
69 Ga0314311_1125783 3300030733 Bacteria 15157
70 Ga0316178_1003831 3300030735 Bacteria 1037
71 Ga0316180_1098196 3300030736 Bacteria 3510
72 Ga0316180_1102309 3300030736 Bacteria 2138
73 Ga0316180_1128875 3300030736 Bacteria 1866
74 Ga0316182_1258695 3300030745 Bacteria 812
75 Ga0307513_10166992 3300031456 Bacteria 2083
76 Ga0307509_10065052 3300031507 Bacteria 3832
77 Ga0307509_10082846 3300031507 Bacteria 3308
78 Ga0307509_10190460 3300031507 Bacteria 1903
79 Ga0307509_10264788 3300031507 Bacteria 1491
80 Ga0307509_10420760 3300031507 Bacteria 1037
81 Ga0307508_10012394 3300031616 Bacteria 7796
82 Ga0307508_10262514 3300031616 Bacteria 1321
83 Ga0307508_10445803 3300031616 Bacteria 887
84 Ga0307516_10043450 3300031730 Bacteria 4453
85 Ga0307518_10001068 3300031838 Bacteria 20520
86 Ga0307518_10270485 3300031838 Bacteria 1061
87 Ga0307411_10439311 3300032005 Bacteria 1088
88 Ga0316593_10039195 3300032168 Bacteria 1571
89 Ga0307507_10024968 3300033179 Bacteria 6495
90 Ga0307510_10002990 3300033180 Bacteria 19443
91 Ga0395899_0347534 3300037312 Bacteria 993
92 Ga0395900_0103596 3300037418 Bacteria 2923
93 Ga0395898_0008924 3300037466 Bacteria 10559
94 Ga0395898_0082204 3300037466 Bacteria 3105
95 Ga0395898_0748042 3300037466 Bacteria 919
96 Ga0436364_0239013 3300037853 Bacteria 22441
97 Ga0395901_0082942 3300038443 Bacteria 3350
98 Ga0395901_0943382 3300038443 Bacteria 842
99 Ga0451801_36469 3300041455 Bacteria 677
100 Ga0439448_0073031 3300042005 Bacteria 1144
101 Ga0466972_0000546 3300044658 Bacteria 18447
102 Ga0466972_0015314 3300044658 Bacteria 3833
103 Ga0466972_0027112 3300044658 Bacteria 2836
104 Ga0466972_0065861 3300044658 Bacteria 1732
105 Ga0466972_0074274 3300044658 Bacteria 1620
106 Ga0466965_0001699 3300044683 Bacteria 9032
107 Ga0466965_0001969 3300044683 Bacteria 8585
108 Ga0466965_0003646 3300044683 Bacteria 6788
109 Ga0466965_0003713 3300044683 Bacteria 6739
110 Ga0466965_0003894 3300044683 Bacteria 6599
111 Ga0466965_0003936 3300044683 Bacteria 6576
112 Ga0466965_0022666 3300044683 Bacteria 3028
113 Ga0466965_0082707 3300044683 Bacteria 1624
114 Ga0466965_0336705 3300044683 Bacteria 824
115 Ga0466963_0079337 3300044694 Bacteria 2221
116 Ga0466964_0310884 3300044706 Bacteria 797
117 Ga0466968_0006381 3300044735 Bacteria 4443
118 Ga0466968_0014384 3300044735 Bacteria 3127
119 Ga0466957_0382151 3300044842 Bacteria 960
120 Ga0466960_0001286 3300044901 Bacteria 9106
121 Ga0466960_0015614 3300044901 Bacteria 3277
122 Ga0466960_0036833 3300044901 Bacteria 2292
123 Ga0466960_0060873 3300044901 Bacteria 1851
124 Ga0466967_0387847 3300045976 Bacteria 1357
125 Ga0495617_018961 3300046452 Bacteria 2327
126 Ga0495592_0247366 3300046454 Bacteria 1180
127 Ga0495629_0044396 3300046459 Bacteria 3119
128 Ga0495629_0171720 3300046459 Bacteria 1504
129 Ga0495629_0551545 3300046459 Bacteria 773
130 Ga0495638_0029270 3300046460 Bacteria 3552
131 Ga0495638_0170129 3300046460 Bacteria 1251
132 Ga0495651_0141602 3300046462 Bacteria 1743
133 Ga0495580_0084578 3300046472 Bacteria 2210
134 Ga0495582_0057316 3300046473 Bacteria 2148
135 Ga0495582_0116180 3300046473 Bacteria 1505
136 Ga0495605_0003217 3300046474 Bacteria 9797
137 Ga0495639_0061333 3300046475 Bacteria 1724
138 Ga0495662_0012145 3300046476 Bacteria 4207
139 Ga0495594_0066056 3300046499 Bacteria 2006
140 Ga0495594_0349275 3300046499 Bacteria 842
141 Ga0495596_0034726 3300046500 Bacteria 2001
142 Ga0495607_0176724 3300046501 Bacteria 1073
143 Ga0495583_0068913 3300046506 Bacteria 1559
144 Ga0495583_0148407 3300046506 Bacteria 973
145 Ga0495606_0050555 3300046507 Bacteria 2718
146 Ga0495608_0222962 3300046511 Bacteria 1182
147 Ga0495616_0039486 3300046513 Bacteria 2417
148 Ga0495618_0272889 3300046514 Bacteria 1056
149 Ga0495620_0010369 3300046515 Bacteria 4917
150 Ga0495620_0022061 3300046515 Bacteria 3076
151 Ga0495630_0296526 3300046517 Bacteria 1235
152 Ga0495643_0004986 3300046522 Bacteria 9103
153 Ga0495648_0047713 3300046524 Bacteria 2644
154 Ga0495648_0103060 3300046524 Bacteria 1570
155 Ga0495666_0025969 3300046526 Bacteria 2890
156 Ga0495666_0190363 3300046526 Bacteria 945
157 Ga0495652_0103948 3300046529 Bacteria 2298
158 Ga0495640_0002741 3300046533 Bacteria 14172
159 Ga0495586_0040061 3300046535 Bacteria 2520
160 Ga0495587_0112155 3300046536 Bacteria 1566
161 Ga0495609_0059758 3300046538 Bacteria 1685
162 Ga0495597_0006883 3300046542 Bacteria 5835
163 Ga0495622_0016296 3300046557 Bacteria 3458
164 Ga0495633_0007616 3300046558 Bacteria 6200
165 Ga0495667_0048971 3300046559 Bacteria 2790
166 Ga0495668_0016203 3300046616 Bacteria 4335
167 Ga0495634_0237057 3300046642 Bacteria 1120
168 Ga0495625_0003669 3300046660 Bacteria 15029
169 Ga0495625_0176907 3300046660 Bacteria 1421
170 Ga0495635_0122384 3300046663 Bacteria 1774
171 Ga0495588_0002572 3300046674 Bacteria 7759
172 Ga0495588_0055809 3300046674 Bacteria 2039
173 Ga0495588_0339216 3300046674 Bacteria 790
174 Ga0495657_0007727 3300046675 Bacteria 8270
175 Ga0495657_0029917 3300046675 Bacteria 3817
176 Ga0495657_0058828 3300046675 Bacteria 2551
177 Ga0495623_0016394 3300046679 Bacteria 4787
178 Ga0495613_0004360 3300046689 Bacteria 10587
179 Ga0495613_0012728 3300046689 Bacteria 6255
180 Ga0495613_0013569 3300046689 Bacteria 6049
181 Ga0495613_0014898 3300046689 Bacteria 5771
182 Ga0495613_0047968 3300046689 Bacteria 3154
183 Ga0495624_0073674 3300046690 Bacteria 2122
184 Ga0495624_0166681 3300046690 Bacteria 1344
185 Ga0495671_0093196 3300046692 Bacteria 1474
186 Ga0495649_0051691 3300046694 Bacteria 2228
187 Ga0495589_0059177 3300046794 Bacteria 1883
188 Ga0495589_0063097 3300046794 Bacteria 1817
189 Ga0495600_0464297 3300046809 Bacteria 781
190 Ga0495604_0024229 3300047317 Bacteria 4842
191 Ga0495636_0065497 3300047318 Bacteria 1543
192 Ga0495636_0092634 3300047318 Bacteria 1313
193 Ga0495676_0027575 3300047321 Bacteria 4866
194 Ga0495676_0133738 3300047321 Bacteria 1786
195 Ga0495680_0018393 3300047322 Bacteria 5934
196 Ga0495687_001766 3300047443 Bacteria 19107
197 Ga0495687_003588 3300047443 Bacteria 11128
198 Ga0495675_0005489 3300047444 Bacteria 7737
199 Ga0495675_0282628 3300047444 Bacteria 989
200 Ga0495685_002372 3300047447 Bacteria 5899
201 Ga0495685_031786 3300047447 Bacteria 1813
202 Ga0495681_0000184 3300047470 Bacteria 53325
203 Ga0495681_0058222 3300047470 Bacteria 1791
204 Ga0495684_0125791 3300047471 Bacteria 1929
205 Ga0495686_0061963 3300047472 Bacteria 2321
206 Ga0495686_0149116 3300047472 Bacteria 1374
207 Ga0495593_0041376 3300047673 Bacteria 2477
208 Ga0495593_0254822 3300047673 Bacteria 878
209 Ga0495614_0224566 3300048089 Bacteria 854
210 Ga0496110_0769654 3300048913 Bacteria 866
211 Ga0501033_0002231 3300049570 Bacteria 16660
212 Ga0501034_0444247 3300049571 Bacteria 1215
213 Ga0501038_0004397 3300049574 Bacteria 13117
214 Ga0501046_0231002 3300049580 Bacteria 1367
215 Ga0501047_0050457 3300049581 Bacteria 4018
216 Ga0501069_0366985 3300049585 Bacteria 850
217 Ga0501074_0410884 3300049590 Bacteria 960
218 Ga0501035_0080892 3300049822 Bacteria 2868
219 Ga0501035_0327313 3300049822 Bacteria 1286
220 Ga0501044_0021810 3300049823 Bacteria 6830
221 nmdc:mga03n38_285874_c1 3300050490 Bacteria 882
222 nmdc:mga06z11_575_c1 3300050494 Bacteria 13431
223 nmdc:mga04h51_4421_c1 3300050495 Bacteria 3497
224 nmdc:mga07m45_322350_c1 3300050496 Bacteria 898
225 nmdc:mga05p37_1197380_c1 3300050507 Bacteria 785
226 nmdc:mga06r32_953103_c1 3300050510 Bacteria 812
227 nmdc:mga0a205_250524_c1 3300050515 Bacteria 1650
228 nmdc:mga0a205_616094_c1 3300050515 Bacteria 938
229 Ga0500644_0010466 3300053088 Bacteria 2513
230 Ga0500560_002115 3300053107 Bacteria 3709
231 Ga0500577_0008515 3300053142 Bacteria 2929
232 Ga0500634_0272818 3300053161 Bacteria 688
233 Ga0587070_006449 3300059491 Bacteria 1584
234 Ga0587073_0018630 3300059492 Bacteria 1300
235 Ga0587088_008373 3300059508 Bacteria 1460
236 Ga0587092_006289 3300059512 Bacteria 1498
237 Ga0587106_007138 3300059605 Bacteria 1346
238 Ga0587125_006373 3300059607 Bacteria 1113
239 Ga0587109_013012 3300059624 Bacteria 1374
240 Ga0587062_005115 3300059639 Bacteria 1432
241 Ga0587067_038599 3300059640 Bacteria 918
242 Ga0587072_011901 3300059643 Bacteria 1429
243 Ga0587076_005688 3300059645 Bacteria 1625
244 Ga0587105_006342 3300059651 Bacteria 810
245 Ga0587119_002707 3300059658 Bacteria 1626
246 Ga0587071_006837 3300060344 Bacteria 1799
247 Ga0587071_082017 3300060344 Bacteria 720
248 Ga0587111_0001622 3300060346 Bacteria 2776
249 Ga0587111_0011284 3300060346 Bacteria 1554
250 Ga0587111_0078058 3300060346 Bacteria 786
251 Ga0587111_0094249 3300060346 Bacteria 736
252 2554257851 2554235005 Bacteria 6457341
253 2616697813 2616644814 Bacteria 11555299
254 2785344855 2784746763 Bacteria 9783172
255 2793985036 2791355406 Bacteria 11364898
256 2808919552 2808606375 Bacteria 9466072
257 2809589956 2808606522 Bacteria 9488490
258 2811844804 2808606982 Bacteria 7791042
259 2862180153 2862178590 Bacteria 8583590
260 2866612308 2866612099 Bacteria 7543886
261 2899361718 2899359706 Bacteria 10940472
262 2915770526 2915768154 Bacteria 8424322
263 2997606733 2997600082 Bacteria 9896405
264 3006394136 3006393351 Bacteria 6615579
265 3006426878 3006425503 Bacteria 6491253
266 8025482071 8025478263 Bacteria 8209203
267 8025482795 8025478263 Bacteria 8209203
268 8025485145 8025478263 Bacteria 8209203
269 8033688186 8033684223 Bacteria 6906479
270 8047899759 8047893842 Bacteria 11723082
271 8048135186 8048127548 Bacteria 11053136
272 8048359171 8048356638 Bacteria 11044339
273 8048376707 8048369669 Bacteria 11666822
274 8048385760 8048379754 Bacteria 11877923
275 8053950112 8053945823 Bacteria 8962862
276 8053950473 8053945823 Bacteria 8962862
277 8053952327 8053945823 Bacteria 8962862
278 8056214158 8056207758 Bacteria 8639239
279 8056451169 8056447290 Bacteria 7680491
280 8056668893 8056667051 Bacteria 6953971
281 8056836752 8056829672 Bacteria 9045328
282 JGI24735J21928_10080840
283 rootH2_10017785
284 rootL2_10030594
285 rootL2_10125079
286 Ga0068869_100423156
287 Ga0068869_100471881
288 Ga0070668_100003885
289 Ga0070710_10000032
290 Ga0070710_10000412
291 Ga0070710_10000984
292 Ga0068854_100573180
293 Ga0068864_100425879
294 Ga0068870_10125034
295 Ga0068863_100010973
296 Ga0068863_100039324
297 Ga0068863_100071060
298 Ga0068862_100281352
299 Ga0081455_10084431
300 Ga0081539_10001344
301 Ga0075368_10010842
302 Ga0075367_10010713
303 Ga0075370_10279739
304 Ga0075433_10428652
305 Ga0105244_10028762
306 Ga0105250_10031118
307 Ga0111539_11167441
308 Ga0105245_10124462
309 Ga0105245_11253368
310 Ga0114129_10388232
311 Ga0105246_10008531
312 Ga0182008_10003747
313 Ga0182006_1028314
314 Ga0182007_10004421
315 Ga0206356_11871427
316 Ga0206352_10926214
317 Ga0256743_117593
318 Ga0209758_1015966
319 Ga0207426_1033243
320 Ga0207692_10000256
321 Ga0207692_10002748
322 Ga0207692_10024033
323 Ga0207692_10049265
324 Ga0207647_10150898
325 Ga0207643_10158257
326 Ga0207687_10011474
327 Ga0207687_10102105
328 Ga0207687_10682173
329 Ga0207689_10431525
330 Ga0207668_10006122
331 Ga0207641_10005001
332 Ga0207641_10058992
333 Ga0207641_10173695
334 Ga0207676_10918411
335 Ga0209813_10004593
336 Ga0268265_10262465
337 Ga0307517_10006947
338 Ga0307515_10000262
339 Ga0311001_1022939
340 Ga0310981_1051348
341 Ga0307512_10030270
342 Ga0307512_10264387
343 Ga0316177_1073527
344 Ga0316176_1013856
345 Ga0316176_1063144
346 Ga0316176_1102700
347 Ga0316176_1122087
348 Ga0314311_1043240
349 Ga0314311_1048258
350 Ga0314311_1125783
351 Ga0316178_1003831
352 Ga0316180_1098196
353 Ga0316180_1102309
354 Ga0316180_1128875
355 Ga0316182_1258695
356 Ga0307513_10166992
357 Ga0307509_10065052
358 Ga0307509_10082846
359 Ga0307509_10190460
360 Ga0307509_10264788
361 Ga0307509_10420760
362 Ga0307508_10012394
363 Ga0307508_10262514
364 Ga0307508_10445803
365 Ga0307516_10043450
366 Ga0307518_10001068
367 Ga0307518_10270485
368 Ga0307411_10439311
369 Ga0316593_10039195
370 Ga0307507_10024968
371 Ga0307510_10002990
372 Ga0395899_0347534
373 Ga0395900_0103596
374 Ga0395898_0008924
375 Ga0395898_0082204
376 Ga0395898_0748042
377 Ga0436364_0239013
378 Ga0395901_0082942
379 Ga0395901_0943382
380 Ga0451801_36469
381 Ga0439448_0073031
382 Ga0466972_0000546
383 Ga0466972_0015314
384 Ga0466972_0027112
385 Ga0466972_0065861
386 Ga0466972_0074274
387 Ga0466965_0001699
388 Ga0466965_0001969
389 Ga0466965_0003646
390 Ga0466965_0003713
391 Ga0466965_0003894
392 Ga0466965_0003936
393 Ga0466965_0022666
394 Ga0466965_0082707
395 Ga0466965_0336705
396 Ga0466963_0079337
397 Ga0466964_0310884
398 Ga0466968_0006381
399 Ga0466968_0014384
400 Ga0466957_0382151
401 Ga0466960_0001286
402 Ga0466960_0015614
403 Ga0466960_0036833
404 Ga0466960_0060873
405 Ga0466967_0387847
406 Ga0495617_018961
407 Ga0495592_0247366
408 Ga0495629_0044396
409 Ga0495629_0171720
410 Ga0495629_0551545
411 Ga0495638_0029270
412 Ga0495638_0170129
413 Ga0495651_0141602
414 Ga0495580_0084578
415 Ga0495582_0057316
416 Ga0495582_0116180
417 Ga0495605_0003217
418 Ga0495639_0061333
419 Ga0495662_0012145
420 Ga0495594_0066056
421 Ga0495594_0349275
422 Ga0495596_0034726
423 Ga0495607_0176724
424 Ga0495583_0068913
425 Ga0495583_0148407
426 Ga0495606_0050555
427 Ga0495608_0222962
428 Ga0495616_0039486
429 Ga0495618_0272889
430 Ga0495620_0010369
431 Ga0495620_0022061
432 Ga0495630_0296526
433 Ga0495643_0004986
434 Ga0495648_0047713
435 Ga0495648_0103060
436 Ga0495666_0025969
437 Ga0495666_0190363
438 Ga0495652_0103948
439 Ga0495640_0002741
440 Ga0495586_0040061
441 Ga0495587_0112155
442 Ga0495609_0059758
443 Ga0495597_0006883
444 Ga0495622_0016296
445 Ga0495633_0007616
446 Ga0495667_0048971
447 Ga0495668_0016203
448 Ga0495634_0237057
449 Ga0495625_0003669
450 Ga0495625_0176907
451 Ga0495635_0122384
452 Ga0495588_0002572
453 Ga0495588_0055809
454 Ga0495588_0339216
455 Ga0495657_0007727
456 Ga0495657_0029917
457 Ga0495657_0058828
458 Ga0495623_0016394
459 Ga0495613_0004360
460 Ga0495613_0012728
461 Ga0495613_0013569
462 Ga0495613_0014898
463 Ga0495613_0047968
464 Ga0495624_0073674
465 Ga0495624_0166681
466 Ga0495671_0093196
467 Ga0495649_0051691
468 Ga0495589_0059177
469 Ga0495589_0063097
470 Ga0495600_0464297
471 Ga0495604_0024229
472 Ga0495636_0065497
473 Ga0495636_0092634
474 Ga0495676_0027575
475 Ga0495676_0133738
476 Ga0495680_0018393
477 Ga0495687_001766
478 Ga0495687_003588
479 Ga0495675_0005489
480 Ga0495675_0282628
481 Ga0495685_002372
482 Ga0495685_031786
483 Ga0495681_0000184
484 Ga0495681_0058222
485 Ga0495684_0125791
486 Ga0495686_0061963
487 Ga0495686_0149116
488 Ga0495593_0041376
489 Ga0495593_0254822
490 Ga0495614_0224566
491 Ga0496110_0769654
492 Ga0501033_0002231
493 Ga0501034_0444247
494 Ga0501038_0004397
495 Ga0501046_0231002
496 Ga0501047_0050457
497 Ga0501069_0366985
498 Ga0501074_0410884
499 Ga0501035_0080892
500 Ga0501035_0327313
501 Ga0501044_0021810
502 nmdc:mga03n38_285874_c1
503 nmdc:mga06z11_575_c1
504 nmdc:mga04h51_4421_c1
505 nmdc:mga07m45_322350_c1
506 nmdc:mga05p37_1197380_c1
507 nmdc:mga06r32_953103_c1
508 nmdc:mga0a205_250524_c1
509 nmdc:mga0a205_616094_c1
510 Ga0500644_0010466
511 Ga0500560_002115
512 Ga0500577_0008515
513 Ga0500634_0272818
514 Ga0587070_006449
515 Ga0587073_0018630
516 Ga0587088_008373
517 Ga0587092_006289
518 Ga0587106_007138
519 Ga0587125_006373
520 Ga0587109_013012
521 Ga0587062_005115
522 Ga0587067_038599
523 Ga0587072_011901
524 Ga0587076_005688
525 Ga0587105_006342
526 Ga0587119_002707
527 Ga0587071_006837
528 Ga0587071_082017
529 Ga0587111_0001622
530 Ga0587111_0011284
531 Ga0587111_0078058
532 Ga0587111_0094249
533 2554257851
534 2616697813
535 2785344855
536 2793985036
537 2808919552
538 2809589956
539 2811844804
540 2862180153
541 2866612308
542 2899361718
543 2915770526
544 2997606733
545 3006394136
546 3006426878
547 8025482071
548 8025482795
549 8025485145
550 8033688186
551 8047899759
552 8048135186
553 8048359171
554 8048376707
555 8048385760
556 8053950112
557 8053950473
558 8053952327
559 8056214158
560 8056451169
561 8056668893
562 8056836752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14273

DUF4360

Domain of unknown function (DUF4360)

42

222

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8okh-assembly1.cif.gz_B crystal structure of bdellovibrio bacteriovorus bd1399 0.6473 35 216
8okh-assembly1.cif.gz_B crystal structure of bdellovibrio bacteriovorus bd1399 0.6409 35 216
6mgp-assembly1.cif.gz_C structure of human 4-1bb / 4-1bbl complex 0.5677 93 215
6mkb-assembly1.cif.gz_A crystal structure of murine 4-1bb ligand 0.5234 52 214
6bwv-assembly2.cif.gz_B crystal structure of the 4-1bb/4-1bbl complex 0.5166 50 215
ID Description Score Start End Superfamily
af_F1Q5F5_33_127_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.4941 103 194 2.60.40.10
af_A0A0R0EJX5_15_128_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.4832 101 187 2.60.120.260
af_P32971_90_225_2.60.120.40 Mainly Beta;Sandwich;Jelly Rolls; 0.4824 48 176 2.60.120.40
6mkzC00 Mainly Beta;Sandwich;Jelly Rolls; 0.4772 52 214 2.60.120.40
af_Q9XUM9_1_91_2.60.210.10 Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 0.4748 104 181 2.60.210.10
ID Description Score Start End GO Terms
AF-A0A7Y9GJM4-F1-model_v4 DUF4360 domain-containing protein 0.9873 37 216
AF-R1FHE9-F1-model_v4 Secreted protein 0.9822 30 214
AF-A0A7Y9GJM4-F1-model_v4 DUF4360 domain-containing protein 0.9765 37 216
AF-A0A060ZXK6-F1-model_v4 Secreted protein 0.9658 44 215
AF-A0A4R5BI68-F1-model_v4 DUF4360 domain-containing protein 0.9628 35 214

Map