F387674

General Info

Members Datasets Scaffolds Average Seq Length
286 219 572 215

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0000023|Ga0501046_0000023_190739_191461
Length 240
Sequence MIEDGCVNVRNLQPAQQRIGKVMARDVSRTPPIFDETFRTAFRDLAVWRRDVRRFRRDPVDPSLVLRLIELASHAPSVGHSQPWRFVLVEAPERRAGIEASFARANGQALDGYTGEKRQRYASLKLEGLRRAPVHLAVFADETTETGSGLGRQTMPETLHYSVVAAIQMFWLAARIEGLGVGWVSILEPEVAKRLLDVPENWRLIAYLCVGWPEEEHLDPELERHGWQDRIDVADFILRR

Samples

Sample ID Description Type Environment
1 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
88 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
197 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
198 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
199 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
200 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
201 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
202 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
205 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
206 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
207 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
208 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
209 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
213 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
214 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
215 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
216 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
217 2902330777 Methylobacterium sp. 2A Isolate Unclassified
218 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
219 2928125067 Methylobacterium sp. 1973 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.85
Metatranscriptomes 0.35
Isolates 2.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.83
Nodule 0.35
Rhizoplane 0.7
Rhizosphere 70.63
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501046_0000023 3300049580 Bacteria 213965
2 rootH2_10095885 3300003320 Bacteria 1287
3 rootL2_10267334 3300003322 Bacteria 2485
4 Ga0070683_100056091 3300005329 Bacteria 3658
5 Ga0070680_100042288 3300005336 Bacteria 3697
6 Ga0070660_100211371 3300005339 Bacteria 1575
7 Ga0070691_10041482 3300005341 Bacteria 2176
8 Ga0070668_100192889 3300005347 Unclassified 1669
9 Ga0070668_100297897 3300005347 Bacteria 1352
10 Ga0070668_100506309 3300005347 Bacteria 1046
11 Ga0070675_100565915 3300005354 Bacteria 1029
12 Ga0070673_100111000 3300005364 Unclassified 2274
13 Ga0070709_10430578 3300005434 Bacteria 990
14 Ga0070714_100184921 3300005435 Bacteria 1898
15 Ga0070713_100170780 3300005436 Bacteria 1948
16 Ga0070663_100251044 3300005455 Bacteria 1400
17 Ga0070681_10039530 3300005458 Bacteria 4728
18 Ga0070681_10455899 3300005458 Bacteria 1191
19 Ga0070706_100038322 3300005467 Bacteria 4424
20 Ga0070707_100107210 3300005468 Bacteria 2710
21 Ga0070699_100112393 3300005518 Bacteria 2392
22 Ga0070679_100022649 3300005530 Bacteria 6142
23 Ga0070679_100046709 3300005530 Bacteria 4316
24 Ga0070684_100019609 3300005535 Bacteria 5596
25 Ga0070665_100657667 3300005548 Bacteria 1061
26 Ga0068855_100198229 3300005563 Bacteria 2261
27 Ga0068859_100612788 3300005617 Bacteria 1181
28 Ga0068860_100007492 3300005843 Bacteria 10915
29 Ga0068860_100619626 3300005843 Bacteria 1089
30 Ga0081538_10134684 3300005981 Bacteria 1153
31 Ga0081539_10003542 3300005985 Bacteria 18982
32 Ga0070717_10000983 3300006028 Bacteria 19067
33 Ga0075365_10027970 3300006038 Bacteria 3592
34 Ga0075365_10074776 3300006038 Bacteria 2285
35 Ga0075365_10147778 3300006038 Bacteria 1634
36 Ga0075365_10196007 3300006038 Bacteria 1414
37 Ga0075365_10355562 3300006038 Bacteria 1032
38 Ga0075363_100032899 3300006048 Bacteria 2697
39 Ga0070712_100804924 3300006175 Bacteria 806
40 Ga0075362_10006545 3300006177 Bacteria 4350
41 Ga0075362_10055168 3300006177 Bacteria 1787
42 Ga0075362_10145476 3300006177 Bacteria 1135
43 Ga0075367_10019581 3300006178 Bacteria 3754
44 Ga0075367_10034382 3300006178 Bacteria 2928
45 Ga0075369_10000191 3300006186 Bacteria 17605
46 Ga0075369_10165558 3300006186 Bacteria 1014
47 Ga0075366_10070862 3300006195 Bacteria 2077
48 Ga0075370_10020388 3300006353 Bacteria 3622
49 Ga0097620_100612833 3300006931 Bacteria 1181
50 Ga0075435_100008849 3300007076 Bacteria 7252
51 Ga0075435_100012721 3300007076 Bacteria 6235
52 Ga0099794_10051964 3300007265 Bacteria 1975
53 Ga0099794_10329166 3300007265 Bacteria 793
54 Ga0099795_10037832 3300007788 Bacteria 1700
55 Ga0105240_10032124 3300009093 Bacteria 6798
56 Ga0111539_10072518 3300009094 Unclassified 4061
57 Ga0111539_10238209 3300009094 Bacteria 2118
58 Ga0105247_10080434 3300009101 Bacteria 2053
59 Ga0114129_10034015 3300009147 Bacteria 7199
60 Ga0105241_10242455 3300009174 Bacteria 1524
61 Ga0105237_10012827 3300009545 Bacteria 8812
62 Ga0105238_10416429 3300009551 Bacteria 1338
63 Ga0105249_11619988 3300009553 Bacteria 720
64 Ga0105246_10195165 3300011119 Bacteria 1570
65 Ga0157369_10161046 3300013105 Bacteria 2369
66 Ga0157378_10140836 3300013297 Bacteria 2239
67 Ga0163162_10140931 3300013306 Bacteria 2524
68 Ga0157375_11106380 3300013308 Bacteria 928
69 Ga0206353_10641892 3300020082 Bacteria 1124
70 Ga0213876_10065811 3300021384 Bacteria 1913
71 Ga0209677_100846 3300025253 Bacteria 15138
72 Ga0209233_1004519 3300025261 Bacteria 4718
73 Ga0209455_1010927 3300025272 Bacteria 2271
74 Ga0209675_1002746 3300025291 Bacteria 8803
75 Ga0207710_10040075 3300025900 Bacteria 2075
76 Ga0207707_10040731 3300025912 Bacteria 4057
77 Ga0207707_10587290 3300025912 Bacteria 944
78 Ga0207695_10185132 3300025913 Bacteria 2002
79 Ga0207695_10280876 3300025913 Bacteria 1559
80 Ga0207693_10103221 3300025915 Bacteria 2236
81 Ga0207660_10087899 3300025917 Bacteria 2297
82 Ga0207652_10022392 3300025921 Bacteria 5227
83 Ga0207652_10184221 3300025921 Bacteria 1877
84 Ga0207646_10098958 3300025922 Bacteria 2614
85 Ga0207646_10201111 3300025922 Bacteria 1799
86 Ga0207659_10393834 3300025926 Bacteria 1157
87 Ga0207700_10021699 3300025928 Bacteria 4390
88 Ga0207664_10159468 3300025929 Bacteria 1923
89 Ga0207664_10307651 3300025929 Bacteria 1396
90 Ga0207690_10731707 3300025932 Bacteria 815
91 Ga0207665_10136691 3300025939 Bacteria 1744
92 Ga0207661_10000210 3300025944 Bacteria 37700
93 Ga0207667_10075447 3300025949 Bacteria 3501
94 Ga0207668_10158703 3300025972 Bacteria 1760
95 Ga0207668_10247619 3300025972 Bacteria 1446
96 Ga0207668_10730831 3300025972 Bacteria 872
97 Ga0207675_100486383 3300026118 Bacteria 1227
98 Ga0207698_10800605 3300026142 Bacteria 944
99 Ga0209588_1106763 3300027671 Bacteria 900
100 Ga0209813_10120937 3300027866 Bacteria 911
101 Ga0268264_10000049 3300028381 Bacteria 329992
102 Ga0268264_11113154 3300028381 Bacteria 798
103 Ga0307511_10100969 3300030521 Bacteria 1895
104 Ga0307513_10078816 3300031456 Bacteria 3406
105 Ga0307508_10303969 3300031616 Bacteria 1188
106 Ga0307405_10386616 3300031731 Bacteria 1091
107 Ga0307410_10240286 3300031852 Bacteria 1403
108 Ga0307412_10611754 3300031911 Bacteria 924
109 Ga0307409_100270695 3300031995 Bacteria 1564
110 Ga0307415_100136414 3300032126 Bacteria 1867
111 Ga0307415_100287241 3300032126 Bacteria 1356
112 Ga0307507_10031939 3300033179 Bacteria 5512
113 Ga0373923_0021390 3300035111 Bacteria 2525
114 Ga0373923_0026390 3300035111 Bacteria 2311
115 Ga0373954_0005149 3300035118 Bacteria 5647
116 Ga0373956_0146117 3300035119 Unclassified 1111
117 Ga0373943_0031436 3300035170 Bacteria 2519
118 Ga0373943_0217248 3300035170 Unclassified 1064
119 Ga0373955_0019894 3300035172 Bacteria 3365
120 Ga0373931_0293176 3300035691 Bacteria 1002
121 Ga0373935_0000596 3300035692 Bacteria 18828
122 Ga0373935_0273716 3300035692 Unclassified 1187
123 Ga0373927_0000954 3300035695 Bacteria 22032
124 Ga0373927_0013520 3300035695 Bacteria 5423
125 Ga0373933_0013044 3300035724 Bacteria 4600
126 Ga0373937_0019136 3300036401 Bacteria 6128
127 Ga0373925_0007093 3300037068 Bacteria 8190
128 Ga0373925_0134880 3300037068 Bacteria 1928
129 Ga0395899_0007844 3300037312 Bacteria 8226
130 Ga0395900_0009060 3300037418 Bacteria 10200
131 Ga0395900_0084698 3300037418 Bacteria 3258
132 Ga0436364_0780252 3300037853 Bacteria 2931
133 Ga0436364_1544615 3300037853 Bacteria 5769
134 Ga0436365_0809774 3300039437 Bacteria 2410
135 Ga0436365_0980647 3300039437 Bacteria 994
136 Ga0436361_1001653 3300039447 Bacteria 1301
137 Ga0436363_1526214 3300039450 Bacteria 1507
138 Ga0439465_0059282 3300041413 Bacteria 1267
139 Ga0466965_0078276 3300044683 Bacteria 1670
140 Ga0466961_0157736 3300044693 Bacteria 1415
141 Ga0466961_0204430 3300044693 Bacteria 1221
142 Ga0466963_0171954 3300044694 Bacteria 1511
143 Ga0466963_0634749 3300044694 Bacteria 754
144 Ga0466964_0036163 3300044706 Bacteria 1979
145 Ga0466971_0032659 3300044719 Bacteria 2332
146 Ga0466970_0083446 3300044765 Bacteria 1729
147 Ga0466957_0248250 3300044842 Bacteria 1183
148 Ga0466959_0035591 3300045049 Bacteria 3681
149 Ga0495592_0004048 3300046454 Bacteria 10659
150 Ga0495592_0008279 3300046454 Bacteria 7808
151 Ga0495603_0003826 3300046455 Bacteria 8963
152 Ga0495603_0125864 3300046455 Bacteria 1493
153 Ga0495629_0001147 3300046459 Bacteria 20928
154 Ga0495629_0074673 3300046459 Bacteria 2367
155 Ga0495641_0016258 3300046461 Bacteria 3927
156 Ga0495651_0032853 3300046462 Bacteria 4047
157 Ga0495653_0063080 3300046463 Bacteria 2798
158 Ga0495653_0176462 3300046463 Bacteria 1470
159 Ga0495580_0007610 3300046472 Bacteria 8691
160 Ga0495582_0004370 3300046473 Bacteria 7949
161 Ga0495639_0000398 3300046475 Bacteria 20606
162 Ga0495662_0016148 3300046476 Bacteria 3620
163 Ga0495664_0010637 3300046477 Bacteria 5165
164 Ga0495594_0002015 3300046499 Bacteria 10580
165 Ga0495606_0100821 3300046507 Bacteria 1758
166 Ga0495608_0024887 3300046511 Bacteria 4089
167 Ga0495618_0217468 3300046514 Bacteria 1206
168 Ga0495628_0022130 3300046516 Bacteria 5225
169 Ga0495628_0037989 3300046516 Bacteria 3858
170 Ga0495628_0574246 3300046516 Bacteria 808
171 Ga0495630_0134403 3300046517 Bacteria 1879
172 Ga0495652_0077393 3300046529 Bacteria 2757
173 Ga0495652_0107517 3300046529 Bacteria 2250
174 Ga0495665_0003500 3300046531 Bacteria 8522
175 Ga0495640_0045588 3300046533 Bacteria 3042
176 Ga0495586_0040115 3300046535 Bacteria 2518
177 Ga0495587_0005312 3300046536 Bacteria 8422
178 Ga0495645_0058450 3300046543 Bacteria 2797
179 Ga0495622_0044565 3300046557 Bacteria 2061
180 Ga0495622_0049595 3300046557 Bacteria 1949
181 Ga0495667_0207831 3300046559 Unclassified 1251
182 Ga0495634_0006456 3300046642 Bacteria 8910
183 Ga0495634_0118156 3300046642 Bacteria 1700
184 Ga0495635_0024559 3300046663 Bacteria 4200
185 Ga0495657_0074594 3300046675 Bacteria 2207
186 Ga0495599_0009184 3300046678 Bacteria 6034
187 Ga0495599_0053837 3300046678 Bacteria 2521
188 Ga0495623_0016419 3300046679 Bacteria 4783
189 Ga0495646_0166628 3300046680 Unclassified 1216
190 Ga0495647_0013483 3300046681 Bacteria 2832
191 Ga0495613_0003666 3300046689 Bacteria 11517
192 Ga0495624_0002840 3300046690 Bacteria 12959
193 Ga0495600_0491404 3300046809 Bacteria 755
194 Ga0495581_0000670 3300047315 Bacteria 18010
195 Ga0495604_0013538 3300047317 Bacteria 6503
196 Ga0495674_0001446 3300047319 Bacteria 23283
197 Ga0495672_0052673 3300047320 Bacteria 2389
198 Ga0495676_0265622 3300047321 Bacteria 1166
199 Ga0495680_0082467 3300047322 Bacteria 2426
200 Ga0495684_0121699 3300047471 Bacteria 1965
201 Ga0495684_0179053 3300047471 Bacteria 1572
202 Ga0495593_0000317 3300047673 Bacteria 26622
203 Ga0495593_0138396 3300047673 Unclassified 1234
204 Ga0495614_0102190 3300048089 Bacteria 1254
205 Ga0496106_0001095 3300048909 Bacteria 20014
206 Ga0496114_0396718 3300048917 Bacteria 1222
207 Ga0496116_0054326 3300048919 Bacteria 2640
208 Ga0496117_0162878 3300048920 Unclassified 1304
209 Ga0496118_0028927 3300048921 Bacteria 4657
210 Ga0496120_0160088 3300048923 Bacteria 1123
211 Ga0496121_0000261 3300048924 Bacteria 110085
212 Ga0496121_0025361 3300048924 Bacteria 5629
213 Ga0496121_0030785 3300048924 Bacteria 4921
214 Ga0496121_0081858 3300048924 Bacteria 2554
215 Ga0496121_0521798 3300048924 Bacteria 749
216 Ga0496124_0002237 3300048927 Bacteria 25740
217 Ga0496125_0116852 3300048928 Bacteria 1914
218 Ga0496125_0141822 3300048928 Bacteria 1669
219 Ga0496126_0035823 3300048929 Bacteria 4646
220 Ga0496126_0190148 3300048929 Bacteria 1739
221 Ga0501034_0002707 3300049571 Bacteria 20879
222 Ga0501034_0005569 3300049571 Bacteria 13720
223 Ga0501034_0261494 3300049571 Bacteria 1673
224 Ga0501034_0269014 3300049571 Bacteria 1646
225 Ga0501036_0094135 3300049572 Bacteria 2532
226 Ga0501039_0708987 3300049575 Bacteria 787
227 Ga0501047_0806229 3300049581 Bacteria 754
228 Ga0501068_0014229 3300049584 Bacteria 4544
229 Ga0501069_0272484 3300049585 Bacteria 990
230 Ga0501070_0598702 3300049586 Bacteria 879
231 Ga0501073_0154808 3300049589 Bacteria 1589
232 Ga0501079_0727380 3300049741 Bacteria 781
233 Ga0501080_0181726 3300049742 Bacteria 1935
234 Ga0501080_0532859 3300049742 Bacteria 1047
235 Ga0501035_0566624 3300049822 Bacteria 929
236 Ga0501044_0166529 3300049823 Bacteria 2178
237 nmdc:mga03683_608_c1 3300050489 Bacteria 6593
238 nmdc:mga03683_78356_c1 3300050489 Bacteria 1423
239 nmdc:mga03n38_90133_c1 3300050490 Bacteria 1458
240 nmdc:mga0yw44_110703_c1 3300050492 Bacteria 1759
241 nmdc:mga0yw44_150088_c1 3300050492 Bacteria 1520
242 nmdc:mga0yw44_22039_c1 3300050492 Bacteria 3564
243 nmdc:mga0yw44_363936_c1 3300050492 Bacteria 975
244 nmdc:mga0yw44_56016_c1 3300050492 Bacteria 2400
245 nmdc:mga0k408_15003_c1 3300050493 Bacteria 4280
246 nmdc:mga0k408_29756_c1 3300050493 Bacteria 3110
247 nmdc:mga06z11_110202_c1 3300050494 Bacteria 1523
248 nmdc:mga06z11_12814_c1 3300050494 Bacteria 3658
249 nmdc:mga06z11_286531_c1 3300050494 Bacteria 977
250 nmdc:mga07m45_339387_c1 3300050496 Bacteria 873
251 nmdc:mga05p37_153539_c1 3300050507 Bacteria 2815
252 nmdc:mga08y16_318113_c1 3300050511 Bacteria 1602
253 nmdc:mga0rr50_59213_c1 3300050513 Bacteria 2875
254 nmdc:mga08x19_99329_c1 3300050514 Bacteria 1929
255 nmdc:mga0a205_17226_c1 3300050515 Bacteria 6769
256 nmdc:mga0sz30_2513_c1 3300050516 Bacteria 6540
257 Ga0495601_0036041 3300053077 Bacteria 3089
258 Ga0495601_0248937 3300053077 Unclassified 1160
259 Ga0495612_0030538 3300053078 Unclassified 2170
260 Ga0500635_0003985 3300053080 Bacteria 3765
261 Ga0495595_0008802 3300053084 Bacteria 4156
262 Ga0500651_0009875 3300053093 Bacteria 5698
263 Ga0500641_0015585 3300053096 Bacteria 2824
264 Ga0500556_0000214 3300053104 Bacteria 47169
265 Ga0500562_003000 3300053108 Bacteria 4208
266 Ga0500559_0012742 3300053136 Bacteria 3569
267 Ga0500573_0069617 3300053140 Bacteria 2007
268 Ga0500603_026887 3300053150 Bacteria 1458
269 Ga0500616_0000923 3300053153 Bacteria 32124
270 Ga0500616_0010489 3300053153 Bacteria 5541
271 Ga0500619_048130 3300053154 Bacteria 1372
272 Ga0500620_017943 3300053155 Bacteria 2052
273 Ga0500638_147676 3300053162 Unclassified 1049
274 Ga0500639_062079 3300053163 Bacteria 1924
275 Ga0500636_0034353 3300053177 Bacteria 3001
276 Ga0500552_001847 3300053733 Bacteria 2032
277 Ga0501082_0038524 3300060353 Bacteria 4125
278 Ga0466962_0038341 3300061719 Bacteria 2295
279 2509152047 2508501128 Bacteria 8613869
280 2596377227 2595698237 Bacteria 6712432
281 2883297223 2883291878 Bacteria 5894118
282 2883360005 2883354860 Bacteria 5865246
283 2889306801 2889306138 Bacteria 6358934
284 2902334349 2902330777 Bacteria 6395352
285 2902411488 2902405164 Bacteria 6784948
286 2928128725 2928125067 Bacteria 5937560
287 Ga0501046_0000023
288 rootH2_10095885
289 rootL2_10267334
290 Ga0070683_100056091
291 Ga0070680_100042288
292 Ga0070660_100211371
293 Ga0070691_10041482
294 Ga0070668_100192889
295 Ga0070668_100297897
296 Ga0070668_100506309
297 Ga0070675_100565915
298 Ga0070673_100111000
299 Ga0070709_10430578
300 Ga0070714_100184921
301 Ga0070713_100170780
302 Ga0070663_100251044
303 Ga0070681_10039530
304 Ga0070681_10455899
305 Ga0070706_100038322
306 Ga0070707_100107210
307 Ga0070699_100112393
308 Ga0070679_100022649
309 Ga0070679_100046709
310 Ga0070684_100019609
311 Ga0070665_100657667
312 Ga0068855_100198229
313 Ga0068859_100612788
314 Ga0068860_100007492
315 Ga0068860_100619626
316 Ga0081538_10134684
317 Ga0081539_10003542
318 Ga0070717_10000983
319 Ga0075365_10027970
320 Ga0075365_10074776
321 Ga0075365_10147778
322 Ga0075365_10196007
323 Ga0075365_10355562
324 Ga0075363_100032899
325 Ga0070712_100804924
326 Ga0075362_10006545
327 Ga0075362_10055168
328 Ga0075362_10145476
329 Ga0075367_10019581
330 Ga0075367_10034382
331 Ga0075369_10000191
332 Ga0075369_10165558
333 Ga0075366_10070862
334 Ga0075370_10020388
335 Ga0097620_100612833
336 Ga0075435_100008849
337 Ga0075435_100012721
338 Ga0099794_10051964
339 Ga0099794_10329166
340 Ga0099795_10037832
341 Ga0105240_10032124
342 Ga0111539_10072518
343 Ga0111539_10238209
344 Ga0105247_10080434
345 Ga0114129_10034015
346 Ga0105241_10242455
347 Ga0105237_10012827
348 Ga0105238_10416429
349 Ga0105249_11619988
350 Ga0105246_10195165
351 Ga0157369_10161046
352 Ga0157378_10140836
353 Ga0163162_10140931
354 Ga0157375_11106380
355 Ga0206353_10641892
356 Ga0213876_10065811
357 Ga0209677_100846
358 Ga0209233_1004519
359 Ga0209455_1010927
360 Ga0209675_1002746
361 Ga0207710_10040075
362 Ga0207707_10040731
363 Ga0207707_10587290
364 Ga0207695_10185132
365 Ga0207695_10280876
366 Ga0207693_10103221
367 Ga0207660_10087899
368 Ga0207652_10022392
369 Ga0207652_10184221
370 Ga0207646_10098958
371 Ga0207646_10201111
372 Ga0207659_10393834
373 Ga0207700_10021699
374 Ga0207664_10159468
375 Ga0207664_10307651
376 Ga0207690_10731707
377 Ga0207665_10136691
378 Ga0207661_10000210
379 Ga0207667_10075447
380 Ga0207668_10158703
381 Ga0207668_10247619
382 Ga0207668_10730831
383 Ga0207675_100486383
384 Ga0207698_10800605
385 Ga0209588_1106763
386 Ga0209813_10120937
387 Ga0268264_10000049
388 Ga0268264_11113154
389 Ga0307511_10100969
390 Ga0307513_10078816
391 Ga0307508_10303969
392 Ga0307405_10386616
393 Ga0307410_10240286
394 Ga0307412_10611754
395 Ga0307409_100270695
396 Ga0307415_100136414
397 Ga0307415_100287241
398 Ga0307507_10031939
399 Ga0373923_0021390
400 Ga0373923_0026390
401 Ga0373954_0005149
402 Ga0373956_0146117
403 Ga0373943_0031436
404 Ga0373943_0217248
405 Ga0373955_0019894
406 Ga0373931_0293176
407 Ga0373935_0000596
408 Ga0373935_0273716
409 Ga0373927_0000954
410 Ga0373927_0013520
411 Ga0373933_0013044
412 Ga0373937_0019136
413 Ga0373925_0007093
414 Ga0373925_0134880
415 Ga0395899_0007844
416 Ga0395900_0009060
417 Ga0395900_0084698
418 Ga0436364_0780252
419 Ga0436364_1544615
420 Ga0436365_0809774
421 Ga0436365_0980647
422 Ga0436361_1001653
423 Ga0436363_1526214
424 Ga0439465_0059282
425 Ga0466965_0078276
426 Ga0466961_0157736
427 Ga0466961_0204430
428 Ga0466963_0171954
429 Ga0466963_0634749
430 Ga0466964_0036163
431 Ga0466971_0032659
432 Ga0466970_0083446
433 Ga0466957_0248250
434 Ga0466959_0035591
435 Ga0495592_0004048
436 Ga0495592_0008279
437 Ga0495603_0003826
438 Ga0495603_0125864
439 Ga0495629_0001147
440 Ga0495629_0074673
441 Ga0495641_0016258
442 Ga0495651_0032853
443 Ga0495653_0063080
444 Ga0495653_0176462
445 Ga0495580_0007610
446 Ga0495582_0004370
447 Ga0495639_0000398
448 Ga0495662_0016148
449 Ga0495664_0010637
450 Ga0495594_0002015
451 Ga0495606_0100821
452 Ga0495608_0024887
453 Ga0495618_0217468
454 Ga0495628_0022130
455 Ga0495628_0037989
456 Ga0495628_0574246
457 Ga0495630_0134403
458 Ga0495652_0077393
459 Ga0495652_0107517
460 Ga0495665_0003500
461 Ga0495640_0045588
462 Ga0495586_0040115
463 Ga0495587_0005312
464 Ga0495645_0058450
465 Ga0495622_0044565
466 Ga0495622_0049595
467 Ga0495667_0207831
468 Ga0495634_0006456
469 Ga0495634_0118156
470 Ga0495635_0024559
471 Ga0495657_0074594
472 Ga0495599_0009184
473 Ga0495599_0053837
474 Ga0495623_0016419
475 Ga0495646_0166628
476 Ga0495647_0013483
477 Ga0495613_0003666
478 Ga0495624_0002840
479 Ga0495600_0491404
480 Ga0495581_0000670
481 Ga0495604_0013538
482 Ga0495674_0001446
483 Ga0495672_0052673
484 Ga0495676_0265622
485 Ga0495680_0082467
486 Ga0495684_0121699
487 Ga0495684_0179053
488 Ga0495593_0000317
489 Ga0495593_0138396
490 Ga0495614_0102190
491 Ga0496106_0001095
492 Ga0496114_0396718
493 Ga0496116_0054326
494 Ga0496117_0162878
495 Ga0496118_0028927
496 Ga0496120_0160088
497 Ga0496121_0000261
498 Ga0496121_0025361
499 Ga0496121_0030785
500 Ga0496121_0081858
501 Ga0496121_0521798
502 Ga0496124_0002237
503 Ga0496125_0116852
504 Ga0496125_0141822
505 Ga0496126_0035823
506 Ga0496126_0190148
507 Ga0501034_0002707
508 Ga0501034_0005569
509 Ga0501034_0261494
510 Ga0501034_0269014
511 Ga0501036_0094135
512 Ga0501039_0708987
513 Ga0501047_0806229
514 Ga0501068_0014229
515 Ga0501069_0272484
516 Ga0501070_0598702
517 Ga0501073_0154808
518 Ga0501079_0727380
519 Ga0501080_0181726
520 Ga0501080_0532859
521 Ga0501035_0566624
522 Ga0501044_0166529
523 nmdc:mga03683_608_c1
524 nmdc:mga03683_78356_c1
525 nmdc:mga03n38_90133_c1
526 nmdc:mga0yw44_110703_c1
527 nmdc:mga0yw44_150088_c1
528 nmdc:mga0yw44_22039_c1
529 nmdc:mga0yw44_363936_c1
530 nmdc:mga0yw44_56016_c1
531 nmdc:mga0k408_15003_c1
532 nmdc:mga0k408_29756_c1
533 nmdc:mga06z11_110202_c1
534 nmdc:mga06z11_12814_c1
535 nmdc:mga06z11_286531_c1
536 nmdc:mga07m45_339387_c1
537 nmdc:mga05p37_153539_c1
538 nmdc:mga08y16_318113_c1
539 nmdc:mga0rr50_59213_c1
540 nmdc:mga08x19_99329_c1
541 nmdc:mga0a205_17226_c1
542 nmdc:mga0sz30_2513_c1
543 Ga0495601_0036041
544 Ga0495601_0248937
545 Ga0495612_0030538
546 Ga0500635_0003985
547 Ga0495595_0008802
548 Ga0500651_0009875
549 Ga0500641_0015585
550 Ga0500556_0000214
551 Ga0500562_003000
552 Ga0500559_0012742
553 Ga0500573_0069617
554 Ga0500603_026887
555 Ga0500616_0000923
556 Ga0500616_0010489
557 Ga0500619_048130
558 Ga0500620_017943
559 Ga0500638_147676
560 Ga0500639_062079
561 Ga0500636_0034353
562 Ga0500552_001847
563 Ga0501082_0038524
564 Ga0466962_0038341
565 2509152047
566 2596377227
567 2883297223
568 2883360005
569 2889306801
570 2902334349
571 2902411488
572 2928128725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

46

212

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2isj-assembly1.cif.gz_A blub bound to oxidized fmn 0.9332 1 212
2isj-assembly1.cif.gz_A blub bound to oxidized fmn 0.9248 1 212
3g14-assembly1.cif.gz_A crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.8651 15 190
3e39-assembly1.cif.gz_B crystal structure of a putative nitroreductase in complex with fmn (dde_0787) from desulfovibrio desulfuricans subsp. at 1.70 a resolution 0.8634 15 213
6q1l-assembly1.cif.gz_B crystal structure of oxidized iodotyrosine deiodinase (iyd) bound to fmn and 3-iodo-l-tyrosine 0.8588 15 212
ID Description Score Start End Superfamily
2isjB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9419 1 192 3.40.109.10
2isjB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9326 1 192 3.40.109.10
af_O07233_1_181_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9168 6 186 3.40.109.10
af_O07233_1_181_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9072 6 186 3.40.109.10
3g14A00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8592 15 190 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A5S4THE3-F1-model_v4 5,6-dimethylbenzimidazole synthase (EC 1.13.11.79) 0.9783 49 200 GO:0102919
AF-A0A516GY21-F1-model_v4 5,6-dimethylbenzimidazole synthase (EC 1.13.11.79) 0.9765 2 213 GO:0102919
AF-A0A160TGS9-F1-model_v4 Cobalamin biosynthesis protein BluB @ 5,6-dimethylbenzimidazole synthase, flavin destructase family 0.9758 38 213 GO:0016491
AF-A0A212IWL5-F1-model_v4 Putative cob(II)yrinic acid a,c-diamide reductase (Modular protein) (EC 1.16.8.1) 0.9749 3 213 GO:0002128
GO:0003723
GO:0005829
GO:0008173
GO:0016491
AF-A0A444K4E1-F1-model_v4 5,6-dimethylbenzimidazole synthase (EC 1.13.11.79) 0.9747 39 213 GO:0102919

Map