F387475

General Info

Members Datasets Scaffolds Average Seq Length
286 165 572 322

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100197665|Ga0207675_1001976652
Length 368
Sequence LPFSYQDPRTLQMSAPFSIPAAKHLWRSLAISSALVFVYATVLMKLGRNWWTDENYSHGLLIPFIIGYIVWSQRERFARAAQRPAIVVGLITVLAALCALWAGTAGAELFMQRTSLVLILAGTVLYFWGFALLRLLIVPLFLLLLAIPIPAIVFNKIAFPLQLFASRCAVWAMMAFGIPVLRQGNVIELMPLGAIETKKLEVVEACSGIRSLMTLVTLAVVFAYFTHPRGGTSSGVANPGDEPNPRRSGTVARGLSLLGRYGFWRSAVIVLSAIPIAIFTNALRVSGTGVLAHYYGTRVADGFFHSFSGWVIYVVAFLMLFSVGWVLDRARPASEKPRSTPSGKASHQSNSSINATTAATLAPAEGTE

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
141 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
147 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
154 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
155 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
156 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.7
Rhizosphere 98.25
Stem 0
Stem Tuber 0
Unclassified 15.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100197665 3300026118 Unclassified 1930
2 JGI25406J46586_10001896 3300003203 Bacteria 9846
3 JGI25406J46586_10044776 3300003203 Bacteria 1529
4 Ga0065704_10107380 3300005289 Bacteria 2057
5 Ga0065712_10010658 3300005290 Bacteria 3261
6 Ga0065712_10011468 3300005290 Bacteria 2637
7 Ga0065715_10019180 3300005293 Archaea 2514
8 Ga0065715_10089602 3300005293 Bacteria 9276
9 Ga0065715_10095441 3300005293 Bacteria 4080
10 Ga0070690_100012284 3300005330 Bacteria 5038
11 Ga0070670_100003788 3300005331 Bacteria 12591
12 Ga0070670_100044359 3300005331 Unclassified 3824
13 Ga0070670_100057277 3300005331 Bacteria 3346
14 Ga0070670_100139082 3300005331 Bacteria 2100
15 Ga0068869_100030131 3300005334 Bacteria 3807
16 Ga0068869_100030294 3300005334 Bacteria 3797
17 Ga0070666_10033514 3300005335 Bacteria 3399
18 Ga0070680_100013502 3300005336 Bacteria 6362
19 Ga0070682_100000073 3300005337 Bacteria 92725
20 Ga0068868_100023891 3300005338 Bacteria 4632
21 Ga0068868_100048870 3300005338 Bacteria 3319
22 Ga0070689_100024787 3300005340 Unclassified 4503
23 Ga0070687_100033914 3300005343 Bacteria 2524
24 Ga0070661_100025282 3300005344 Bacteria 4266
25 Ga0070675_100237134 3300005354 Bacteria 1593
26 Ga0070671_100014584 3300005355 Bacteria 6356
27 Ga0070671_100033406 3300005355 Bacteria 4254
28 Ga0070671_100035467 3300005355 Unclassified 4132
29 Ga0070674_100134664 3300005356 Bacteria 1847
30 Ga0070673_100051513 3300005364 Bacteria 3225
31 Ga0070673_100081705 3300005364 Bacteria 2621
32 Ga0070673_100229246 3300005364 Unclassified 1611
33 Ga0070688_100122211 3300005365 Bacteria 1746
34 Ga0070659_100010294 3300005366 Bacteria 6877
35 Ga0070705_100017713 3300005440 Unclassified 3722
36 Ga0070705_100104852 3300005440 Bacteria 1794
37 Ga0070700_100002786 3300005441 Bacteria 8952
38 Ga0070694_100000832 3300005444 Bacteria 17316
39 Ga0070694_100012776 3300005444 Bacteria 5231
40 Ga0070694_100082167 3300005444 Bacteria 2243
41 Ga0070694_100084040 3300005444 Bacteria 2220
42 Ga0070694_100126383 3300005444 Bacteria 1841
43 Ga0070708_100000933 3300005445 Bacteria 22118
44 Ga0070678_100015121 3300005456 Bacteria 4894
45 Ga0070681_10001431 3300005458 Bacteria 20993
46 Ga0070681_10029881 3300005458 Bacteria 5469
47 Ga0068867_100125222 3300005459 Bacteria 1990
48 Ga0070706_100025115 3300005467 Bacteria 5485
49 Ga0070706_100044871 3300005467 Bacteria 4083
50 Ga0070707_100017014 3300005468 Bacteria 6828
51 Ga0070707_100401349 3300005468 Bacteria 1331
52 Ga0070698_100001384 3300005471 Bacteria 26879
53 Ga0070698_100036206 3300005471 Bacteria 5100
54 Ga0070699_100051274 3300005518 Bacteria 3572
55 Ga0070679_100408603 3300005530 Unclassified 1303
56 Ga0070684_100352782 3300005535 Bacteria 1353
57 Ga0070697_100001022 3300005536 Bacteria 21112
58 Ga0070697_100002331 3300005536 Bacteria 14597
59 Ga0070697_100017523 3300005536 Bacteria 5637
60 Ga0070697_100194959 3300005536 Bacteria 1720
61 Ga0070697_100310703 3300005536 Unclassified 1356
62 Ga0068853_100003797 3300005539 Bacteria 11580
63 Ga0070686_100003336 3300005544 Bacteria 8796
64 Ga0070686_100018035 3300005544 Bacteria 4136
65 Ga0070686_100169905 3300005544 Bacteria 1541
66 Ga0070696_100009375 3300005546 Bacteria 6553
67 Ga0070693_100006287 3300005547 Bacteria 5755
68 Ga0070693_100048487 3300005547 Bacteria 2419
69 Ga0070665_100108155 3300005548 Bacteria 2783
70 Ga0070704_100061344 3300005549 Unclassified 2691
71 Ga0070664_100001046 3300005564 Bacteria 21746
72 Ga0070664_100045362 3300005564 Bacteria 3713
73 Ga0070664_100125663 3300005564 Bacteria 2250
74 Ga0068857_100004900 3300005577 Bacteria 11360
75 Ga0068857_100097828 3300005577 Bacteria 2631
76 Ga0068857_100149878 3300005577 Unclassified 2113
77 Ga0068857_100178262 3300005577 Bacteria 1933
78 Ga0068854_100118464 3300005578 Bacteria 2006
79 Ga0070702_100032175 3300005615 Unclassified 2877
80 Ga0068852_100140706 3300005616 Bacteria 2233
81 Ga0068859_100006043 3300005617 Bacteria 12292
82 Ga0068859_100094885 3300005617 Unclassified 3036
83 Ga0068864_100001329 3300005618 Bacteria 20579
84 Ga0068864_100002573 3300005618 Bacteria 14974
85 Ga0068864_100045755 3300005618 Bacteria 3754
86 Ga0068864_100108434 3300005618 Bacteria 2471
87 Ga0068864_100185030 3300005618 Bacteria 1906
88 Ga0068866_10060073 3300005718 Bacteria 1969
89 Ga0068866_10076928 3300005718 Unclassified 1781
90 Ga0068861_100023187 3300005719 Bacteria 4474
91 Ga0068861_100232180 3300005719 Bacteria 1565
92 Ga0068870_10003654 3300005840 Bacteria 6534
93 Ga0068870_10029693 3300005840 Bacteria 2756
94 Ga0068863_100029639 3300005841 Bacteria 5224
95 Ga0068858_100218273 3300005842 Bacteria 1805
96 Ga0068858_100251097 3300005842 Unclassified 1680
97 Ga0068860_100027163 3300005843 Bacteria 5514
98 Ga0068862_100011327 3300005844 Bacteria 7364
99 Ga0068862_100362393 3300005844 Unclassified 1348
100 Ga0081539_10000652 3300005985 Bacteria 69804
101 Ga0081539_10001904 3300005985 Bacteria 32329
102 Ga0081539_10001938 3300005985 Bacteria 31724
103 Ga0081539_10002451 3300005985 Bacteria 26173
104 Ga0097621_100019902 3300006237 Bacteria 5163
105 Ga0097621_100213988 3300006237 Bacteria 1677
106 Ga0068871_100001546 3300006358 Bacteria 15436
107 Ga0068871_100009503 3300006358 Bacteria 7051
108 Ga0075430_100005780 3300006846 Bacteria 10437
109 Ga0075431_100015599 3300006847 Bacteria 7701
110 Ga0075433_10016544 3300006852 Bacteria 6083
111 Ga0075434_100118274 3300006871 Bacteria 2664
112 Ga0075429_100007792 3300006880 Bacteria 9302
113 Ga0068865_100004053 3300006881 Bacteria 8798
114 Ga0068865_100028337 3300006881 Bacteria 3707
115 Ga0075436_100000044 3300006914 Bacteria 77101
116 Ga0075436_100004392 3300006914 Bacteria 9682
117 Ga0097620_100006043 3300006931 Bacteria 12292
118 Ga0097620_100094885 3300006931 Unclassified 3036
119 Ga0075435_100000183 3300007076 Bacteria 37284
120 Ga0075435_100004755 3300007076 Bacteria 9377
121 Ga0075435_100199968 3300007076 Bacteria 1693
122 Ga0105251_10120295 3300009011 Bacteria 1193
123 Ga0111539_10350027 3300009094 Bacteria 1719
124 Ga0105245_10623530 3300009098 Unclassified 1107
125 Ga0105247_10041491 3300009101 Unclassified 2816
126 Ga0114129_10068603 3300009147 Bacteria 4944
127 Ga0114129_10134760 3300009147 Unclassified 3389
128 Ga0114129_10232116 3300009147 Bacteria 2485
129 Ga0105243_10000029 3300009148 Bacteria 190577
130 Ga0105243_10002540 3300009148 Bacteria 15243
131 Ga0105243_10009443 3300009148 Bacteria 7432
132 Ga0105243_10063844 3300009148 Bacteria 2953
133 Ga0105241_10023576 3300009174 Unclassified 4564
134 Ga0105241_10069994 3300009174 Bacteria 2721
135 Ga0105241_10087538 3300009174 Bacteria 2452
136 Ga0105241_10117071 3300009174 Unclassified 2141
137 Ga0105242_10000009 3300009176 Bacteria 162286
138 Ga0105242_10018844 3300009176 Bacteria 5403
139 Ga0105248_10005727 3300009177 Bacteria 13641
140 Ga0105248_10026862 3300009177 Bacteria 6402
141 Ga0105248_10078802 3300009177 Bacteria 3703
142 Ga0105237_10305504 3300009545 Bacteria 1594
143 Ga0105239_10029053 3300010375 Bacteria 6078
144 Ga0105239_10064067 3300010375 Bacteria 4035
145 Ga0105246_10021695 3300011119 Unclassified 4136
146 Ga0105246_10088148 3300011119 Unclassified 2229
147 Ga0105246_10436537 3300011119 Bacteria 1097
148 Ga0157373_10068277 3300013100 Bacteria 2513
149 Ga0157373_10115436 3300013100 Unclassified 1887
150 Ga0157371_10113742 3300013102 Bacteria 1922
151 Ga0157378_10000707 3300013297 Bacteria 31247
152 Ga0157378_10013342 3300013297 Bacteria 7182
153 Ga0157378_10023508 3300013297 Bacteria 5423
154 Ga0157378_10048663 3300013297 Bacteria 3770
155 Ga0157378_10096603 3300013297 Unclassified 2692
156 Ga0163162_10003906 3300013306 Bacteria 14315
157 Ga0157375_10001200 3300013308 Bacteria 22326
158 Ga0157375_10161069 3300013308 Unclassified 2385
159 Ga0157375_10444038 3300013308 Unclassified 1463
160 Ga0163163_10012702 3300014325 Bacteria 7682
161 Ga0163163_10015859 3300014325 Bacteria 6980
162 Ga0163163_10025451 3300014325 Bacteria 5641
163 Ga0163163_10037386 3300014325 Bacteria 4723
164 Ga0163163_10047623 3300014325 Bacteria 4214
165 Ga0157380_10015090 3300014326 Bacteria 5669
166 Ga0157380_10284953 3300014326 Bacteria 1514
167 Ga0157377_10014864 3300014745 Unclassified 3970
168 Ga0157377_10093813 3300014745 Bacteria 1777
169 Ga0157379_10242567 3300014968 Bacteria 1634
170 Ga0157376_10004618 3300014969 Bacteria 9594
171 Ga0157376_10165668 3300014969 Bacteria 2008
172 Ga0157376_10302843 3300014969 Bacteria 1514
173 Ga0163161_10031594 3300017792 Bacteria 3773
174 Ga0207642_10116209 3300025899 Unclassified 1371
175 Ga0207710_10047212 3300025900 Unclassified 1924
176 Ga0207680_10039092 3300025903 Unclassified 2750
177 Ga0207647_10015048 3300025904 Bacteria 5317
178 Ga0207643_10000737 3300025908 Bacteria 20096
179 Ga0207643_10074616 3300025908 Bacteria 1957
180 Ga0207684_10001621 3300025910 Bacteria 23877
181 Ga0207684_10015479 3300025910 Bacteria 6562
182 Ga0207654_10022963 3300025911 Bacteria 3335
183 Ga0207654_10057912 3300025911 Bacteria 2254
184 Ga0207654_10062697 3300025911 Unclassified 2179
185 Ga0207654_10179237 3300025911 Unclassified 1381
186 Ga0207707_10015220 3300025912 Bacteria 6697
187 Ga0207662_10002715 3300025918 Bacteria 8929
188 Ga0207649_10008515 3300025920 Bacteria 5594
189 Ga0207646_10024586 3300025922 Bacteria 5517
190 Ga0207681_10000672 3300025923 Bacteria 22530
191 Ga0207681_10086686 3300025923 Bacteria 2225
192 Ga0207650_10000935 3300025925 Bacteria 21996
193 Ga0207650_10062952 3300025925 Bacteria 2772
194 Ga0207650_10069639 3300025925 Bacteria 2643
195 Ga0207650_10131828 3300025925 Bacteria 1956
196 Ga0207644_10000179 3300025931 Bacteria 45397
197 Ga0207644_10079379 3300025931 Bacteria 2421
198 Ga0207706_10230131 3300025933 Bacteria 1622
199 Ga0207686_10000010 3300025934 Bacteria 227471
200 Ga0207686_10000248 3300025934 Bacteria 40993
201 Ga0207709_10000052 3300025935 Bacteria 227471
202 Ga0207670_10015588 3300025936 Unclassified 4545
203 Ga0207704_10013478 3300025938 Bacteria 4091
204 Ga0207691_10003804 3300025940 Bacteria 14648
205 Ga0207711_10184522 3300025941 Bacteria 1899
206 Ga0207711_10299598 3300025941 Bacteria 1483
207 Ga0207689_10004445 3300025942 Bacteria 12712
208 Ga0207689_10015572 3300025942 Bacteria 6441
209 Ga0207689_10035660 3300025942 Bacteria 4131
210 Ga0207679_10004953 3300025945 Bacteria 8308
211 Ga0207651_10043441 3300025960 Bacteria 3000
212 Ga0207651_10072393 3300025960 Bacteria 2447
213 Ga0207651_10073312 3300025960 Bacteria 2434
214 Ga0207712_10267426 3300025961 Bacteria 1389
215 Ga0207640_10041664 3300025981 Bacteria 2922
216 Ga0207640_10085504 3300025981 Bacteria 2169
217 Ga0207658_10037745 3300025986 Bacteria 3474
218 Ga0207677_10015880 3300026023 Bacteria 4444
219 Ga0207703_10028481 3300026035 Bacteria 4403
220 Ga0207703_10281503 3300026035 Unclassified 1510
221 Ga0207639_10080445 3300026041 Bacteria 2577
222 Ga0207708_10006106 3300026075 Bacteria 8931
223 Ga0207708_10113808 3300026075 Bacteria 2103
224 Ga0207708_10136244 3300026075 Bacteria 1923
225 Ga0207648_10136636 3300026089 Bacteria 2159
226 Ga0207648_10401676 3300026089 Unclassified 1242
227 Ga0207676_10001273 3300026095 Bacteria 18747
228 Ga0207676_10029674 3300026095 Bacteria 4097
229 Ga0207676_10049463 3300026095 Bacteria 3270
230 Ga0207674_10000019 3300026116 Bacteria 167439
231 Ga0207674_10121207 3300026116 Unclassified 2583
232 Ga0207675_100002215 3300026118 Bacteria 19313
233 Ga0207675_100136481 3300026118 Bacteria 2328
234 Ga0207675_100207492 3300026118 Bacteria 1883
235 Ga0207675_100330087 3300026118 Bacteria 1491
236 Ga0207683_10013972 3300026121 Bacteria 6847
237 Ga0268266_10123562 3300028379 Bacteria 2306
238 Ga0268265_10487211 3300028380 Unclassified 1159
239 Ga0268264_10133600 3300028381 Unclassified 2203
240 Ga0268264_10230013 3300028381 Bacteria 1712
241 Ga0307513_10002326 3300031456 Bacteria 26490
242 Ga0307513_10281827 3300031456 Bacteria 1439
243 Ga0307405_10004874 3300031731 Bacteria 6407
244 Ga0307405_10064420 3300031731 Unclassified 2330
245 Ga0307410_10245452 3300031852 Bacteria 1390
246 Ga0307406_10004079 3300031901 Bacteria 7951
247 Ga0307412_10036753 3300031911 Bacteria 3141
248 Ga0307416_100015704 3300032002 Bacteria 5239
249 Ga0307414_10006690 3300032004 Bacteria 6447
250 Ga0307415_100009505 3300032126 Bacteria 5455
251 Ga0307415_100306843 3300032126 Bacteria 1317
252 Ga0373941_0050928 3300035115 Bacteria 1316
253 Ga0395905_0037213 3300037471 Bacteria 4570
254 Ga0395905_0153094 3300037471 Bacteria 2169
255 Ga0395905_0270019 3300037471 Bacteria 1587
256 Ga0395901_0313945 3300038443 Bacteria 1623
257 Ga0242419_001192 3300038698 Unclassified 1569
258 Ga0242420_000602 3300038996 Unclassified 4199
259 Ga0436365_1394352 3300039437 Bacteria 3456
260 Ga0439434_0043228 3300042435 Unclassified 1386
261 Ga0451576_0483249 3300045051 Bacteria 1301
262 Ga0495651_0081827 3300046462 Bacteria 2437
263 Ga0495663_0000024 3300046525 Bacteria 97211
264 Ga0495598_0001483 3300046537 Bacteria 4671
265 Ga0495621_0001172 3300046539 Bacteria 6776
266 Ga0495621_0004533 3300046539 Unclassified 3918
267 Ga0495656_0026597 3300046615 Bacteria 2305
268 Ga0495600_0179203 3300046809 Unclassified 1366
269 Ga0496104_0155133 3300048907 Bacteria 2198
270 Ga0496112_0199677 3300048915 Bacteria 1960
271 Ga0501209_002481 3300049656 Bacteria 2852
272 Ga0501224_001399 3300049664 Bacteria 3193
273 Ga0501250_004413 3300049680 Bacteria 1399
274 Ga0501257_021745 3300049686 Bacteria 1514
275 nmdc:mga05p37_56689_c1 3300050507 Bacteria 4824
276 nmdc:mga09592_102054_c1 3300050508 Bacteria 2458
277 nmdc:mga0qj67_69091_c1 3300050509 Bacteria 2817
278 nmdc:mga06r32_210078_c1 3300050510 Bacteria 1934
279 nmdc:mga0n895_285956_c1 3300050512 Bacteria 1672
280 nmdc:mga0rr50_40052_c1 3300050513 Bacteria 3404
281 nmdc:mga0rr50_64_c1 3300050513 Bacteria 63318
282 nmdc:mga08x19_2203_c1 3300050514 Bacteria 11918
283 nmdc:mga08x19_61_c1 3300050514 Bacteria 114972
284 nmdc:mga0a205_150453_c1 3300050515 Bacteria 2227
285 nmdc:mga0a205_64236_c1 3300050515 Bacteria 3545
286 Ga0530510_0111677 3300061734 Bacteria 2002
287 Ga0207675_100197665
288 JGI25406J46586_10001896
289 JGI25406J46586_10044776
290 Ga0065704_10107380
291 Ga0065712_10010658
292 Ga0065712_10011468
293 Ga0065715_10019180
294 Ga0065715_10089602
295 Ga0065715_10095441
296 Ga0070690_100012284
297 Ga0070670_100003788
298 Ga0070670_100044359
299 Ga0070670_100057277
300 Ga0070670_100139082
301 Ga0068869_100030131
302 Ga0068869_100030294
303 Ga0070666_10033514
304 Ga0070680_100013502
305 Ga0070682_100000073
306 Ga0068868_100023891
307 Ga0068868_100048870
308 Ga0070689_100024787
309 Ga0070687_100033914
310 Ga0070661_100025282
311 Ga0070675_100237134
312 Ga0070671_100014584
313 Ga0070671_100033406
314 Ga0070671_100035467
315 Ga0070674_100134664
316 Ga0070673_100051513
317 Ga0070673_100081705
318 Ga0070673_100229246
319 Ga0070688_100122211
320 Ga0070659_100010294
321 Ga0070705_100017713
322 Ga0070705_100104852
323 Ga0070700_100002786
324 Ga0070694_100000832
325 Ga0070694_100012776
326 Ga0070694_100082167
327 Ga0070694_100084040
328 Ga0070694_100126383
329 Ga0070708_100000933
330 Ga0070678_100015121
331 Ga0070681_10001431
332 Ga0070681_10029881
333 Ga0068867_100125222
334 Ga0070706_100025115
335 Ga0070706_100044871
336 Ga0070707_100017014
337 Ga0070707_100401349
338 Ga0070698_100001384
339 Ga0070698_100036206
340 Ga0070699_100051274
341 Ga0070679_100408603
342 Ga0070684_100352782
343 Ga0070697_100001022
344 Ga0070697_100002331
345 Ga0070697_100017523
346 Ga0070697_100194959
347 Ga0070697_100310703
348 Ga0068853_100003797
349 Ga0070686_100003336
350 Ga0070686_100018035
351 Ga0070686_100169905
352 Ga0070696_100009375
353 Ga0070693_100006287
354 Ga0070693_100048487
355 Ga0070665_100108155
356 Ga0070704_100061344
357 Ga0070664_100001046
358 Ga0070664_100045362
359 Ga0070664_100125663
360 Ga0068857_100004900
361 Ga0068857_100097828
362 Ga0068857_100149878
363 Ga0068857_100178262
364 Ga0068854_100118464
365 Ga0070702_100032175
366 Ga0068852_100140706
367 Ga0068859_100006043
368 Ga0068859_100094885
369 Ga0068864_100001329
370 Ga0068864_100002573
371 Ga0068864_100045755
372 Ga0068864_100108434
373 Ga0068864_100185030
374 Ga0068866_10060073
375 Ga0068866_10076928
376 Ga0068861_100023187
377 Ga0068861_100232180
378 Ga0068870_10003654
379 Ga0068870_10029693
380 Ga0068863_100029639
381 Ga0068858_100218273
382 Ga0068858_100251097
383 Ga0068860_100027163
384 Ga0068862_100011327
385 Ga0068862_100362393
386 Ga0081539_10000652
387 Ga0081539_10001904
388 Ga0081539_10001938
389 Ga0081539_10002451
390 Ga0097621_100019902
391 Ga0097621_100213988
392 Ga0068871_100001546
393 Ga0068871_100009503
394 Ga0075430_100005780
395 Ga0075431_100015599
396 Ga0075433_10016544
397 Ga0075434_100118274
398 Ga0075429_100007792
399 Ga0068865_100004053
400 Ga0068865_100028337
401 Ga0075436_100000044
402 Ga0075436_100004392
403 Ga0097620_100006043
404 Ga0097620_100094885
405 Ga0075435_100000183
406 Ga0075435_100004755
407 Ga0075435_100199968
408 Ga0105251_10120295
409 Ga0111539_10350027
410 Ga0105245_10623530
411 Ga0105247_10041491
412 Ga0114129_10068603
413 Ga0114129_10134760
414 Ga0114129_10232116
415 Ga0105243_10000029
416 Ga0105243_10002540
417 Ga0105243_10009443
418 Ga0105243_10063844
419 Ga0105241_10023576
420 Ga0105241_10069994
421 Ga0105241_10087538
422 Ga0105241_10117071
423 Ga0105242_10000009
424 Ga0105242_10018844
425 Ga0105248_10005727
426 Ga0105248_10026862
427 Ga0105248_10078802
428 Ga0105237_10305504
429 Ga0105239_10029053
430 Ga0105239_10064067
431 Ga0105246_10021695
432 Ga0105246_10088148
433 Ga0105246_10436537
434 Ga0157373_10068277
435 Ga0157373_10115436
436 Ga0157371_10113742
437 Ga0157378_10000707
438 Ga0157378_10013342
439 Ga0157378_10023508
440 Ga0157378_10048663
441 Ga0157378_10096603
442 Ga0163162_10003906
443 Ga0157375_10001200
444 Ga0157375_10161069
445 Ga0157375_10444038
446 Ga0163163_10012702
447 Ga0163163_10015859
448 Ga0163163_10025451
449 Ga0163163_10037386
450 Ga0163163_10047623
451 Ga0157380_10015090
452 Ga0157380_10284953
453 Ga0157377_10014864
454 Ga0157377_10093813
455 Ga0157379_10242567
456 Ga0157376_10004618
457 Ga0157376_10165668
458 Ga0157376_10302843
459 Ga0163161_10031594
460 Ga0207642_10116209
461 Ga0207710_10047212
462 Ga0207680_10039092
463 Ga0207647_10015048
464 Ga0207643_10000737
465 Ga0207643_10074616
466 Ga0207684_10001621
467 Ga0207684_10015479
468 Ga0207654_10022963
469 Ga0207654_10057912
470 Ga0207654_10062697
471 Ga0207654_10179237
472 Ga0207707_10015220
473 Ga0207662_10002715
474 Ga0207649_10008515
475 Ga0207646_10024586
476 Ga0207681_10000672
477 Ga0207681_10086686
478 Ga0207650_10000935
479 Ga0207650_10062952
480 Ga0207650_10069639
481 Ga0207650_10131828
482 Ga0207644_10000179
483 Ga0207644_10079379
484 Ga0207706_10230131
485 Ga0207686_10000010
486 Ga0207686_10000248
487 Ga0207709_10000052
488 Ga0207670_10015588
489 Ga0207704_10013478
490 Ga0207691_10003804
491 Ga0207711_10184522
492 Ga0207711_10299598
493 Ga0207689_10004445
494 Ga0207689_10015572
495 Ga0207689_10035660
496 Ga0207679_10004953
497 Ga0207651_10043441
498 Ga0207651_10072393
499 Ga0207651_10073312
500 Ga0207712_10267426
501 Ga0207640_10041664
502 Ga0207640_10085504
503 Ga0207658_10037745
504 Ga0207677_10015880
505 Ga0207703_10028481
506 Ga0207703_10281503
507 Ga0207639_10080445
508 Ga0207708_10006106
509 Ga0207708_10113808
510 Ga0207708_10136244
511 Ga0207648_10136636
512 Ga0207648_10401676
513 Ga0207676_10001273
514 Ga0207676_10029674
515 Ga0207676_10049463
516 Ga0207674_10000019
517 Ga0207674_10121207
518 Ga0207675_100002215
519 Ga0207675_100136481
520 Ga0207675_100207492
521 Ga0207675_100330087
522 Ga0207683_10013972
523 Ga0268266_10123562
524 Ga0268265_10487211
525 Ga0268264_10133600
526 Ga0268264_10230013
527 Ga0307513_10002326
528 Ga0307513_10281827
529 Ga0307405_10004874
530 Ga0307405_10064420
531 Ga0307410_10245452
532 Ga0307406_10004079
533 Ga0307412_10036753
534 Ga0307416_100015704
535 Ga0307414_10006690
536 Ga0307415_100009505
537 Ga0307415_100306843
538 Ga0373941_0050928
539 Ga0395905_0037213
540 Ga0395905_0153094
541 Ga0395905_0270019
542 Ga0395901_0313945
543 Ga0242419_001192
544 Ga0242420_000602
545 Ga0436365_1394352
546 Ga0439434_0043228
547 Ga0451576_0483249
548 Ga0495651_0081827
549 Ga0495663_0000024
550 Ga0495598_0001483
551 Ga0495621_0001172
552 Ga0495621_0004533
553 Ga0495656_0026597
554 Ga0495600_0179203
555 Ga0496104_0155133
556 Ga0496112_0199677
557 Ga0501209_002481
558 Ga0501224_001399
559 Ga0501250_004413
560 Ga0501257_021745
561 nmdc:mga05p37_56689_c1
562 nmdc:mga09592_102054_c1
563 nmdc:mga0qj67_69091_c1
564 nmdc:mga06r32_210078_c1
565 nmdc:mga0n895_285956_c1
566 nmdc:mga0rr50_40052_c1
567 nmdc:mga0rr50_64_c1
568 nmdc:mga08x19_2203_c1
569 nmdc:mga08x19_61_c1
570 nmdc:mga0a205_150453_c1
571 nmdc:mga0a205_64236_c1
572 Ga0530510_0111677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09721

Exosortase_EpsH

Transmembrane exosortase (Exosortase_EpsH)

249

327

0.92

PF09721

Exosortase_EpsH

Transmembrane exosortase (Exosortase_EpsH)

32

233

0.91

Map