F387468

General Info

Members Datasets Scaffolds Average Seq Length
286 125 572 415

Family's Representative Sequence

Representative Sequence 3300025981|Ga0207640_10319459|Ga0207640_103194591
Length 394
Sequence MGPGDFEILTKGCVDVVTPASLKEKLARGKPLTVKVGFDPTAPDIHLGHTVLMRKMKHFQDAGHRVVFVIGDFTGMIGDPTGKSKTRPPLTRAEIEANAETYKRQAFKILDPVKTETRFNREWLGALAADDVVRLAATYNVARMLERREFRQRFDAGQPISLHEFLYPLSQAYDSVALKADVELGGTDQLFNLNVGRDIMPSYGLEAQVVMTTPLLEGTDGVEKMSKSLGNYIGVAESADAMFGKLLSISDELMWKYYLLLTDLTPAEIATEKGLGRPMDSKIALARRVAADFHGTALAAAAEAEWRRVHQARQAPSEMPEKAIAPGRHKWRELLVAGALAPSKSEAERLLRQRAVKKDGVVVEAGTDLEAAASESFVVSVGAARFVRFRVESA

Samples

Sample ID Description Type Environment
1 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
64 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
65 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
69 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
70 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
71 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
72 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
73 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
74 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
75 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
76 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
77 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
97 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
98 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
99 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
100 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
102 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
106 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
110 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
111 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
122 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
123 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
125 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 0
Rhizoplane 2.45
Rhizosphere 93.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207640_10319459 3300025981 Bacteria 1236
2 Ga0065712_10078683 3300005290 Bacteria 3309
3 Ga0065707_10113568 3300005295 Bacteria 2324
4 Ga0065707_10114517 3300005295 Bacteria 2295
5 Ga0065707_10118762 3300005295 Bacteria 2177
6 Ga0070670_100142242 3300005331 Bacteria 2075
7 Ga0070671_100008809 3300005355 Bacteria 8093
8 Ga0070688_100102082 3300005365 Bacteria 1893
9 Ga0070667_100189820 3300005367 Bacteria 1820
10 Ga0070694_100015437 3300005444 Bacteria 4798
11 Ga0070678_100107194 3300005456 Bacteria 2179
12 Ga0070662_100076847 3300005457 Bacteria 2476
13 Ga0070685_10097086 3300005466 Bacteria 1794
14 Ga0070685_10147696 3300005466 Bacteria 1487
15 Ga0070672_100057793 3300005543 Bacteria 3046
16 Ga0070686_100043209 3300005544 Bacteria 2827
17 Ga0070695_100000275 3300005545 Bacteria 25881
18 Ga0070665_100224257 3300005548 Bacteria 1880
19 Ga0068859_100031477 3300005617 Bacteria 5327
20 Ga0068864_100085473 3300005618 Bacteria 2774
21 Ga0068861_100049065 3300005719 Bacteria 3195
22 Ga0068863_100045317 3300005841 Bacteria 4174
23 Ga0068863_100188794 3300005841 Bacteria 1980
24 Ga0068858_100062686 3300005842 Bacteria 3438
25 Ga0068860_100297238 3300005843 Bacteria 1581
26 Ga0075368_10034007 3300006042 Bacteria 1985
27 Ga0075364_10011915 3300006051 Bacteria 5298
28 Ga0075364_10044418 3300006051 Bacteria 2890
29 Ga0075367_10123704 3300006178 Bacteria 1595
30 Ga0075366_10002470 3300006195 Bacteria 9469
31 Ga0075366_10004749 3300006195 Bacteria 7322
32 Ga0075366_10099286 3300006195 Bacteria 1746
33 Ga0075428_100000364 3300006844 Bacteria 44975
34 Ga0075428_100002761 3300006844 Bacteria 19113
35 Ga0075428_100010186 3300006844 Bacteria 10438
36 Ga0075428_100014809 3300006844 Bacteria 8667
37 Ga0075428_100049108 3300006844 Bacteria 4630
38 Ga0075430_100003140 3300006846 Bacteria 13820
39 Ga0075430_100003359 3300006846 Bacteria 13407
40 Ga0075431_100002079 3300006847 Bacteria 19113
41 Ga0075431_100027703 3300006847 Bacteria 5816
42 Ga0075431_100054284 3300006847 Bacteria 4132
43 Ga0075431_100056878 3300006847 Bacteria 4034
44 Ga0075431_100098299 3300006847 Bacteria 3022
45 Ga0075433_10168483 3300006852 Bacteria 1949
46 Ga0075433_10278230 3300006852 Bacteria 1483
47 Ga0075429_100060030 3300006880 Bacteria 3313
48 Ga0068865_100138723 3300006881 Bacteria 1831
49 Ga0097620_100031476 3300006931 Bacteria 5327
50 Ga0111539_10000364 3300009094 Bacteria 55762
51 Ga0111539_10004093 3300009094 Bacteria 19136
52 Ga0111539_10020503 3300009094 Bacteria 8141
53 Ga0111539_10049279 3300009094 Bacteria 5024
54 Ga0111539_10052351 3300009094 Bacteria 4860
55 Ga0111539_10077191 3300009094 Bacteria 3921
56 Ga0114129_10000162 3300009147 Bacteria 71781
57 Ga0114129_10004836 3300009147 Bacteria 19019
58 Ga0114129_10007819 3300009147 Bacteria 15211
59 Ga0114129_10048030 3300009147 Bacteria 5997
60 Ga0114129_10101036 3300009147 Bacteria 3991
61 Ga0114129_10159130 3300009147 Bacteria 3087
62 Ga0114129_10247265 3300009147 Bacteria 2396
63 Ga0114129_10299167 3300009147 Bacteria 2145
64 Ga0114129_10338619 3300009147 Bacteria 1996
65 Ga0105242_10187529 3300009176 Bacteria 1829
66 Ga0105248_10023847 3300009177 Bacteria 6801
67 Ga0105248_10048462 3300009177 Bacteria 4766
68 Ga0105248_10099192 3300009177 Bacteria 3282
69 Ga0105248_10461350 3300009177 Bacteria 1432
70 Ga0157374_10091423 3300013296 Bacteria 2902
71 Ga0157378_10212742 3300013297 Bacteria 1834
72 Ga0163162_10161337 3300013306 Bacteria 2364
73 Ga0163162_10171642 3300013306 Bacteria 2293
74 Ga0163163_10000042 3300014325 Bacteria 138794
75 Ga0163163_10018059 3300014325 Bacteria 6591
76 Ga0163163_10119805 3300014325 Bacteria 2665
77 Ga0157380_10044406 3300014326 Bacteria 3483
78 Ga0157380_10083625 3300014326 Bacteria 2615
79 Ga0157380_10109399 3300014326 Bacteria 2319
80 Ga0157376_10141078 3300014969 Bacteria 2162
81 Ga0163161_10079589 3300017792 Bacteria 2410
82 Ga0207697_10001552 3300025315 Bacteria 12423
83 Ga0207670_10100074 3300025936 Bacteria 2069
84 Ga0207669_10003670 3300025937 Bacteria 6669
85 Ga0207669_10008711 3300025937 Bacteria 4780
86 Ga0207704_10065628 3300025938 Bacteria 2274
87 Ga0207679_10142789 3300025945 Bacteria 1937
88 Ga0207651_10108523 3300025960 Bacteria 2078
89 Ga0207678_10043903 3300026067 Bacteria 3867
90 Ga0207708_10195818 3300026075 Bacteria 1610
91 Ga0207675_100034133 3300026118 Bacteria 4742
92 Ga0207683_10137037 3300026121 Bacteria 2203
93 Ga0207428_10000998 3300027907 Bacteria 31385
94 Ga0207428_10001099 3300027907 Bacteria 29427
95 Ga0207428_10059336 3300027907 Bacteria 3034
96 Ga0268264_10263159 3300028381 Bacteria 1608
97 Ga0307408_100072566 3300031548 Bacteria 2549
98 Ga0307408_100169468 3300031548 Bacteria 1742
99 Ga0307405_10052200 3300031731 Bacteria 2541
100 Ga0307407_10037094 3300031903 Bacteria 2691
101 Ga0307407_10149909 3300031903 Bacteria 1514
102 Ga0307412_10029810 3300031911 Bacteria 3428
103 Ga0307412_10071890 3300031911 Bacteria 2363
104 Ga0307416_100028605 3300032002 Bacteria 4148
105 Ga0307416_100128933 3300032002 Bacteria 2272
106 Ga0307416_100187126 3300032002 Bacteria 1948
107 Ga0307411_10064713 3300032005 Bacteria 2449
108 Ga0307411_10077645 3300032005 Bacteria 2274
109 Ga0307415_100085430 3300032126 Bacteria 2267
110 Ga0450896_001436 3300042133 Bacteria 2932
111 Ga0450908_006552 3300042184 Bacteria 2207
112 Ga0439464_0000613 3300042439 Bacteria 7545
113 Ga0451577_0008817 3300042876 Bacteria 9770
114 Ga0453684_0022509 3300044712 Bacteria 9343
115 Ga0495638_0002005 3300046460 Bacteria 17384
116 Ga0495639_0003656 3300046475 Bacteria 6623
117 Ga0495676_0052256 3300047321 Bacteria 3263
118 Ga0495680_0102654 3300047322 Bacteria 2129
119 Ga0496109_0006337 3300048912 Bacteria 9964
120 Ga0496109_0260920 3300048912 Bacteria 1632
121 Ga0496110_0108113 3300048913 Bacteria 2497
122 Ga0496111_0167897 3300048914 Bacteria 1630
123 Ga0496112_0026840 3300048915 Bacteria 5549
124 Ga0496112_0109151 3300048915 Bacteria 2737
125 Ga0496114_0281320 3300048917 Bacteria 1467
126 Ga0501031_0001087 3300049568 Bacteria 16537
127 Ga0501031_0055846 3300049568 Bacteria 2573
128 Ga0501032_0004392 3300049569 Bacteria 10644
129 Ga0501032_0027987 3300049569 Bacteria 3873
130 Ga0501032_0062875 3300049569 Bacteria 2486
131 Ga0501033_0013907 3300049570 Bacteria 6124
132 Ga0501033_0016604 3300049570 Bacteria 5569
133 Ga0501033_0053973 3300049570 Bacteria 2974
134 Ga0501034_0005150 3300049571 Bacteria 14343
135 Ga0501034_0031287 3300049571 Bacteria 5405
136 Ga0501034_0044607 3300049571 Bacteria 4482
137 Ga0501034_0045583 3300049571 Bacteria 4430
138 Ga0501034_0142623 3300049571 Bacteria 2374
139 Ga0501036_0015303 3300049572 Bacteria 6404
140 Ga0501036_0018437 3300049572 Bacteria 5847
141 Ga0501036_0033353 3300049572 Bacteria 4354
142 Ga0501036_0081373 3300049572 Bacteria 2737
143 Ga0501036_0113712 3300049572 Bacteria 2287
144 Ga0501037_0001467 3300049573 Bacteria 17296
145 Ga0501037_0025268 3300049573 Bacteria 4388
146 Ga0501037_0077765 3300049573 Bacteria 2407
147 Ga0501038_0003829 3300049574 Bacteria 13993
148 Ga0501038_0007413 3300049574 Bacteria 10119
149 Ga0501038_0022442 3300049574 Bacteria 5655
150 Ga0501038_0036573 3300049574 Bacteria 4308
151 Ga0501039_0031628 3300049575 Bacteria 4080
152 Ga0501039_0033915 3300049575 Bacteria 3938
153 Ga0501039_0076813 3300049575 Bacteria 2597
154 Ga0501039_0113585 3300049575 Bacteria 2118
155 Ga0501040_0041141 3300049576 Bacteria 3147
156 Ga0501040_0048852 3300049576 Bacteria 2892
157 Ga0501040_0065332 3300049576 Bacteria 2506
158 Ga0501041_0052723 3300049577 Bacteria 2480
159 Ga0501042_0046537 3300049578 Bacteria 3093
160 Ga0501042_0050232 3300049578 Bacteria 2975
161 Ga0501042_0080277 3300049578 Bacteria 2337
162 Ga0501042_0081687 3300049578 Bacteria 2316
163 Ga0501043_0007693 3300049579 Bacteria 8533
164 Ga0501043_0012710 3300049579 Bacteria 6582
165 Ga0501043_0038391 3300049579 Bacteria 3765
166 Ga0501043_0039540 3300049579 Bacteria 3706
167 Ga0501043_0060400 3300049579 Bacteria 2975
168 Ga0501043_0098147 3300049579 Bacteria 2302
169 Ga0501046_0005157 3300049580 Bacteria 11710
170 Ga0501046_0047415 3300049580 Bacteria 3406
171 Ga0501046_0051588 3300049580 Bacteria 3245
172 Ga0501046_0065210 3300049580 Bacteria 2842
173 Ga0501046_0095578 3300049580 Bacteria 2282
174 Ga0501046_0109388 3300049580 Bacteria 2113
175 Ga0501046_0118864 3300049580 Bacteria 2012
176 Ga0501047_0004046 3300049581 Bacteria 13787
177 Ga0501047_0004351 3300049581 Bacteria 13321
178 Ga0501047_0075319 3300049581 Bacteria 3247
179 Ga0501047_0221273 3300049581 Bacteria 1749
180 Ga0501048_0001810 3300049582 Bacteria 16239
181 Ga0501048_0008424 3300049582 Bacteria 7797
182 Ga0501048_0024909 3300049582 Bacteria 4365
183 Ga0501048_0139350 3300049582 Bacteria 1715
184 Ga0501067_0000955 3300049583 Bacteria 15486
185 Ga0501067_0110099 3300049583 Bacteria 1531
186 Ga0501068_0032720 3300049584 Bacteria 3092
187 Ga0501068_0039718 3300049584 Bacteria 2822
188 Ga0501068_0061681 3300049584 Bacteria 2278
189 Ga0501069_0011667 3300049585 Bacteria 4659
190 Ga0501069_0034388 3300049585 Bacteria 2791
191 Ga0501069_0036759 3300049585 Bacteria 2701
192 Ga0501070_0083310 3300049586 Bacteria 2647
193 Ga0501070_0115848 3300049586 Bacteria 2213
194 Ga0501070_0141335 3300049586 Bacteria 1987
195 Ga0501071_0044698 3300049587 Bacteria 3177
196 Ga0501071_0052373 3300049587 Bacteria 2943
197 Ga0501072_0025885 3300049588 Bacteria 4571
198 Ga0501072_0056057 3300049588 Bacteria 3106
199 Ga0501073_0000607 3300049589 Bacteria 25259
200 Ga0501073_0002377 3300049589 Bacteria 14091
201 Ga0501073_0067440 3300049589 Bacteria 2494
202 Ga0501073_0133123 3300049589 Bacteria 1723
203 Ga0501074_0018380 3300049590 Bacteria 5076
204 Ga0501074_0029996 3300049590 Bacteria 3941
205 Ga0501074_0219175 3300049590 Bacteria 1355
206 Ga0501075_0030090 3300049591 Bacteria 4019
207 Ga0501076_0025178 3300049592 Bacteria 4604
208 Ga0501076_0037454 3300049592 Bacteria 3804
209 Ga0501076_0064520 3300049592 Bacteria 2919
210 Ga0501076_0066047 3300049592 Bacteria 2886
211 Ga0501076_0092988 3300049592 Bacteria 2426
212 Ga0501076_0173228 3300049592 Bacteria 1759
213 Ga0501076_0198391 3300049592 Bacteria 1638
214 Ga0501077_0084903 3300049593 Bacteria 2007
215 Ga0501079_0001009 3300049741 Bacteria 19500
216 Ga0501079_0025339 3300049741 Bacteria 4550
217 Ga0501079_0063856 3300049741 Bacteria 2840
218 Ga0501079_0129807 3300049741 Bacteria 1961
219 Ga0501079_0236594 3300049741 Bacteria 1427
220 Ga0501080_0005425 3300049742 Bacteria 11376
221 Ga0501080_0045419 3300049742 Bacteria 4089
222 Ga0501080_0205509 3300049742 Bacteria 1806
223 Ga0501080_0272864 3300049742 Bacteria 1539
224 Ga0501081_0069255 3300049743 Bacteria 2458
225 Ga0501081_0123800 3300049743 Bacteria 1844
226 Ga0501083_0015872 3300049744 Bacteria 5271
227 Ga0501083_0030226 3300049744 Bacteria 3722
228 Ga0501083_0132512 3300049744 Bacteria 1634
229 Ga0501035_0010417 3300049822 Bacteria 8617
230 Ga0501035_0036111 3300049822 Bacteria 4480
231 Ga0501035_0047150 3300049822 Bacteria 3870
232 Ga0501035_0077967 3300049822 Bacteria 2928
233 Ga0501035_0216597 3300049822 Bacteria 1636
234 Ga0501035_0318570 3300049822 Bacteria 1307
235 Ga0501044_0006011 3300049823 Bacteria 13408
236 Ga0501044_0007201 3300049823 Bacteria 12235
237 Ga0501044_0027372 3300049823 Bacteria 6026
238 Ga0501044_0088969 3300049823 Bacteria 3117
239 Ga0501044_0213980 3300049823 Bacteria 1880
240 Ga0501044_0232052 3300049823 Bacteria 1792
241 Ga0501045_0040775 3300049824 Bacteria 3377
242 Ga0501045_0093792 3300049824 Bacteria 2220
243 Ga0501045_0191698 3300049824 Bacteria 1523
244 nmdc:mga0k408_10498_c1 3300050493 Bacteria 5010
245 nmdc:mga0k408_18321_c1 3300050493 Bacteria 3907
246 nmdc:mga0k408_48472_c1 3300050493 Bacteria 2457
247 nmdc:mga0k408_76054_c1 3300050493 Bacteria 1962
248 nmdc:mga0k408_8966_c1 3300050493 Bacteria 3406
249 nmdc:mga07m45_1997_c1 3300050496 Bacteria 9450
250 nmdc:mga05p37_3104_c1 3300050507 Bacteria 19302
251 nmdc:mga05p37_31291_c1 3300050507 Bacteria 6500
252 nmdc:mga05p37_53_c1 3300050507 Bacteria 102685
253 nmdc:mga05p37_7133_c1 3300050507 Bacteria 13178
254 nmdc:mga05p37_80854_c1 3300050507 Bacteria 4003
255 nmdc:mga09592_17050_c1 3300050508 Bacteria 5946
256 nmdc:mga09592_261555_c1 3300050508 Bacteria 1500
257 nmdc:mga09592_38193_c1 3300050508 Bacteria 4029
258 nmdc:mga0qj67_232202_c1 3300050509 Bacteria 1497
259 nmdc:mga0qj67_24533_c1 3300050509 Bacteria 4650
260 nmdc:mga0qj67_31047_c1 3300050509 Bacteria 4161
261 nmdc:mga0qj67_45950_c1 3300050509 Bacteria 3446
262 nmdc:mga06r32_1125_c1 3300050510 Bacteria 23961
263 nmdc:mga06r32_123786_c1 3300050510 Bacteria 2552
264 nmdc:mga06r32_124023_c1 3300050510 Bacteria 2550
265 nmdc:mga06r32_127534_c1 3300050510 Bacteria 2514
266 nmdc:mga06r32_364426_c1 3300050510 Bacteria 1429
267 nmdc:mga06r32_39376_c1 3300050510 Bacteria 4484
268 nmdc:mga08y16_2429_c1 3300050511 Bacteria 19134
269 nmdc:mga08y16_256307_c1 3300050511 Bacteria 1807
270 nmdc:mga08y16_383265_c1 3300050511 Bacteria 1441
271 nmdc:mga08y16_9382_c1 3300050511 Bacteria 10262
272 nmdc:mga0a205_3965_c1 3300050515 Bacteria 13237
273 Ga0495595_0044026 3300053084 Bacteria 2050
274 Ga0495619_0062692 3300053085 Bacteria 2475
275 Ga0495619_0076860 3300053085 Bacteria 2242
276 Ga0501084_0042710 3300054114 Bacteria 3792
277 Ga0501084_0094523 3300054114 Bacteria 2510
278 Ga0590074_002476 3300059423 Bacteria 3030
279 Ga0590075_003196 3300059424 Bacteria 3899
280 Ga0590077_000498 3300059426 Bacteria 10968
281 Ga0501082_0015616 3300060353 Bacteria 6535
282 Ga0501082_0021843 3300060353 Bacteria 5516
283 Ga0501082_0034357 3300060353 Bacteria 4372
284 Ga0501082_0106389 3300060353 Bacteria 2427
285 Ga0501082_0117953 3300060353 Bacteria 2299
286 Ga0530510_0145610 3300061734 Bacteria 1747
287 Ga0207640_10319459
288 Ga0065712_10078683
289 Ga0065707_10113568
290 Ga0065707_10114517
291 Ga0065707_10118762
292 Ga0070670_100142242
293 Ga0070671_100008809
294 Ga0070688_100102082
295 Ga0070667_100189820
296 Ga0070694_100015437
297 Ga0070678_100107194
298 Ga0070662_100076847
299 Ga0070685_10097086
300 Ga0070685_10147696
301 Ga0070672_100057793
302 Ga0070686_100043209
303 Ga0070695_100000275
304 Ga0070665_100224257
305 Ga0068859_100031477
306 Ga0068864_100085473
307 Ga0068861_100049065
308 Ga0068863_100045317
309 Ga0068863_100188794
310 Ga0068858_100062686
311 Ga0068860_100297238
312 Ga0075368_10034007
313 Ga0075364_10011915
314 Ga0075364_10044418
315 Ga0075367_10123704
316 Ga0075366_10002470
317 Ga0075366_10004749
318 Ga0075366_10099286
319 Ga0075428_100000364
320 Ga0075428_100002761
321 Ga0075428_100010186
322 Ga0075428_100014809
323 Ga0075428_100049108
324 Ga0075430_100003140
325 Ga0075430_100003359
326 Ga0075431_100002079
327 Ga0075431_100027703
328 Ga0075431_100054284
329 Ga0075431_100056878
330 Ga0075431_100098299
331 Ga0075433_10168483
332 Ga0075433_10278230
333 Ga0075429_100060030
334 Ga0068865_100138723
335 Ga0097620_100031476
336 Ga0111539_10000364
337 Ga0111539_10004093
338 Ga0111539_10020503
339 Ga0111539_10049279
340 Ga0111539_10052351
341 Ga0111539_10077191
342 Ga0114129_10000162
343 Ga0114129_10004836
344 Ga0114129_10007819
345 Ga0114129_10048030
346 Ga0114129_10101036
347 Ga0114129_10159130
348 Ga0114129_10247265
349 Ga0114129_10299167
350 Ga0114129_10338619
351 Ga0105242_10187529
352 Ga0105248_10023847
353 Ga0105248_10048462
354 Ga0105248_10099192
355 Ga0105248_10461350
356 Ga0157374_10091423
357 Ga0157378_10212742
358 Ga0163162_10161337
359 Ga0163162_10171642
360 Ga0163163_10000042
361 Ga0163163_10018059
362 Ga0163163_10119805
363 Ga0157380_10044406
364 Ga0157380_10083625
365 Ga0157380_10109399
366 Ga0157376_10141078
367 Ga0163161_10079589
368 Ga0207697_10001552
369 Ga0207670_10100074
370 Ga0207669_10003670
371 Ga0207669_10008711
372 Ga0207704_10065628
373 Ga0207679_10142789
374 Ga0207651_10108523
375 Ga0207678_10043903
376 Ga0207708_10195818
377 Ga0207675_100034133
378 Ga0207683_10137037
379 Ga0207428_10000998
380 Ga0207428_10001099
381 Ga0207428_10059336
382 Ga0268264_10263159
383 Ga0307408_100072566
384 Ga0307408_100169468
385 Ga0307405_10052200
386 Ga0307407_10037094
387 Ga0307407_10149909
388 Ga0307412_10029810
389 Ga0307412_10071890
390 Ga0307416_100028605
391 Ga0307416_100128933
392 Ga0307416_100187126
393 Ga0307411_10064713
394 Ga0307411_10077645
395 Ga0307415_100085430
396 Ga0450896_001436
397 Ga0450908_006552
398 Ga0439464_0000613
399 Ga0451577_0008817
400 Ga0453684_0022509
401 Ga0495638_0002005
402 Ga0495639_0003656
403 Ga0495676_0052256
404 Ga0495680_0102654
405 Ga0496109_0006337
406 Ga0496109_0260920
407 Ga0496110_0108113
408 Ga0496111_0167897
409 Ga0496112_0026840
410 Ga0496112_0109151
411 Ga0496114_0281320
412 Ga0501031_0001087
413 Ga0501031_0055846
414 Ga0501032_0004392
415 Ga0501032_0027987
416 Ga0501032_0062875
417 Ga0501033_0013907
418 Ga0501033_0016604
419 Ga0501033_0053973
420 Ga0501034_0005150
421 Ga0501034_0031287
422 Ga0501034_0044607
423 Ga0501034_0045583
424 Ga0501034_0142623
425 Ga0501036_0015303
426 Ga0501036_0018437
427 Ga0501036_0033353
428 Ga0501036_0081373
429 Ga0501036_0113712
430 Ga0501037_0001467
431 Ga0501037_0025268
432 Ga0501037_0077765
433 Ga0501038_0003829
434 Ga0501038_0007413
435 Ga0501038_0022442
436 Ga0501038_0036573
437 Ga0501039_0031628
438 Ga0501039_0033915
439 Ga0501039_0076813
440 Ga0501039_0113585
441 Ga0501040_0041141
442 Ga0501040_0048852
443 Ga0501040_0065332
444 Ga0501041_0052723
445 Ga0501042_0046537
446 Ga0501042_0050232
447 Ga0501042_0080277
448 Ga0501042_0081687
449 Ga0501043_0007693
450 Ga0501043_0012710
451 Ga0501043_0038391
452 Ga0501043_0039540
453 Ga0501043_0060400
454 Ga0501043_0098147
455 Ga0501046_0005157
456 Ga0501046_0047415
457 Ga0501046_0051588
458 Ga0501046_0065210
459 Ga0501046_0095578
460 Ga0501046_0109388
461 Ga0501046_0118864
462 Ga0501047_0004046
463 Ga0501047_0004351
464 Ga0501047_0075319
465 Ga0501047_0221273
466 Ga0501048_0001810
467 Ga0501048_0008424
468 Ga0501048_0024909
469 Ga0501048_0139350
470 Ga0501067_0000955
471 Ga0501067_0110099
472 Ga0501068_0032720
473 Ga0501068_0039718
474 Ga0501068_0061681
475 Ga0501069_0011667
476 Ga0501069_0034388
477 Ga0501069_0036759
478 Ga0501070_0083310
479 Ga0501070_0115848
480 Ga0501070_0141335
481 Ga0501071_0044698
482 Ga0501071_0052373
483 Ga0501072_0025885
484 Ga0501072_0056057
485 Ga0501073_0000607
486 Ga0501073_0002377
487 Ga0501073_0067440
488 Ga0501073_0133123
489 Ga0501074_0018380
490 Ga0501074_0029996
491 Ga0501074_0219175
492 Ga0501075_0030090
493 Ga0501076_0025178
494 Ga0501076_0037454
495 Ga0501076_0064520
496 Ga0501076_0066047
497 Ga0501076_0092988
498 Ga0501076_0173228
499 Ga0501076_0198391
500 Ga0501077_0084903
501 Ga0501079_0001009
502 Ga0501079_0025339
503 Ga0501079_0063856
504 Ga0501079_0129807
505 Ga0501079_0236594
506 Ga0501080_0005425
507 Ga0501080_0045419
508 Ga0501080_0205509
509 Ga0501080_0272864
510 Ga0501081_0069255
511 Ga0501081_0123800
512 Ga0501083_0015872
513 Ga0501083_0030226
514 Ga0501083_0132512
515 Ga0501035_0010417
516 Ga0501035_0036111
517 Ga0501035_0047150
518 Ga0501035_0077967
519 Ga0501035_0216597
520 Ga0501035_0318570
521 Ga0501044_0006011
522 Ga0501044_0007201
523 Ga0501044_0027372
524 Ga0501044_0088969
525 Ga0501044_0213980
526 Ga0501044_0232052
527 Ga0501045_0040775
528 Ga0501045_0093792
529 Ga0501045_0191698
530 nmdc:mga0k408_10498_c1
531 nmdc:mga0k408_18321_c1
532 nmdc:mga0k408_48472_c1
533 nmdc:mga0k408_76054_c1
534 nmdc:mga0k408_8966_c1
535 nmdc:mga07m45_1997_c1
536 nmdc:mga05p37_3104_c1
537 nmdc:mga05p37_31291_c1
538 nmdc:mga05p37_53_c1
539 nmdc:mga05p37_7133_c1
540 nmdc:mga05p37_80854_c1
541 nmdc:mga09592_17050_c1
542 nmdc:mga09592_261555_c1
543 nmdc:mga09592_38193_c1
544 nmdc:mga0qj67_232202_c1
545 nmdc:mga0qj67_24533_c1
546 nmdc:mga0qj67_31047_c1
547 nmdc:mga0qj67_45950_c1
548 nmdc:mga06r32_1125_c1
549 nmdc:mga06r32_123786_c1
550 nmdc:mga06r32_124023_c1
551 nmdc:mga06r32_127534_c1
552 nmdc:mga06r32_364426_c1
553 nmdc:mga06r32_39376_c1
554 nmdc:mga08y16_2429_c1
555 nmdc:mga08y16_256307_c1
556 nmdc:mga08y16_383265_c1
557 nmdc:mga08y16_9382_c1
558 nmdc:mga0a205_3965_c1
559 Ga0495595_0044026
560 Ga0495619_0062692
561 Ga0495619_0076860
562 Ga0501084_0042710
563 Ga0501084_0094523
564 Ga0590074_002476
565 Ga0590075_003196
566 Ga0590077_000498
567 Ga0501082_0015616
568 Ga0501082_0021843
569 Ga0501082_0034357
570 Ga0501082_0106389
571 Ga0501082_0117953
572 Ga0530510_0145610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00579

tRNA-synt_1b

tRNA synthetases class I (W and Y)

27

311

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bqz-assembly1.cif.gz_A crystal structure of tyrosine-trna synthetase from acinetobacter baumannii with bound l-tyrosine 0.939 5 221
6bqz-assembly2.cif.gz_B crystal structure of tyrosine-trna synthetase from acinetobacter baumannii with bound l-tyrosine 0.9372 5 221
6byq-assembly1.cif.gz_A-2 crystal structure of tyrosine-trna ligase from helicobacter pylori g27 0.9294 5 314
6vwl-assembly1.cif.gz_c 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) 0.9278 345 396
6bqy-assembly2.cif.gz_B crystal structure of tyrosine-trna synthetase from acinetobacter baumannii 0.9185 5 221
ID Description Score Start End Superfamily
af_A0A0P0Y445_123_179_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9689 344 383 3.10.290.10
af_C6TBL4_107_182_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9662 344 383 3.10.290.10
af_A0A144A2N8_107_181_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9639 344 385 3.10.290.10
1h3fB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9328 6 222 3.40.50.620
1h3fB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.924 6 222 3.40.50.620
ID Description Score Start End GO Terms
AF-X1RTR0-F1-model_v4 tyrosine--tRNA ligase (EC 6.1.1.1) 0.952 165 316 GO:0004831
GO:0005524
GO:0005829
GO:0006437
AF-A0A3D3SE74-F1-model_v4 deleted 0.9491 178 316
AF-A0A6I1INX2-F1-model_v4 deleted 0.9488 112 260
AF-A0A7W0V2K0-F1-model_v4 Tyrosine--tRNA ligase (EC 6.1.1.1) 0.9478 4 297 GO:0004831
GO:0005524
GO:0005829
GO:0006437
AF-A0A7X7BTK9-F1-model_v4 Tyrosine--tRNA ligase (EC 6.1.1.1) 0.9462 4 298 GO:0004831
GO:0005524
GO:0005829
GO:0006437

Map