F387319

General Info

Members Datasets Scaffolds Average Seq Length
286 193 286 330

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100021562|Ga0068856_1000215626
Length 375
Sequence MTATHSAARSPSQAFWRDVVEPYAHAERRRSWWFLLTSLPPYLMLFALMDLSLRISYLLTLALAFPAAGFLVRVYIIFHDCTHGSFLASKRGNRWLGTSLGLFTFSAFDCWQHNHAIHHATAGDLDRRGVGDVQTLTVAEYNARPWRGRMAYRLFRNPLIMFGVGPFVALVVQPRIVPHSARPRIKRSVVATNIALVVLVGGICLLMGWRSYALVQAPIIMLGGAAGIWLFYVQHQFEDVYWEGSAAWSYPDAALHGSSYLKLPKVLQFFSGNIGFHHVHHLSARIPSYNLPRAHLENAIFHDVPTLSLTDGLRAVKLKLYDEDRRRMVSFSQARANSRRKHEQSARRLVPEVSRSRRTNRTGATASGQNPGTGA

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
114 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
115 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.19
Rhizosphere 83.57
Stem 0
Stem Tuber 0
Unclassified 5.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1005610 3300001977 Bacteria 1957
2 Ga0065712_10088918 3300005290 Unclassified 2496
3 Ga0070683_100001023 3300005329 Bacteria 20987
4 Ga0068869_100066384 3300005334 Bacteria 2658
5 Ga0070682_100011375 3300005337 Bacteria 5084
6 Ga0068868_100029363 3300005338 Bacteria 4210
7 Ga0068868_100058817 3300005338 Bacteria 3039
8 Ga0070660_100040629 3300005339 Bacteria 3541
9 Ga0070691_10031598 3300005341 Bacteria 2484
10 Ga0070661_100069097 3300005344 Bacteria 2597
11 Ga0070668_100005079 3300005347 Bacteria 9746
12 Ga0070669_100006300 3300005353 Bacteria 8553
13 Ga0070675_100065173 3300005354 Bacteria 3012
14 Ga0070674_100141602 3300005356 Unclassified 1805
15 Ga0070659_100004504 3300005366 Bacteria 9952
16 Ga0070659_100062989 3300005366 Bacteria 2933
17 Ga0070667_100003166 3300005367 Bacteria 14103
18 Ga0070714_100170460 3300005435 Bacteria 1975
19 Ga0070713_100171659 3300005436 Bacteria 1943
20 Ga0070710_10019857 3300005437 Bacteria 3479
21 Ga0070705_100226814 3300005440 Bacteria 1297
22 Ga0070700_100007856 3300005441 Bacteria 5786
23 Ga0070663_100010708 3300005455 Bacteria 5725
24 Ga0070678_100014181 3300005456 Bacteria 5020
25 Ga0070678_100042998 3300005456 Bacteria 3216
26 Ga0070662_100006874 3300005457 Bacteria 7361
27 Ga0070662_100137236 3300005457 Bacteria 1892
28 Ga0070662_100303454 3300005457 Bacteria 1298
29 Ga0070681_10213251 3300005458 Bacteria 1847
30 Ga0070685_10015550 3300005466 Bacteria 4042
31 Ga0070679_100215502 3300005530 Bacteria 1882
32 Ga0070684_100063319 3300005535 Bacteria 3242
33 Ga0070684_100121329 3300005535 Bacteria 2351
34 Ga0070684_100421576 3300005535 Bacteria 1232
35 Ga0068853_100055163 3300005539 Bacteria 3425
36 Ga0070672_100305664 3300005543 Unclassified 1349
37 Ga0070672_100317291 3300005543 Bacteria 1324
38 Ga0070695_100144764 3300005545 Bacteria 1652
39 Ga0070696_100231893 3300005546 Bacteria 1389
40 Ga0070665_100009250 3300005548 Bacteria 9981
41 Ga0070665_100015102 3300005548 Bacteria 7753
42 Ga0070665_100203045 3300005548 Bacteria 1982
43 Ga0070704_100158833 3300005549 Bacteria 1786
44 Ga0068855_100045319 3300005563 Bacteria 5201
45 Ga0068857_100039070 3300005577 Bacteria 4203
46 Ga0068857_100143505 3300005577 Bacteria 2159
47 Ga0068854_100024422 3300005578 Bacteria 4139
48 Ga0068856_100021562 3300005614 Bacteria 6261
49 Ga0068856_100028790 3300005614 Bacteria 5427
50 Ga0068856_100043545 3300005614 Bacteria 4417
51 Ga0070702_100053147 3300005615 Bacteria 2326
52 Ga0068859_100288085 3300005617 Bacteria 1735
53 Ga0068864_100129355 3300005618 Bacteria 2266
54 Ga0068866_10072461 3300005718 Bacteria 1825
55 Ga0068861_100017481 3300005719 Bacteria 5094
56 Ga0068861_100060152 3300005719 Bacteria 2911
57 Ga0068851_10062972 3300005834 Bacteria 1904
58 Ga0068870_10134510 3300005840 Bacteria 1440
59 Ga0068863_100094845 3300005841 Bacteria 2832
60 Ga0068860_100085239 3300005843 Bacteria 3006
61 Ga0068862_100004434 3300005844 Bacteria 11844
62 Ga0068862_100324011 3300005844 Bacteria 1423
63 Ga0070717_10021315 3300006028 Bacteria 5104
64 Ga0070717_10103305 3300006028 Bacteria 2423
65 Ga0070712_100034486 3300006175 Bacteria 3430
66 Ga0075428_100036543 3300006844 Bacteria 5410
67 Ga0075431_100001823 3300006847 Bacteria 20126
68 Ga0075431_100024823 3300006847 Bacteria 6146
69 Ga0075429_100000334 3300006880 Bacteria 34171
70 Ga0068865_100033591 3300006881 Bacteria 3436
71 Ga0068865_100061554 3300006881 Bacteria 2632
72 Ga0068865_100084024 3300006881 Bacteria 2293
73 Ga0097620_100288094 3300006931 Bacteria 1735
74 Ga0111539_10006054 3300009094 Bacteria 15614
75 Ga0111539_10010035 3300009094 Bacteria 11936
76 Ga0111539_10590566 3300009094 Bacteria 1293
77 Ga0105245_10004523 3300009098 Bacteria 12285
78 Ga0105245_10028828 3300009098 Bacteria 4899
79 Ga0114129_10015100 3300009147 Bacteria 10990
80 Ga0114129_10272318 3300009147 Bacteria 2265
81 Ga0105243_10014897 3300009148 Bacteria 5885
82 Ga0105243_10123592 3300009148 Bacteria 2186
83 Ga0105242_10012663 3300009176 Bacteria 6496
84 Ga0105242_10042597 3300009176 Bacteria 3667
85 Ga0105242_10072398 3300009176 Bacteria 2862
86 Ga0105242_10374762 3300009176 Bacteria 1321
87 Ga0105248_10297472 3300009177 Bacteria 1817
88 Ga0105249_10056677 3300009553 Bacteria 3587
89 Ga0105239_10085981 3300010375 Bacteria 3466
90 Ga0105239_10142051 3300010375 Bacteria 2676
91 Ga0105239_10332975 3300010375 Bacteria 1713
92 Ga0105246_10014325 3300011119 Bacteria 4986
93 Ga0157374_10012907 3300013296 Bacteria 7278
94 Ga0157374_10162385 3300013296 Bacteria 2176
95 Ga0157372_10058782 3300013307 Bacteria 4299
96 Ga0157372_10228238 3300013307 Bacteria 2158
97 Ga0157375_10069083 3300013308 Bacteria 3538
98 Ga0163163_10050289 3300014325 Bacteria 4104
99 Ga0163163_10138908 3300014325 Bacteria 2472
100 Ga0157377_10017680 3300014745 Bacteria 3692
101 Ga0213876_10003535 3300021384 Bacteria 8911
102 Ga0213876_10007437 3300021384 Bacteria 5956
103 Ga0213876_10034351 3300021384 Bacteria 2674
104 Ga0213876_10060963 3300021384 Bacteria 1990
105 Ga0213875_10035058 3300021388 Bacteria 2368
106 Ga0207688_10000219 3300025901 Bacteria 25690
107 Ga0207688_10008352 3300025901 Bacteria 5631
108 Ga0207680_10002186 3300025903 Bacteria 9165
109 Ga0207680_10046129 3300025903 Bacteria 2575
110 Ga0207647_10076080 3300025904 Bacteria 2020
111 Ga0207699_10041618 3300025906 Bacteria 2655
112 Ga0207705_10088808 3300025909 Bacteria 2261
113 Ga0207695_10100922 3300025913 Bacteria 2881
114 Ga0207671_10008150 3300025914 Bacteria 8939
115 Ga0207693_10009249 3300025915 Bacteria 8045
116 Ga0207663_10299635 3300025916 Bacteria 1201
117 Ga0207657_10011012 3300025919 Bacteria 8990
118 Ga0207681_10024568 3300025923 Bacteria 3869
119 Ga0207694_10052954 3300025924 Bacteria 3146
120 Ga0207659_10048280 3300025926 Bacteria 3015
121 Ga0207687_10023293 3300025927 Bacteria 4126
122 Ga0207687_10053403 3300025927 Bacteria 2823
123 Ga0207700_10123398 3300025928 Bacteria 2103
124 Ga0207664_10062355 3300025929 Bacteria 2977
125 Ga0207706_10006277 3300025933 Bacteria 11044
126 Ga0207706_10028071 3300025933 Bacteria 5028
127 Ga0207706_10111637 3300025933 Bacteria 2405
128 Ga0207686_10011648 3300025934 Bacteria 4823
129 Ga0207686_10049998 3300025934 Bacteria 2598
130 Ga0207709_10034054 3300025935 Bacteria 2998
131 Ga0207704_10011822 3300025938 Bacteria 4313
132 Ga0207691_10138871 3300025940 Unclassified 2142
133 Ga0207691_10195074 3300025940 Bacteria 1765
134 Ga0207689_10081292 3300025942 Bacteria 2663
135 Ga0207661_10000165 3300025944 Bacteria 43066
136 Ga0207661_10002470 3300025944 Bacteria 12702
137 Ga0207679_10090120 3300025945 Bacteria 2369
138 Ga0207667_10116059 3300025949 Bacteria 2759
139 Ga0207712_10038380 3300025961 Bacteria 3275
140 Ga0207668_10067640 3300025972 Bacteria 2537
141 Ga0207640_10017262 3300025981 Bacteria 4220
142 Ga0207658_10125347 3300025986 Bacteria 2054
143 Ga0207703_10000042 3300026035 Bacteria 161459
144 Ga0207639_10052791 3300026041 Bacteria 3099
145 Ga0207678_10014260 3300026067 Bacteria 6987
146 Ga0207708_10023745 3300026075 Bacteria 4635
147 Ga0207702_10044687 3300026078 Bacteria 3724
148 Ga0207702_10045443 3300026078 Bacteria 3694
149 Ga0207676_10061238 3300026095 Bacteria 2979
150 Ga0207674_10043612 3300026116 Bacteria 4624
151 Ga0207674_10046749 3300026116 Bacteria 4442
152 Ga0207675_100007560 3300026118 Bacteria 10268
153 Ga0207675_100086348 3300026118 Bacteria 2946
154 Ga0207683_10041578 3300026121 Bacteria 4014
155 Ga0207428_10003328 3300027907 Bacteria 15627
156 Ga0207428_10301257 3300027907 Bacteria 1186
157 Ga0268266_10003936 3300028379 Bacteria 14439
158 Ga0268266_10017614 3300028379 Bacteria 6091
159 Ga0268265_10003391 3300028380 Bacteria 11467
160 Ga0268264_10139993 3300028381 Bacteria 2157
161 Ga0265337_1000069 3300028556 Bacteria 47825
162 Ga0265326_10000012 3300028558 Bacteria 175352
163 Ga0265326_10011011 3300028558 Bacteria 2675
164 Ga0265319_1000627 3300028563 Bacteria 23305
165 Ga0265318_10020101 3300028577 Bacteria 2699
166 Ga0265322_10000003 3300028654 Bacteria 468671
167 Ga0265322_10011917 3300028654 Bacteria 2515
168 Ga0265336_10000001 3300028666 Bacteria 916179
169 Ga0265338_10000004 3300028800 Bacteria 644793
170 Ga0265324_10000732 3300029957 Bacteria 21883
171 Ga0265760_10006492 3300031090 Bacteria 3342
172 Ga0265328_10014309 3300031239 Bacteria 3125
173 Ga0265320_10000001 3300031240 Bacteria 847191
174 Ga0265340_10000002 3300031247 Bacteria 711693
175 Ga0265339_10012630 3300031249 Bacteria 5145
176 Ga0265327_10000003 3300031251 Bacteria 852750
177 Ga0265316_10018663 3300031344 Bacteria 5957
178 Ga0265316_10177544 3300031344 Bacteria 1586
179 Ga0265314_10000044 3300031711 Bacteria 207337
180 Ga0265314_10119331 3300031711 Bacteria 1663
181 Ga0373936_0086542 3300035113 Bacteria 1309
182 Ga0373946_0018966 3300035171 Bacteria 2645
183 Ga0316574_0205250 3300035398 Bacteria 1265
184 Ga0373927_0103609 3300035695 Bacteria 1852
185 Ga0373947_0002801 3300035725 Bacteria 10422
186 Ga0373947_0080173 3300035725 Bacteria 2019
187 Ga0316582_0063353 3300036647 Bacteria 2376
188 Ga0395899_0154052 3300037312 Bacteria 1627
189 Ga0395900_0070111 3300037418 Bacteria 3603
190 Ga0395900_0381258 3300037418 Bacteria 1378
191 Ga0395898_0004936 3300037466 Bacteria 14476
192 Ga0395898_0218574 3300037466 Bacteria 1818
193 Ga0436364_0636613 3300037853 Bacteria 40639
194 Ga0436364_1407505 3300037853 Bacteria 1899
195 Ga0395901_0000308 3300038443 Bacteria 59999
196 Ga0395901_0087425 3300038443 Bacteria 3259
197 Ga0395901_0638683 3300038443 Bacteria 1069
198 Ga0436365_0277770 3300039437 Bacteria 5595
199 Ga0436365_0663277 3300039437 Bacteria 7386
200 Ga0436365_0787002 3300039437 Bacteria 2726
201 Ga0436365_1017497 3300039437 Bacteria 7240
202 Ga0436363_0645205 3300039450 Bacteria 7081
203 Ga0451853_0183869 3300041512 Bacteria 6916
204 Ga0466966_0032984 3300044684 Bacteria 3352
205 Ga0466966_0049948 3300044684 Bacteria 2662
206 Ga0466961_0265573 3300044693 Bacteria 1052
207 Ga0466971_0039634 3300044719 Bacteria 2114
208 Ga0466971_0068133 3300044719 Bacteria 1613
209 Ga0466970_0047026 3300044765 Bacteria 2299
210 Ga0466957_0055210 3300044842 Bacteria 2427
211 Ga0466960_0023052 3300044901 Bacteria 2791
212 Ga0466960_0118859 3300044901 Bacteria 1382
213 Ga0466959_0013535 3300045049 Bacteria 5913
214 Ga0466959_0022051 3300045049 Bacteria 4704
215 Ga0466959_0112002 3300045049 Bacteria 1947
216 Ga0466958_0005333 3300045836 Bacteria 6905
217 Ga0466958_0008582 3300045836 Bacteria 5672
218 Ga0466958_0110311 3300045836 Bacteria 1717
219 Ga0466958_0247773 3300045836 Bacteria 1139
220 Ga0466967_0064025 3300045976 Bacteria 3269
221 Ga0495592_0047745 3300046454 Bacteria 3188
222 Ga0495641_0031778 3300046461 Bacteria 2519
223 Ga0495653_0064901 3300046463 Bacteria 2750
224 Ga0495653_0156432 3300046463 Bacteria 1587
225 Ga0495628_0062434 3300046516 Bacteria 2920
226 Ga0495630_0072059 3300046517 Bacteria 2601
227 Ga0495632_0064871 3300046519 Bacteria 1765
228 Ga0495652_0120874 3300046529 Bacteria 2089
229 Ga0495640_0079047 3300046533 Bacteria 2190
230 Ga0495634_0000018 3300046642 Bacteria 121323
231 Ga0495647_0100584 3300046681 Bacteria 1197
232 Ga0495658_0060119 3300046683 Bacteria 2178
233 Ga0495604_0023751 3300047317 Bacteria 4892
234 Ga0495674_0118666 3300047319 Bacteria 2236
235 Ga0495672_0003313 3300047320 Bacteria 13918
236 Ga0495672_0020852 3300047320 Bacteria 4286
237 Ga0495676_0000974 3300047321 Bacteria 23999
238 Ga0495676_0040954 3300047321 Bacteria 3819
239 Ga0495676_0093384 3300047321 Bacteria 2244
240 Ga0495680_0022643 3300047322 Bacteria 5234
241 Ga0495602_0000032 3300048088 Bacteria 141185
242 Ga0496100_0021998 3300048903 Bacteria 3851
243 Ga0496101_0026075 3300048904 Bacteria 4061
244 Ga0496101_0053015 3300048904 Bacteria 2925
245 Ga0496102_0013713 3300048905 Bacteria 7028
246 Ga0496102_0026306 3300048905 Bacteria 5188
247 Ga0496103_0028317 3300048906 Bacteria 3399
248 Ga0496103_0075529 3300048906 Bacteria 2113
249 Ga0496104_0044103 3300048907 Bacteria 4190
250 Ga0496104_0080515 3300048907 Bacteria 3105
251 Ga0496105_0014811 3300048908 Bacteria 6208
252 Ga0496105_0099173 3300048908 Bacteria 2405
253 Ga0496106_0003206 3300048909 Bacteria 12247
254 Ga0496106_0088604 3300048909 Bacteria 2386
255 Ga0496107_0033301 3300048910 Bacteria 3686
256 Ga0496107_0073608 3300048910 Bacteria 2485
257 Ga0496108_0023045 3300048911 Bacteria 5122
258 Ga0496108_0179213 3300048911 Bacteria 1834
259 Ga0496109_0028102 3300048912 Bacteria 5028
260 Ga0496109_0101860 3300048912 Bacteria 2665
261 Ga0496109_0179697 3300048912 Bacteria 1987
262 Ga0496110_0076673 3300048913 Bacteria 2972
263 Ga0496111_0004356 3300048914 Bacteria 8935
264 Ga0496111_0037136 3300048914 Bacteria 3486
265 Ga0496112_0016643 3300048915 Bacteria 6894
266 Ga0496112_0089557 3300048915 Bacteria 3045
267 Ga0496112_0122705 3300048915 Bacteria 2568
268 Ga0496112_0300669 3300048915 Archaea 1550
269 Ga0496113_0015292 3300048916 Bacteria 5270
270 Ga0496113_0028473 3300048916 Bacteria 4019
271 Ga0496114_0019272 3300048917 Bacteria 5527
272 Ga0496114_0034244 3300048917 Bacteria 4189
273 Ga0496115_0000815 3300048918 Bacteria 22850
274 Ga0496119_0000623 3300048922 Bacteria 47810
275 Ga0496119_0004977 3300048922 Bacteria 12968
276 Ga0501080_0268239 3300049742 Bacteria 1554
277 nmdc:mga05p37_23403_c1 3300050507 Bacteria 7495
278 nmdc:mga09592_17268_c1 3300050508 Bacteria 5910
279 nmdc:mga0qj67_72669_c1 3300050509 Bacteria 2747
280 nmdc:mga06r32_3731_c1 3300050510 Bacteria 13635
281 nmdc:mga06r32_62_c1 3300050510 Bacteria 68174
282 nmdc:mga08y16_18060_c1 3300050511 Bacteria 7429
283 nmdc:mga08y16_4022_c1 3300050511 Bacteria 15340
284 nmdc:mga08y16_51625_c1 3300050511 Bacteria 4303
285 Ga0495595_0023345 3300053084 Bacteria 2722
286 Ga0466962_0014831 3300061719 Bacteria 3754

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035695 Ga0373927_0103609 Ga0373927_0103609_960_1814 270
2 3300045836 Ga0466958_0247773 Ga0466958_0247773_87_959 270
3 3300048912 Ga0496109_0179697 Ga0496109_0179697_241_1158 279
4 3300046454 Ga0495592_0047745 Ga0495592_0047745_1669_2721 281
5 3300046516 Ga0495628_0062434 Ga0495628_0062434_132_1184 281
6 3300046529 Ga0495652_0120874 Ga0495652_0120874_518_1570 281
7 3300046533 Ga0495640_0079047 Ga0495640_0079047_341_1393 281
8 3300047319 Ga0495674_0118666 Ga0495674_0118666_103_1155 281
9 3300010375 Ga0105239_10142051 Ga0105239_101420512 282
10 3300038443 Ga0395901_0638683 Ga0395901_0638683_13_930 282
11 3300045049 Ga0466959_0112002 Ga0466959_0112002_554_1477 282
12 3300021384 Ga0213876_10034351 Ga0213876_100343513 286
13 3300039437 Ga0436365_0787002 Ga0436365_0787002_388_1374 286
14 3300044765 Ga0466970_0047026 Ga0466970_0047026_691_1653 287
15 3300045049 Ga0466959_0022051 Ga0466959_0022051_1718_2680 287
16 3300031090 Ga0265760_10006492 Ga0265760_100064922 290
17 3300046642 Ga0495634_0000018 Ga0495634_0000018_57633_58613 290
18 3300048915 Ga0496112_0300669 Ga0496112_0300669_67_1047 291
19 3300044684 Ga0466966_0049948 Ga0466966_0049948_1591_2604 292
20 3300045049 Ga0466959_0013535 Ga0466959_0013535_1257_2270 292
21 3300045836 Ga0466958_0110311 Ga0466958_0110311_630_1643 292
22 3300005329 Ga0070683_100001023 Ga0070683_10000102316 293
23 3300044684 Ga0466966_0032984 Ga0466966_0032984_988_1962 293
24 3300044693 Ga0466961_0265573 Ga0466961_0265573_70_1035 293
25 3300025929 Ga0207664_10062355 Ga0207664_100623552 294
26 3300046463 Ga0495653_0156432 Ga0495653_0156432_539_1519 295
27 3300047317 Ga0495604_0023751 Ga0495604_0023751_412_1434 296
28 3300048088 Ga0495602_0000032 Ga0495602_0000032_104034_105056 296
29 3300037418 Ga0395900_0381258 Ga0395900_0381258_123_1154 297
30 3300048911 Ga0496108_0023045 Ga0496108_0023045_175_1158 297
31 3300048915 Ga0496112_0016643 Ga0496112_0016643_4939_5922 297
32 3300053084 Ga0495595_0023345 Ga0495595_0023345_232_1218 297
33 3300010375 Ga0105239_10332975 Ga0105239_103329752 299
34 3300041512 Ga0451853_0183869 Ga0451853_0183869_1152_2135 299
35 3300044719 Ga0466971_0039634 Ga0466971_0039634_465_1451 299
36 3300061719 Ga0466962_0014831 Ga0466962_0014831_1228_2214 299
37 3300009098 Ga0105245_10004523 Ga0105245_100045233 300
38 3300046681 Ga0495647_0100584 Ga0495647_0100584_150_1142 300
39 3300047321 Ga0495676_0040954 Ga0495676_0040954_2279_3271 300
40 3300005339 Ga0070660_100040629 Ga0070660_1000406295 301
41 3300005347 Ga0070668_100005079 Ga0070668_1000050799 301
42 3300005353 Ga0070669_100006300 Ga0070669_10000630010 301
43 3300005366 Ga0070659_100004504 Ga0070659_10000450410 301
44 3300005366 Ga0070659_100062989 Ga0070659_1000629892 301
45 3300005457 Ga0070662_100006874 Ga0070662_1000068744 301
46 3300005458 Ga0070681_10213251 Ga0070681_102132512 301
47 3300005530 Ga0070679_100215502 Ga0070679_1002155022 301
48 3300005535 Ga0070684_100121329 Ga0070684_1001213292 301
49 3300005539 Ga0068853_100055163 Ga0068853_1000551632 301
50 3300005548 Ga0070665_100009250 Ga0070665_1000092503 301
51 3300005563 Ga0068855_100045319 Ga0068855_1000453192 301
52 3300005719 Ga0068861_100017481 Ga0068861_1000174815 301
53 3300005844 Ga0068862_100004434 Ga0068862_1000044346 301
54 3300006881 Ga0068865_100084024 Ga0068865_1000840242 301
55 3300009094 Ga0111539_10590566 Ga0111539_105905662 301
56 3300009553 Ga0105249_10056677 Ga0105249_100566773 301
57 3300013307 Ga0157372_10228238 Ga0157372_102282382 301
58 3300025909 Ga0207705_10088808 Ga0207705_100888082 301
59 3300025913 Ga0207695_10100922 Ga0207695_101009222 301
60 3300025919 Ga0207657_10011012 Ga0207657_100110123 301
61 3300025923 Ga0207681_10024568 Ga0207681_100245684 301
62 3300025924 Ga0207694_10052954 Ga0207694_100529542 301
63 3300025933 Ga0207706_10006277 Ga0207706_1000627713 301
64 3300025949 Ga0207667_10116059 Ga0207667_101160594 301
65 3300025961 Ga0207712_10038380 Ga0207712_100383803 301
66 3300026041 Ga0207639_10052791 Ga0207639_100527912 301
67 3300026116 Ga0207674_10043612 Ga0207674_100436122 301
68 3300026118 Ga0207675_100007560 Ga0207675_1000075605 301
69 3300028380 Ga0268265_10003391 Ga0268265_1000339112 301
70 3300050511 nmdc:mga08y16_51625_c1 nmdc:mga08y16_51625_c1_1226_2215 301
71 3300005436 Ga0070713_100171659 Ga0070713_1001716591 302
72 3300006028 Ga0070717_10021315 Ga0070717_100213155 302
73 3300021384 Ga0213876_10060963 Ga0213876_100609633 302
74 3300021388 Ga0213875_10035058 Ga0213875_100350582 302
75 3300025928 Ga0207700_10123398 Ga0207700_101233981 302
76 3300039437 Ga0436365_1017497 Ga0436365_1017497_743_1768 302
77 3300039450 Ga0436363_0645205 Ga0436363_0645205_4998_6023 302
78 3300047322 Ga0495680_0022643 Ga0495680_0022643_2647_3696 302
79 3300037853 Ga0436364_1407505 Ga0436364_1407505_804_1829 303
80 3300049742 Ga0501080_0268239 Ga0501080_0268239_38_1027 303
81 3300005435 Ga0070714_100170460 Ga0070714_1001704602 304
82 3300006028 Ga0070717_10103305 Ga0070717_101033051 304
83 3300035398 Ga0316574_0205250 Ga0316574_0205250_35_1042 304
84 3300009176 Ga0105242_10374762 Ga0105242_103747621 305
85 3300009176 Ga0105242_10012663 Ga0105242_100126632 306
86 3300021384 Ga0213876_10007437 Ga0213876_100074372 306
87 3300025934 Ga0207686_10011648 Ga0207686_100116485 306
88 3300028379 Ga0268266_10017614 Ga0268266_100176147 306
89 3300036647 Ga0316582_0063353 Ga0316582_0063353_490_1533 306
90 3300005367 Ga0070667_100003166 Ga0070667_10000316613 307
91 3300005548 Ga0070665_100015102 Ga0070665_1000151025 307
92 3300005577 Ga0068857_100143505 Ga0068857_1001435052 307
93 3300005840 Ga0068870_10134510 Ga0068870_101345101 307
94 3300014325 Ga0163163_10138908 Ga0163163_101389083 307
95 3300021384 Ga0213876_10003535 Ga0213876_100035353 307
96 3300025903 Ga0207680_10002186 Ga0207680_100021867 307
97 3300025986 Ga0207658_10125347 Ga0207658_101253473 307
98 3300026035 Ga0207703_10000042 Ga0207703_10000042171 307
99 3300028379 Ga0268266_10003936 Ga0268266_100039368 307
100 3300028558 Ga0265326_10011011 Ga0265326_100110112 307
101 3300028563 Ga0265319_1000627 Ga0265319_10006276 307
102 3300028577 Ga0265318_10020101 Ga0265318_100201012 307
103 3300028654 Ga0265322_10011917 Ga0265322_100119171 307
104 3300028666 Ga0265336_10000001 Ga0265336_10000001762 307
105 3300028800 Ga0265338_10000004 Ga0265338_10000004121 307
106 3300031247 Ga0265340_10000002 Ga0265340_10000002121 307
107 3300031249 Ga0265339_10012630 Ga0265339_100126305 307
108 3300031344 Ga0265316_10018663 Ga0265316_100186636 307
109 3300035725 Ga0373947_0080173 Ga0373947_0080173_327_1379 307
110 3300037312 Ga0395899_0154052 Ga0395899_0154052_363_1376 307
111 3300037418 Ga0395900_0070111 Ga0395900_0070111_902_1915 307
112 3300037466 Ga0395898_0004936 Ga0395898_0004936_11971_12984 307
113 3300037466 Ga0395898_0218574 Ga0395898_0218574_395_1417 307
114 3300038443 Ga0395901_0000308 Ga0395901_0000308_11971_12984 307
115 3300038443 Ga0395901_0087425 Ga0395901_0087425_57_1058 307
116 3300039437 Ga0436365_0663277 Ga0436365_0663277_594_1604 307
117 3300046463 Ga0495653_0064901 Ga0495653_0064901_1162_2214 307
118 3300048922 Ga0496119_0000623 Ga0496119_0000623_20330_21334 307
119 3300006847 Ga0075431_100024823 Ga0075431_1000248236 308
120 3300050509 nmdc:mga0qj67_72669_c1 nmdc:mga0qj67_72669_c1_1153_2166 308
121 3300050510 nmdc:mga06r32_3731_c1 nmdc:mga06r32_3731_c1_12126_13139 308
122 3300025933 Ga0207706_10028071 Ga0207706_100280715 309
123 3300037853 Ga0436364_0636613 Ga0436364_0636613_17427_18473 309
124 3300044901 Ga0466960_0023052 Ga0466960_0023052_738_1778 309
125 3300045836 Ga0466958_0008582 Ga0466958_0008582_4490_5503 309
126 3300005535 Ga0070684_100421576 Ga0070684_1004215761 310
127 3300035113 Ga0373936_0086542 Ga0373936_0086542_116_1138 310
128 3300035171 Ga0373946_0018966 Ga0373946_0018966_791_1813 310
129 3300035725 Ga0373947_0002801 Ga0373947_0002801_8467_9489 310
130 3300046517 Ga0495630_0072059 Ga0495630_0072059_631_1653 310
131 3300046683 Ga0495658_0060119 Ga0495658_0060119_1029_2051 310
132 3300047321 Ga0495676_0093384 Ga0495676_0093384_457_1479 310
133 3300006844 Ga0075428_100036543 Ga0075428_1000365433 311
134 3300006847 Ga0075431_100001823 Ga0075431_10000182311 311
135 3300006880 Ga0075429_100000334 Ga0075429_10000033431 311
136 3300027907 Ga0207428_10003328 Ga0207428_100033287 311
137 3300027907 Ga0207428_10301257 Ga0207428_103012571 311
138 3300044719 Ga0466971_0068133 Ga0466971_0068133_379_1419 311
139 3300044842 Ga0466957_0055210 Ga0466957_0055210_1282_2322 311
140 3300045976 Ga0466967_0064025 Ga0466967_0064025_1152_2168 311
141 3300047320 Ga0495672_0020852 Ga0495672_0020852_568_1644 311
142 3300025944 Ga0207661_10000165 Ga0207661_1000016525 312
143 3300028556 Ga0265337_1000069 Ga0265337_100006947 312
144 3300028558 Ga0265326_10000012 Ga0265326_1000001235 312
145 3300028654 Ga0265322_10000003 Ga0265322_10000003322 312
146 3300029957 Ga0265324_10000732 Ga0265324_1000073213 312
147 3300031239 Ga0265328_10014309 Ga0265328_100143095 312
148 3300031240 Ga0265320_10000001 Ga0265320_10000001322 312
149 3300031251 Ga0265327_10000003 Ga0265327_10000003322 312
150 3300031711 Ga0265314_10000044 Ga0265314_10000044145 312
151 3300047321 Ga0495676_0000974 Ga0495676_0000974_18445_19485 312
152 3300009094 Ga0111539_10006054 Ga0111539_1000605410 313
153 3300009094 Ga0111539_10010035 Ga0111539_100100357 313
154 3300009147 Ga0114129_10015100 Ga0114129_100151007 313
155 3300025944 Ga0207661_10002470 Ga0207661_100024709 313
156 3300047320 Ga0495672_0003313 Ga0495672_0003313_1885_2919 313
157 3300048922 Ga0496119_0004977 Ga0496119_0004977_4641_5699 313
158 3300050507 nmdc:mga05p37_23403_c1 nmdc:mga05p37_23403_c1_5056_6084 313
159 3300050508 nmdc:mga09592_17268_c1 nmdc:mga09592_17268_c1_3722_4750 313
160 3300050510 nmdc:mga06r32_62_c1 nmdc:mga06r32_62_c1_11265_12293 313
161 3300050511 nmdc:mga08y16_18060_c1 nmdc:mga08y16_18060_c1_2267_3295 313
162 3300050511 nmdc:mga08y16_4022_c1 nmdc:mga08y16_4022_c1_9143_10171 313
163 3300046519 Ga0495632_0064871 Ga0495632_0064871_255_1316 316
164 3300005614 Ga0068856_100021562 Ga0068856_1000215626 317
165 3300009147 Ga0114129_10272318 Ga0114129_102723184 317
166 3300044901 Ga0466960_0118859 Ga0466960_0118859_211_1275 317
167 3300005457 Ga0070662_100137236 Ga0070662_1001372361 318
168 3300005548 Ga0070665_100203045 Ga0070665_1002030452 318
169 3300025903 Ga0207680_10046129 Ga0207680_100461291 318
170 3300025933 Ga0207706_10111637 Ga0207706_101116371 318
171 3300031344 Ga0265316_10177544 Ga0265316_101775443 318
172 3300031711 Ga0265314_10119331 Ga0265314_101193311 318
173 3300025914 Ga0207671_10008150 Ga0207671_100081502 319
174 3300005614 Ga0068856_100028790 Ga0068856_1000287903 320
175 3300026078 Ga0207702_10044687 Ga0207702_100446873 320
176 3300045836 Ga0466958_0005333 Ga0466958_0005333_5058_6128 320
177 3300005356 Ga0070674_100141602 Ga0070674_1001416022 322
178 3300005543 Ga0070672_100305664 Ga0070672_1003056642 322
179 3300025940 Ga0207691_10138871 Ga0207691_101388712 322
180 3300005338 Ga0068868_100058817 Ga0068868_1000588172 323
181 3300005456 Ga0070678_100014181 Ga0070678_1000141814 323
182 3300005545 Ga0070695_100144764 Ga0070695_1001447642 323
183 3300005549 Ga0070704_100158833 Ga0070704_1001588332 323
184 3300006175 Ga0070712_100034486 Ga0070712_1000344862 323
185 3300006881 Ga0068865_100061554 Ga0068865_1000615542 323
186 3300009148 Ga0105243_10123592 Ga0105243_101235922 323
187 3300009176 Ga0105242_10072398 Ga0105242_100723982 323
188 3300013296 Ga0157374_10162385 Ga0157374_101623852 323
189 3300013308 Ga0157375_10069083 Ga0157375_100690833 323
190 3300025901 Ga0207688_10008352 Ga0207688_100083522 323
191 3300025915 Ga0207693_10009249 Ga0207693_100092499 323
192 3300025927 Ga0207687_10023293 Ga0207687_100232932 323
193 3300025934 Ga0207686_10049998 Ga0207686_100499982 323
194 3300039437 Ga0436365_0277770 Ga0436365_0277770_1748_2830 323
195 3300046461 Ga0495641_0031778 Ga0495641_0031778_616_1686 323
196 3300048903 Ga0496100_0021998 Ga0496100_0021998_1039_2109 323
197 3300048904 Ga0496101_0026075 Ga0496101_0026075_81_1151 323
198 3300048905 Ga0496102_0013713 Ga0496102_0013713_5041_6111 323
199 3300048906 Ga0496103_0075529 Ga0496103_0075529_963_2033 323
200 3300048907 Ga0496104_0044103 Ga0496104_0044103_1384_2454 323
201 3300048908 Ga0496105_0099173 Ga0496105_0099173_71_1141 323
202 3300048909 Ga0496106_0003206 Ga0496106_0003206_3884_4954 323
203 3300048910 Ga0496107_0033301 Ga0496107_0033301_1089_2159 323
204 3300048912 Ga0496109_0028102 Ga0496109_0028102_1540_2610 323
205 3300048914 Ga0496111_0004356 Ga0496111_0004356_6868_7938 323
206 3300048915 Ga0496112_0089557 Ga0496112_0089557_1907_2977 323
207 3300048916 Ga0496113_0028473 Ga0496113_0028473_813_1883 323
208 3300048917 Ga0496114_0019272 Ga0496114_0019272_1047_2117 323
209 3300048918 Ga0496115_0000815 Ga0496115_0000815_2332_3402 323
210 3300005290 Ga0065712_10088918 Ga0065712_100889183 325
211 3300025904 Ga0207647_10076080 Ga0207647_100760802 325
212 3300001977 JGI24746J21847_1005610 JGI24746J21847_10056101 326
213 3300005334 Ga0068869_100066384 Ga0068869_1000663843 326
214 3300005337 Ga0070682_100011375 Ga0070682_1000113755 326
215 3300005338 Ga0068868_100029363 Ga0068868_1000293634 326
216 3300005341 Ga0070691_10031598 Ga0070691_100315983 326
217 3300005344 Ga0070661_100069097 Ga0070661_1000690972 326
218 3300005354 Ga0070675_100065173 Ga0070675_1000651733 326
219 3300005437 Ga0070710_10019857 Ga0070710_100198573 326
220 3300005440 Ga0070705_100226814 Ga0070705_1002268141 326
221 3300005441 Ga0070700_100007856 Ga0070700_1000078562 326
222 3300005455 Ga0070663_100010708 Ga0070663_1000107086 326
223 3300005456 Ga0070678_100042998 Ga0070678_1000429984 326
224 3300005457 Ga0070662_100303454 Ga0070662_1003034541 326
225 3300005466 Ga0070685_10015550 Ga0070685_100155503 326
226 3300005535 Ga0070684_100063319 Ga0070684_1000633192 326
227 3300005543 Ga0070672_100317291 Ga0070672_1003172912 326
228 3300005546 Ga0070696_100231893 Ga0070696_1002318932 326
229 3300005577 Ga0068857_100039070 Ga0068857_1000390704 326
230 3300005578 Ga0068854_100024422 Ga0068854_1000244223 326
231 3300005614 Ga0068856_100043545 Ga0068856_1000435456 326
232 3300005615 Ga0070702_100053147 Ga0070702_1000531474 326
233 3300005617 Ga0068859_100288085 Ga0068859_1002880852 326
234 3300005618 Ga0068864_100129355 Ga0068864_1001293553 326
235 3300005718 Ga0068866_10072461 Ga0068866_100724612 326
236 3300005719 Ga0068861_100060152 Ga0068861_1000601524 326
237 3300005834 Ga0068851_10062972 Ga0068851_100629722 326
238 3300005841 Ga0068863_100094845 Ga0068863_1000948454 326
239 3300005843 Ga0068860_100085239 Ga0068860_1000852393 326
240 3300005844 Ga0068862_100324011 Ga0068862_1003240111 326
241 3300006881 Ga0068865_100033591 Ga0068865_1000335913 326
242 3300006931 Ga0097620_100288094 Ga0097620_1002880942 326
243 3300009098 Ga0105245_10028828 Ga0105245_100288285 326
244 3300009148 Ga0105243_10014897 Ga0105243_100148973 326
245 3300009176 Ga0105242_10042597 Ga0105242_100425974 326
246 3300009177 Ga0105248_10297472 Ga0105248_102974722 326
247 3300010375 Ga0105239_10085981 Ga0105239_100859812 326
248 3300011119 Ga0105246_10014325 Ga0105246_100143253 326
249 3300013296 Ga0157374_10012907 Ga0157374_100129074 326
250 3300013307 Ga0157372_10058782 Ga0157372_100587825 326
251 3300014325 Ga0163163_10050289 Ga0163163_100502894 326
252 3300014745 Ga0157377_10017680 Ga0157377_100176802 326
253 3300025901 Ga0207688_10000219 Ga0207688_100002196 326
254 3300025906 Ga0207699_10041618 Ga0207699_100416182 326
255 3300025916 Ga0207663_10299635 Ga0207663_102996351 326
256 3300025926 Ga0207659_10048280 Ga0207659_100482803 326
257 3300025927 Ga0207687_10053403 Ga0207687_100534034 326
258 3300025935 Ga0207709_10034054 Ga0207709_100340543 326
259 3300025938 Ga0207704_10011822 Ga0207704_100118225 326
260 3300025940 Ga0207691_10195074 Ga0207691_101950742 326
261 3300025942 Ga0207689_10081292 Ga0207689_100812922 326
262 3300025945 Ga0207679_10090120 Ga0207679_100901202 326
263 3300025972 Ga0207668_10067640 Ga0207668_100676403 326
264 3300025981 Ga0207640_10017262 Ga0207640_100172624 326
265 3300026067 Ga0207678_10014260 Ga0207678_100142607 326
266 3300026075 Ga0207708_10023745 Ga0207708_100237453 326
267 3300026078 Ga0207702_10045443 Ga0207702_100454434 326
268 3300026095 Ga0207676_10061238 Ga0207676_100612385 326
269 3300026116 Ga0207674_10046749 Ga0207674_100467494 326
270 3300026118 Ga0207675_100086348 Ga0207675_1000863484 326
271 3300026121 Ga0207683_10041578 Ga0207683_100415783 326
272 3300028381 Ga0268264_10139993 Ga0268264_101399933 326
273 3300048904 Ga0496101_0053015 Ga0496101_0053015_1618_2676 326
274 3300048905 Ga0496102_0026306 Ga0496102_0026306_1855_2913 326
275 3300048906 Ga0496103_0028317 Ga0496103_0028317_409_1467 326
276 3300048907 Ga0496104_0080515 Ga0496104_0080515_608_1666 326
277 3300048908 Ga0496105_0014811 Ga0496105_0014811_2895_3953 326
278 3300048909 Ga0496106_0088604 Ga0496106_0088604_942_2000 326
279 3300048910 Ga0496107_0073608 Ga0496107_0073608_351_1409 326
280 3300048911 Ga0496108_0179213 Ga0496108_0179213_583_1641 326
281 3300048912 Ga0496109_0101860 Ga0496109_0101860_560_1618 326
282 3300048913 Ga0496110_0076673 Ga0496110_0076673_288_1346 326
283 3300048914 Ga0496111_0037136 Ga0496111_0037136_1835_2893 326
284 3300048915 Ga0496112_0122705 Ga0496112_0122705_475_1533 326
285 3300048916 Ga0496113_0015292 Ga0496113_0015292_2184_3242 326
286 3300048917 Ga0496114_0034244 Ga0496114_0034244_1674_2732 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00487

FA_desaturase

Fatty acid desaturase

55

307

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e0m-assembly4.cif.gz_K homotrimeric variant of tctrp9, bgl15 0.2252 88 297
1i4l-assembly2.cif.gz_A-2 crystal structure analysis of rac1-gdp in complex with arfaptin (p41) 0.2132 24 209
8e0m-assembly4.cif.gz_K homotrimeric variant of tctrp9, bgl15 0.2089 88 297
3ez0-assembly2.cif.gz_C crystal structure of protein of unknown function with ferritin-like fold (yp_832262.1) from arthrobacter sp. fb24 at 2.33 a resolution 0.2022 49 278
5c21-assembly1.cif.gz_B crystal structure of native hlyd from e. coli 0.197 36 209
ID Description Score Start End Superfamily
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7853 36 278 3.30.40.10
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7092 36 278 3.30.40.10
af_Q09528_241_476_1.10.565.10 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.3942 123 209 1.10.565.10
4ijiF02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.3473 125 209 1.20.1050.10
4z90B02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.2924 119 209 1.20.58.390
ID Description Score Start End GO Terms
AF-K2P600-F1-model_v4 deleted 0.9805 39 320
AF-A0A7W4LW14-F1-model_v4 Fatty acid desaturase (EC 1.14.19.-) 0.9805 39 317 GO:0006629
GO:0016020
GO:0016717
AF-A0A147KBS8-F1-model_v4 Fatty acid desaturase 0.9801 39 319 GO:0006629
GO:0016020
GO:0016717
AF-A0A512CRQ0-F1-model_v4 deleted 0.9775 82 315
AF-A0A3C1DH76-F1-model_v4 Fatty acid desaturase 0.9773 210 312 GO:0006629

Feature Viewer

pLDDT pTM Quality
88.24 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map