F387319
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 286 | 193 | 286 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100021562|Ga0068856_1000215626 |
| Length | 375 |
| Sequence | MTATHSAARSPSQAFWRDVVEPYAHAERRRSWWFLLTSLPPYLMLFALMDLSLRISYLLTLALAFPAAGFLVRVYIIFHDCTHGSFLASKRGNRWLGTSLGLFTFSAFDCWQHNHAIHHATAGDLDRRGVGDVQTLTVAEYNARPWRGRMAYRLFRNPLIMFGVGPFVALVVQPRIVPHSARPRIKRSVVATNIALVVLVGGICLLMGWRSYALVQAPIIMLGGAAGIWLFYVQHQFEDVYWEGSAAWSYPDAALHGSSYLKLPKVLQFFSGNIGFHHVHHLSARIPSYNLPRAHLENAIFHDVPTLSLTDGLRAVKLKLYDEDRRRMVSFSQARANSRRKHEQSARRLVPEVSRSRRTNRTGATASGQNPGTGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 70 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 71 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 114 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 116 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 118 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 121 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 123 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 124 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 125 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 126 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 127 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 128 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 130 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 131 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 132 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 133 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 134 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 135 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 136 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 137 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 138 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 141 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 142 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 143 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 144 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 145 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 146 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 147 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 148 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 149 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 150 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 151 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 152 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 173 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 174 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 175 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 176 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 177 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 180 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 181 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 182 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 183 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 184 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 185 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 186 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0.35 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 11.19 |
| Rhizosphere | 83.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1005610 | 3300001977 | Bacteria | 1957 |
| 2 | Ga0065712_10088918 | 3300005290 | Unclassified | 2496 |
| 3 | Ga0070683_100001023 | 3300005329 | Bacteria | 20987 |
| 4 | Ga0068869_100066384 | 3300005334 | Bacteria | 2658 |
| 5 | Ga0070682_100011375 | 3300005337 | Bacteria | 5084 |
| 6 | Ga0068868_100029363 | 3300005338 | Bacteria | 4210 |
| 7 | Ga0068868_100058817 | 3300005338 | Bacteria | 3039 |
| 8 | Ga0070660_100040629 | 3300005339 | Bacteria | 3541 |
| 9 | Ga0070691_10031598 | 3300005341 | Bacteria | 2484 |
| 10 | Ga0070661_100069097 | 3300005344 | Bacteria | 2597 |
| 11 | Ga0070668_100005079 | 3300005347 | Bacteria | 9746 |
| 12 | Ga0070669_100006300 | 3300005353 | Bacteria | 8553 |
| 13 | Ga0070675_100065173 | 3300005354 | Bacteria | 3012 |
| 14 | Ga0070674_100141602 | 3300005356 | Unclassified | 1805 |
| 15 | Ga0070659_100004504 | 3300005366 | Bacteria | 9952 |
| 16 | Ga0070659_100062989 | 3300005366 | Bacteria | 2933 |
| 17 | Ga0070667_100003166 | 3300005367 | Bacteria | 14103 |
| 18 | Ga0070714_100170460 | 3300005435 | Bacteria | 1975 |
| 19 | Ga0070713_100171659 | 3300005436 | Bacteria | 1943 |
| 20 | Ga0070710_10019857 | 3300005437 | Bacteria | 3479 |
| 21 | Ga0070705_100226814 | 3300005440 | Bacteria | 1297 |
| 22 | Ga0070700_100007856 | 3300005441 | Bacteria | 5786 |
| 23 | Ga0070663_100010708 | 3300005455 | Bacteria | 5725 |
| 24 | Ga0070678_100014181 | 3300005456 | Bacteria | 5020 |
| 25 | Ga0070678_100042998 | 3300005456 | Bacteria | 3216 |
| 26 | Ga0070662_100006874 | 3300005457 | Bacteria | 7361 |
| 27 | Ga0070662_100137236 | 3300005457 | Bacteria | 1892 |
| 28 | Ga0070662_100303454 | 3300005457 | Bacteria | 1298 |
| 29 | Ga0070681_10213251 | 3300005458 | Bacteria | 1847 |
| 30 | Ga0070685_10015550 | 3300005466 | Bacteria | 4042 |
| 31 | Ga0070679_100215502 | 3300005530 | Bacteria | 1882 |
| 32 | Ga0070684_100063319 | 3300005535 | Bacteria | 3242 |
| 33 | Ga0070684_100121329 | 3300005535 | Bacteria | 2351 |
| 34 | Ga0070684_100421576 | 3300005535 | Bacteria | 1232 |
| 35 | Ga0068853_100055163 | 3300005539 | Bacteria | 3425 |
| 36 | Ga0070672_100305664 | 3300005543 | Unclassified | 1349 |
| 37 | Ga0070672_100317291 | 3300005543 | Bacteria | 1324 |
| 38 | Ga0070695_100144764 | 3300005545 | Bacteria | 1652 |
| 39 | Ga0070696_100231893 | 3300005546 | Bacteria | 1389 |
| 40 | Ga0070665_100009250 | 3300005548 | Bacteria | 9981 |
| 41 | Ga0070665_100015102 | 3300005548 | Bacteria | 7753 |
| 42 | Ga0070665_100203045 | 3300005548 | Bacteria | 1982 |
| 43 | Ga0070704_100158833 | 3300005549 | Bacteria | 1786 |
| 44 | Ga0068855_100045319 | 3300005563 | Bacteria | 5201 |
| 45 | Ga0068857_100039070 | 3300005577 | Bacteria | 4203 |
| 46 | Ga0068857_100143505 | 3300005577 | Bacteria | 2159 |
| 47 | Ga0068854_100024422 | 3300005578 | Bacteria | 4139 |
| 48 | Ga0068856_100021562 | 3300005614 | Bacteria | 6261 |
| 49 | Ga0068856_100028790 | 3300005614 | Bacteria | 5427 |
| 50 | Ga0068856_100043545 | 3300005614 | Bacteria | 4417 |
| 51 | Ga0070702_100053147 | 3300005615 | Bacteria | 2326 |
| 52 | Ga0068859_100288085 | 3300005617 | Bacteria | 1735 |
| 53 | Ga0068864_100129355 | 3300005618 | Bacteria | 2266 |
| 54 | Ga0068866_10072461 | 3300005718 | Bacteria | 1825 |
| 55 | Ga0068861_100017481 | 3300005719 | Bacteria | 5094 |
| 56 | Ga0068861_100060152 | 3300005719 | Bacteria | 2911 |
| 57 | Ga0068851_10062972 | 3300005834 | Bacteria | 1904 |
| 58 | Ga0068870_10134510 | 3300005840 | Bacteria | 1440 |
| 59 | Ga0068863_100094845 | 3300005841 | Bacteria | 2832 |
| 60 | Ga0068860_100085239 | 3300005843 | Bacteria | 3006 |
| 61 | Ga0068862_100004434 | 3300005844 | Bacteria | 11844 |
| 62 | Ga0068862_100324011 | 3300005844 | Bacteria | 1423 |
| 63 | Ga0070717_10021315 | 3300006028 | Bacteria | 5104 |
| 64 | Ga0070717_10103305 | 3300006028 | Bacteria | 2423 |
| 65 | Ga0070712_100034486 | 3300006175 | Bacteria | 3430 |
| 66 | Ga0075428_100036543 | 3300006844 | Bacteria | 5410 |
| 67 | Ga0075431_100001823 | 3300006847 | Bacteria | 20126 |
| 68 | Ga0075431_100024823 | 3300006847 | Bacteria | 6146 |
| 69 | Ga0075429_100000334 | 3300006880 | Bacteria | 34171 |
| 70 | Ga0068865_100033591 | 3300006881 | Bacteria | 3436 |
| 71 | Ga0068865_100061554 | 3300006881 | Bacteria | 2632 |
| 72 | Ga0068865_100084024 | 3300006881 | Bacteria | 2293 |
| 73 | Ga0097620_100288094 | 3300006931 | Bacteria | 1735 |
| 74 | Ga0111539_10006054 | 3300009094 | Bacteria | 15614 |
| 75 | Ga0111539_10010035 | 3300009094 | Bacteria | 11936 |
| 76 | Ga0111539_10590566 | 3300009094 | Bacteria | 1293 |
| 77 | Ga0105245_10004523 | 3300009098 | Bacteria | 12285 |
| 78 | Ga0105245_10028828 | 3300009098 | Bacteria | 4899 |
| 79 | Ga0114129_10015100 | 3300009147 | Bacteria | 10990 |
| 80 | Ga0114129_10272318 | 3300009147 | Bacteria | 2265 |
| 81 | Ga0105243_10014897 | 3300009148 | Bacteria | 5885 |
| 82 | Ga0105243_10123592 | 3300009148 | Bacteria | 2186 |
| 83 | Ga0105242_10012663 | 3300009176 | Bacteria | 6496 |
| 84 | Ga0105242_10042597 | 3300009176 | Bacteria | 3667 |
| 85 | Ga0105242_10072398 | 3300009176 | Bacteria | 2862 |
| 86 | Ga0105242_10374762 | 3300009176 | Bacteria | 1321 |
| 87 | Ga0105248_10297472 | 3300009177 | Bacteria | 1817 |
| 88 | Ga0105249_10056677 | 3300009553 | Bacteria | 3587 |
| 89 | Ga0105239_10085981 | 3300010375 | Bacteria | 3466 |
| 90 | Ga0105239_10142051 | 3300010375 | Bacteria | 2676 |
| 91 | Ga0105239_10332975 | 3300010375 | Bacteria | 1713 |
| 92 | Ga0105246_10014325 | 3300011119 | Bacteria | 4986 |
| 93 | Ga0157374_10012907 | 3300013296 | Bacteria | 7278 |
| 94 | Ga0157374_10162385 | 3300013296 | Bacteria | 2176 |
| 95 | Ga0157372_10058782 | 3300013307 | Bacteria | 4299 |
| 96 | Ga0157372_10228238 | 3300013307 | Bacteria | 2158 |
| 97 | Ga0157375_10069083 | 3300013308 | Bacteria | 3538 |
| 98 | Ga0163163_10050289 | 3300014325 | Bacteria | 4104 |
| 99 | Ga0163163_10138908 | 3300014325 | Bacteria | 2472 |
| 100 | Ga0157377_10017680 | 3300014745 | Bacteria | 3692 |
| 101 | Ga0213876_10003535 | 3300021384 | Bacteria | 8911 |
| 102 | Ga0213876_10007437 | 3300021384 | Bacteria | 5956 |
| 103 | Ga0213876_10034351 | 3300021384 | Bacteria | 2674 |
| 104 | Ga0213876_10060963 | 3300021384 | Bacteria | 1990 |
| 105 | Ga0213875_10035058 | 3300021388 | Bacteria | 2368 |
| 106 | Ga0207688_10000219 | 3300025901 | Bacteria | 25690 |
| 107 | Ga0207688_10008352 | 3300025901 | Bacteria | 5631 |
| 108 | Ga0207680_10002186 | 3300025903 | Bacteria | 9165 |
| 109 | Ga0207680_10046129 | 3300025903 | Bacteria | 2575 |
| 110 | Ga0207647_10076080 | 3300025904 | Bacteria | 2020 |
| 111 | Ga0207699_10041618 | 3300025906 | Bacteria | 2655 |
| 112 | Ga0207705_10088808 | 3300025909 | Bacteria | 2261 |
| 113 | Ga0207695_10100922 | 3300025913 | Bacteria | 2881 |
| 114 | Ga0207671_10008150 | 3300025914 | Bacteria | 8939 |
| 115 | Ga0207693_10009249 | 3300025915 | Bacteria | 8045 |
| 116 | Ga0207663_10299635 | 3300025916 | Bacteria | 1201 |
| 117 | Ga0207657_10011012 | 3300025919 | Bacteria | 8990 |
| 118 | Ga0207681_10024568 | 3300025923 | Bacteria | 3869 |
| 119 | Ga0207694_10052954 | 3300025924 | Bacteria | 3146 |
| 120 | Ga0207659_10048280 | 3300025926 | Bacteria | 3015 |
| 121 | Ga0207687_10023293 | 3300025927 | Bacteria | 4126 |
| 122 | Ga0207687_10053403 | 3300025927 | Bacteria | 2823 |
| 123 | Ga0207700_10123398 | 3300025928 | Bacteria | 2103 |
| 124 | Ga0207664_10062355 | 3300025929 | Bacteria | 2977 |
| 125 | Ga0207706_10006277 | 3300025933 | Bacteria | 11044 |
| 126 | Ga0207706_10028071 | 3300025933 | Bacteria | 5028 |
| 127 | Ga0207706_10111637 | 3300025933 | Bacteria | 2405 |
| 128 | Ga0207686_10011648 | 3300025934 | Bacteria | 4823 |
| 129 | Ga0207686_10049998 | 3300025934 | Bacteria | 2598 |
| 130 | Ga0207709_10034054 | 3300025935 | Bacteria | 2998 |
| 131 | Ga0207704_10011822 | 3300025938 | Bacteria | 4313 |
| 132 | Ga0207691_10138871 | 3300025940 | Unclassified | 2142 |
| 133 | Ga0207691_10195074 | 3300025940 | Bacteria | 1765 |
| 134 | Ga0207689_10081292 | 3300025942 | Bacteria | 2663 |
| 135 | Ga0207661_10000165 | 3300025944 | Bacteria | 43066 |
| 136 | Ga0207661_10002470 | 3300025944 | Bacteria | 12702 |
| 137 | Ga0207679_10090120 | 3300025945 | Bacteria | 2369 |
| 138 | Ga0207667_10116059 | 3300025949 | Bacteria | 2759 |
| 139 | Ga0207712_10038380 | 3300025961 | Bacteria | 3275 |
| 140 | Ga0207668_10067640 | 3300025972 | Bacteria | 2537 |
| 141 | Ga0207640_10017262 | 3300025981 | Bacteria | 4220 |
| 142 | Ga0207658_10125347 | 3300025986 | Bacteria | 2054 |
| 143 | Ga0207703_10000042 | 3300026035 | Bacteria | 161459 |
| 144 | Ga0207639_10052791 | 3300026041 | Bacteria | 3099 |
| 145 | Ga0207678_10014260 | 3300026067 | Bacteria | 6987 |
| 146 | Ga0207708_10023745 | 3300026075 | Bacteria | 4635 |
| 147 | Ga0207702_10044687 | 3300026078 | Bacteria | 3724 |
| 148 | Ga0207702_10045443 | 3300026078 | Bacteria | 3694 |
| 149 | Ga0207676_10061238 | 3300026095 | Bacteria | 2979 |
| 150 | Ga0207674_10043612 | 3300026116 | Bacteria | 4624 |
| 151 | Ga0207674_10046749 | 3300026116 | Bacteria | 4442 |
| 152 | Ga0207675_100007560 | 3300026118 | Bacteria | 10268 |
| 153 | Ga0207675_100086348 | 3300026118 | Bacteria | 2946 |
| 154 | Ga0207683_10041578 | 3300026121 | Bacteria | 4014 |
| 155 | Ga0207428_10003328 | 3300027907 | Bacteria | 15627 |
| 156 | Ga0207428_10301257 | 3300027907 | Bacteria | 1186 |
| 157 | Ga0268266_10003936 | 3300028379 | Bacteria | 14439 |
| 158 | Ga0268266_10017614 | 3300028379 | Bacteria | 6091 |
| 159 | Ga0268265_10003391 | 3300028380 | Bacteria | 11467 |
| 160 | Ga0268264_10139993 | 3300028381 | Bacteria | 2157 |
| 161 | Ga0265337_1000069 | 3300028556 | Bacteria | 47825 |
| 162 | Ga0265326_10000012 | 3300028558 | Bacteria | 175352 |
| 163 | Ga0265326_10011011 | 3300028558 | Bacteria | 2675 |
| 164 | Ga0265319_1000627 | 3300028563 | Bacteria | 23305 |
| 165 | Ga0265318_10020101 | 3300028577 | Bacteria | 2699 |
| 166 | Ga0265322_10000003 | 3300028654 | Bacteria | 468671 |
| 167 | Ga0265322_10011917 | 3300028654 | Bacteria | 2515 |
| 168 | Ga0265336_10000001 | 3300028666 | Bacteria | 916179 |
| 169 | Ga0265338_10000004 | 3300028800 | Bacteria | 644793 |
| 170 | Ga0265324_10000732 | 3300029957 | Bacteria | 21883 |
| 171 | Ga0265760_10006492 | 3300031090 | Bacteria | 3342 |
| 172 | Ga0265328_10014309 | 3300031239 | Bacteria | 3125 |
| 173 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 174 | Ga0265340_10000002 | 3300031247 | Bacteria | 711693 |
| 175 | Ga0265339_10012630 | 3300031249 | Bacteria | 5145 |
| 176 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 177 | Ga0265316_10018663 | 3300031344 | Bacteria | 5957 |
| 178 | Ga0265316_10177544 | 3300031344 | Bacteria | 1586 |
| 179 | Ga0265314_10000044 | 3300031711 | Bacteria | 207337 |
| 180 | Ga0265314_10119331 | 3300031711 | Bacteria | 1663 |
| 181 | Ga0373936_0086542 | 3300035113 | Bacteria | 1309 |
| 182 | Ga0373946_0018966 | 3300035171 | Bacteria | 2645 |
| 183 | Ga0316574_0205250 | 3300035398 | Bacteria | 1265 |
| 184 | Ga0373927_0103609 | 3300035695 | Bacteria | 1852 |
| 185 | Ga0373947_0002801 | 3300035725 | Bacteria | 10422 |
| 186 | Ga0373947_0080173 | 3300035725 | Bacteria | 2019 |
| 187 | Ga0316582_0063353 | 3300036647 | Bacteria | 2376 |
| 188 | Ga0395899_0154052 | 3300037312 | Bacteria | 1627 |
| 189 | Ga0395900_0070111 | 3300037418 | Bacteria | 3603 |
| 190 | Ga0395900_0381258 | 3300037418 | Bacteria | 1378 |
| 191 | Ga0395898_0004936 | 3300037466 | Bacteria | 14476 |
| 192 | Ga0395898_0218574 | 3300037466 | Bacteria | 1818 |
| 193 | Ga0436364_0636613 | 3300037853 | Bacteria | 40639 |
| 194 | Ga0436364_1407505 | 3300037853 | Bacteria | 1899 |
| 195 | Ga0395901_0000308 | 3300038443 | Bacteria | 59999 |
| 196 | Ga0395901_0087425 | 3300038443 | Bacteria | 3259 |
| 197 | Ga0395901_0638683 | 3300038443 | Bacteria | 1069 |
| 198 | Ga0436365_0277770 | 3300039437 | Bacteria | 5595 |
| 199 | Ga0436365_0663277 | 3300039437 | Bacteria | 7386 |
| 200 | Ga0436365_0787002 | 3300039437 | Bacteria | 2726 |
| 201 | Ga0436365_1017497 | 3300039437 | Bacteria | 7240 |
| 202 | Ga0436363_0645205 | 3300039450 | Bacteria | 7081 |
| 203 | Ga0451853_0183869 | 3300041512 | Bacteria | 6916 |
| 204 | Ga0466966_0032984 | 3300044684 | Bacteria | 3352 |
| 205 | Ga0466966_0049948 | 3300044684 | Bacteria | 2662 |
| 206 | Ga0466961_0265573 | 3300044693 | Bacteria | 1052 |
| 207 | Ga0466971_0039634 | 3300044719 | Bacteria | 2114 |
| 208 | Ga0466971_0068133 | 3300044719 | Bacteria | 1613 |
| 209 | Ga0466970_0047026 | 3300044765 | Bacteria | 2299 |
| 210 | Ga0466957_0055210 | 3300044842 | Bacteria | 2427 |
| 211 | Ga0466960_0023052 | 3300044901 | Bacteria | 2791 |
| 212 | Ga0466960_0118859 | 3300044901 | Bacteria | 1382 |
| 213 | Ga0466959_0013535 | 3300045049 | Bacteria | 5913 |
| 214 | Ga0466959_0022051 | 3300045049 | Bacteria | 4704 |
| 215 | Ga0466959_0112002 | 3300045049 | Bacteria | 1947 |
| 216 | Ga0466958_0005333 | 3300045836 | Bacteria | 6905 |
| 217 | Ga0466958_0008582 | 3300045836 | Bacteria | 5672 |
| 218 | Ga0466958_0110311 | 3300045836 | Bacteria | 1717 |
| 219 | Ga0466958_0247773 | 3300045836 | Bacteria | 1139 |
| 220 | Ga0466967_0064025 | 3300045976 | Bacteria | 3269 |
| 221 | Ga0495592_0047745 | 3300046454 | Bacteria | 3188 |
| 222 | Ga0495641_0031778 | 3300046461 | Bacteria | 2519 |
| 223 | Ga0495653_0064901 | 3300046463 | Bacteria | 2750 |
| 224 | Ga0495653_0156432 | 3300046463 | Bacteria | 1587 |
| 225 | Ga0495628_0062434 | 3300046516 | Bacteria | 2920 |
| 226 | Ga0495630_0072059 | 3300046517 | Bacteria | 2601 |
| 227 | Ga0495632_0064871 | 3300046519 | Bacteria | 1765 |
| 228 | Ga0495652_0120874 | 3300046529 | Bacteria | 2089 |
| 229 | Ga0495640_0079047 | 3300046533 | Bacteria | 2190 |
| 230 | Ga0495634_0000018 | 3300046642 | Bacteria | 121323 |
| 231 | Ga0495647_0100584 | 3300046681 | Bacteria | 1197 |
| 232 | Ga0495658_0060119 | 3300046683 | Bacteria | 2178 |
| 233 | Ga0495604_0023751 | 3300047317 | Bacteria | 4892 |
| 234 | Ga0495674_0118666 | 3300047319 | Bacteria | 2236 |
| 235 | Ga0495672_0003313 | 3300047320 | Bacteria | 13918 |
| 236 | Ga0495672_0020852 | 3300047320 | Bacteria | 4286 |
| 237 | Ga0495676_0000974 | 3300047321 | Bacteria | 23999 |
| 238 | Ga0495676_0040954 | 3300047321 | Bacteria | 3819 |
| 239 | Ga0495676_0093384 | 3300047321 | Bacteria | 2244 |
| 240 | Ga0495680_0022643 | 3300047322 | Bacteria | 5234 |
| 241 | Ga0495602_0000032 | 3300048088 | Bacteria | 141185 |
| 242 | Ga0496100_0021998 | 3300048903 | Bacteria | 3851 |
| 243 | Ga0496101_0026075 | 3300048904 | Bacteria | 4061 |
| 244 | Ga0496101_0053015 | 3300048904 | Bacteria | 2925 |
| 245 | Ga0496102_0013713 | 3300048905 | Bacteria | 7028 |
| 246 | Ga0496102_0026306 | 3300048905 | Bacteria | 5188 |
| 247 | Ga0496103_0028317 | 3300048906 | Bacteria | 3399 |
| 248 | Ga0496103_0075529 | 3300048906 | Bacteria | 2113 |
| 249 | Ga0496104_0044103 | 3300048907 | Bacteria | 4190 |
| 250 | Ga0496104_0080515 | 3300048907 | Bacteria | 3105 |
| 251 | Ga0496105_0014811 | 3300048908 | Bacteria | 6208 |
| 252 | Ga0496105_0099173 | 3300048908 | Bacteria | 2405 |
| 253 | Ga0496106_0003206 | 3300048909 | Bacteria | 12247 |
| 254 | Ga0496106_0088604 | 3300048909 | Bacteria | 2386 |
| 255 | Ga0496107_0033301 | 3300048910 | Bacteria | 3686 |
| 256 | Ga0496107_0073608 | 3300048910 | Bacteria | 2485 |
| 257 | Ga0496108_0023045 | 3300048911 | Bacteria | 5122 |
| 258 | Ga0496108_0179213 | 3300048911 | Bacteria | 1834 |
| 259 | Ga0496109_0028102 | 3300048912 | Bacteria | 5028 |
| 260 | Ga0496109_0101860 | 3300048912 | Bacteria | 2665 |
| 261 | Ga0496109_0179697 | 3300048912 | Bacteria | 1987 |
| 262 | Ga0496110_0076673 | 3300048913 | Bacteria | 2972 |
| 263 | Ga0496111_0004356 | 3300048914 | Bacteria | 8935 |
| 264 | Ga0496111_0037136 | 3300048914 | Bacteria | 3486 |
| 265 | Ga0496112_0016643 | 3300048915 | Bacteria | 6894 |
| 266 | Ga0496112_0089557 | 3300048915 | Bacteria | 3045 |
| 267 | Ga0496112_0122705 | 3300048915 | Bacteria | 2568 |
| 268 | Ga0496112_0300669 | 3300048915 | Archaea | 1550 |
| 269 | Ga0496113_0015292 | 3300048916 | Bacteria | 5270 |
| 270 | Ga0496113_0028473 | 3300048916 | Bacteria | 4019 |
| 271 | Ga0496114_0019272 | 3300048917 | Bacteria | 5527 |
| 272 | Ga0496114_0034244 | 3300048917 | Bacteria | 4189 |
| 273 | Ga0496115_0000815 | 3300048918 | Bacteria | 22850 |
| 274 | Ga0496119_0000623 | 3300048922 | Bacteria | 47810 |
| 275 | Ga0496119_0004977 | 3300048922 | Bacteria | 12968 |
| 276 | Ga0501080_0268239 | 3300049742 | Bacteria | 1554 |
| 277 | nmdc:mga05p37_23403_c1 | 3300050507 | Bacteria | 7495 |
| 278 | nmdc:mga09592_17268_c1 | 3300050508 | Bacteria | 5910 |
| 279 | nmdc:mga0qj67_72669_c1 | 3300050509 | Bacteria | 2747 |
| 280 | nmdc:mga06r32_3731_c1 | 3300050510 | Bacteria | 13635 |
| 281 | nmdc:mga06r32_62_c1 | 3300050510 | Bacteria | 68174 |
| 282 | nmdc:mga08y16_18060_c1 | 3300050511 | Bacteria | 7429 |
| 283 | nmdc:mga08y16_4022_c1 | 3300050511 | Bacteria | 15340 |
| 284 | nmdc:mga08y16_51625_c1 | 3300050511 | Bacteria | 4303 |
| 285 | Ga0495595_0023345 | 3300053084 | Bacteria | 2722 |
| 286 | Ga0466962_0014831 | 3300061719 | Bacteria | 3754 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035695 | Ga0373927_0103609 | Ga0373927_0103609_960_1814 | 270 |
| 2 | 3300045836 | Ga0466958_0247773 | Ga0466958_0247773_87_959 | 270 |
| 3 | 3300048912 | Ga0496109_0179697 | Ga0496109_0179697_241_1158 | 279 |
| 4 | 3300046454 | Ga0495592_0047745 | Ga0495592_0047745_1669_2721 | 281 |
| 5 | 3300046516 | Ga0495628_0062434 | Ga0495628_0062434_132_1184 | 281 |
| 6 | 3300046529 | Ga0495652_0120874 | Ga0495652_0120874_518_1570 | 281 |
| 7 | 3300046533 | Ga0495640_0079047 | Ga0495640_0079047_341_1393 | 281 |
| 8 | 3300047319 | Ga0495674_0118666 | Ga0495674_0118666_103_1155 | 281 |
| 9 | 3300010375 | Ga0105239_10142051 | Ga0105239_101420512 | 282 |
| 10 | 3300038443 | Ga0395901_0638683 | Ga0395901_0638683_13_930 | 282 |
| 11 | 3300045049 | Ga0466959_0112002 | Ga0466959_0112002_554_1477 | 282 |
| 12 | 3300021384 | Ga0213876_10034351 | Ga0213876_100343513 | 286 |
| 13 | 3300039437 | Ga0436365_0787002 | Ga0436365_0787002_388_1374 | 286 |
| 14 | 3300044765 | Ga0466970_0047026 | Ga0466970_0047026_691_1653 | 287 |
| 15 | 3300045049 | Ga0466959_0022051 | Ga0466959_0022051_1718_2680 | 287 |
| 16 | 3300031090 | Ga0265760_10006492 | Ga0265760_100064922 | 290 |
| 17 | 3300046642 | Ga0495634_0000018 | Ga0495634_0000018_57633_58613 | 290 |
| 18 | 3300048915 | Ga0496112_0300669 | Ga0496112_0300669_67_1047 | 291 |
| 19 | 3300044684 | Ga0466966_0049948 | Ga0466966_0049948_1591_2604 | 292 |
| 20 | 3300045049 | Ga0466959_0013535 | Ga0466959_0013535_1257_2270 | 292 |
| 21 | 3300045836 | Ga0466958_0110311 | Ga0466958_0110311_630_1643 | 292 |
| 22 | 3300005329 | Ga0070683_100001023 | Ga0070683_10000102316 | 293 |
| 23 | 3300044684 | Ga0466966_0032984 | Ga0466966_0032984_988_1962 | 293 |
| 24 | 3300044693 | Ga0466961_0265573 | Ga0466961_0265573_70_1035 | 293 |
| 25 | 3300025929 | Ga0207664_10062355 | Ga0207664_100623552 | 294 |
| 26 | 3300046463 | Ga0495653_0156432 | Ga0495653_0156432_539_1519 | 295 |
| 27 | 3300047317 | Ga0495604_0023751 | Ga0495604_0023751_412_1434 | 296 |
| 28 | 3300048088 | Ga0495602_0000032 | Ga0495602_0000032_104034_105056 | 296 |
| 29 | 3300037418 | Ga0395900_0381258 | Ga0395900_0381258_123_1154 | 297 |
| 30 | 3300048911 | Ga0496108_0023045 | Ga0496108_0023045_175_1158 | 297 |
| 31 | 3300048915 | Ga0496112_0016643 | Ga0496112_0016643_4939_5922 | 297 |
| 32 | 3300053084 | Ga0495595_0023345 | Ga0495595_0023345_232_1218 | 297 |
| 33 | 3300010375 | Ga0105239_10332975 | Ga0105239_103329752 | 299 |
| 34 | 3300041512 | Ga0451853_0183869 | Ga0451853_0183869_1152_2135 | 299 |
| 35 | 3300044719 | Ga0466971_0039634 | Ga0466971_0039634_465_1451 | 299 |
| 36 | 3300061719 | Ga0466962_0014831 | Ga0466962_0014831_1228_2214 | 299 |
| 37 | 3300009098 | Ga0105245_10004523 | Ga0105245_100045233 | 300 |
| 38 | 3300046681 | Ga0495647_0100584 | Ga0495647_0100584_150_1142 | 300 |
| 39 | 3300047321 | Ga0495676_0040954 | Ga0495676_0040954_2279_3271 | 300 |
| 40 | 3300005339 | Ga0070660_100040629 | Ga0070660_1000406295 | 301 |
| 41 | 3300005347 | Ga0070668_100005079 | Ga0070668_1000050799 | 301 |
| 42 | 3300005353 | Ga0070669_100006300 | Ga0070669_10000630010 | 301 |
| 43 | 3300005366 | Ga0070659_100004504 | Ga0070659_10000450410 | 301 |
| 44 | 3300005366 | Ga0070659_100062989 | Ga0070659_1000629892 | 301 |
| 45 | 3300005457 | Ga0070662_100006874 | Ga0070662_1000068744 | 301 |
| 46 | 3300005458 | Ga0070681_10213251 | Ga0070681_102132512 | 301 |
| 47 | 3300005530 | Ga0070679_100215502 | Ga0070679_1002155022 | 301 |
| 48 | 3300005535 | Ga0070684_100121329 | Ga0070684_1001213292 | 301 |
| 49 | 3300005539 | Ga0068853_100055163 | Ga0068853_1000551632 | 301 |
| 50 | 3300005548 | Ga0070665_100009250 | Ga0070665_1000092503 | 301 |
| 51 | 3300005563 | Ga0068855_100045319 | Ga0068855_1000453192 | 301 |
| 52 | 3300005719 | Ga0068861_100017481 | Ga0068861_1000174815 | 301 |
| 53 | 3300005844 | Ga0068862_100004434 | Ga0068862_1000044346 | 301 |
| 54 | 3300006881 | Ga0068865_100084024 | Ga0068865_1000840242 | 301 |
| 55 | 3300009094 | Ga0111539_10590566 | Ga0111539_105905662 | 301 |
| 56 | 3300009553 | Ga0105249_10056677 | Ga0105249_100566773 | 301 |
| 57 | 3300013307 | Ga0157372_10228238 | Ga0157372_102282382 | 301 |
| 58 | 3300025909 | Ga0207705_10088808 | Ga0207705_100888082 | 301 |
| 59 | 3300025913 | Ga0207695_10100922 | Ga0207695_101009222 | 301 |
| 60 | 3300025919 | Ga0207657_10011012 | Ga0207657_100110123 | 301 |
| 61 | 3300025923 | Ga0207681_10024568 | Ga0207681_100245684 | 301 |
| 62 | 3300025924 | Ga0207694_10052954 | Ga0207694_100529542 | 301 |
| 63 | 3300025933 | Ga0207706_10006277 | Ga0207706_1000627713 | 301 |
| 64 | 3300025949 | Ga0207667_10116059 | Ga0207667_101160594 | 301 |
| 65 | 3300025961 | Ga0207712_10038380 | Ga0207712_100383803 | 301 |
| 66 | 3300026041 | Ga0207639_10052791 | Ga0207639_100527912 | 301 |
| 67 | 3300026116 | Ga0207674_10043612 | Ga0207674_100436122 | 301 |
| 68 | 3300026118 | Ga0207675_100007560 | Ga0207675_1000075605 | 301 |
| 69 | 3300028380 | Ga0268265_10003391 | Ga0268265_1000339112 | 301 |
| 70 | 3300050511 | nmdc:mga08y16_51625_c1 | nmdc:mga08y16_51625_c1_1226_2215 | 301 |
| 71 | 3300005436 | Ga0070713_100171659 | Ga0070713_1001716591 | 302 |
| 72 | 3300006028 | Ga0070717_10021315 | Ga0070717_100213155 | 302 |
| 73 | 3300021384 | Ga0213876_10060963 | Ga0213876_100609633 | 302 |
| 74 | 3300021388 | Ga0213875_10035058 | Ga0213875_100350582 | 302 |
| 75 | 3300025928 | Ga0207700_10123398 | Ga0207700_101233981 | 302 |
| 76 | 3300039437 | Ga0436365_1017497 | Ga0436365_1017497_743_1768 | 302 |
| 77 | 3300039450 | Ga0436363_0645205 | Ga0436363_0645205_4998_6023 | 302 |
| 78 | 3300047322 | Ga0495680_0022643 | Ga0495680_0022643_2647_3696 | 302 |
| 79 | 3300037853 | Ga0436364_1407505 | Ga0436364_1407505_804_1829 | 303 |
| 80 | 3300049742 | Ga0501080_0268239 | Ga0501080_0268239_38_1027 | 303 |
| 81 | 3300005435 | Ga0070714_100170460 | Ga0070714_1001704602 | 304 |
| 82 | 3300006028 | Ga0070717_10103305 | Ga0070717_101033051 | 304 |
| 83 | 3300035398 | Ga0316574_0205250 | Ga0316574_0205250_35_1042 | 304 |
| 84 | 3300009176 | Ga0105242_10374762 | Ga0105242_103747621 | 305 |
| 85 | 3300009176 | Ga0105242_10012663 | Ga0105242_100126632 | 306 |
| 86 | 3300021384 | Ga0213876_10007437 | Ga0213876_100074372 | 306 |
| 87 | 3300025934 | Ga0207686_10011648 | Ga0207686_100116485 | 306 |
| 88 | 3300028379 | Ga0268266_10017614 | Ga0268266_100176147 | 306 |
| 89 | 3300036647 | Ga0316582_0063353 | Ga0316582_0063353_490_1533 | 306 |
| 90 | 3300005367 | Ga0070667_100003166 | Ga0070667_10000316613 | 307 |
| 91 | 3300005548 | Ga0070665_100015102 | Ga0070665_1000151025 | 307 |
| 92 | 3300005577 | Ga0068857_100143505 | Ga0068857_1001435052 | 307 |
| 93 | 3300005840 | Ga0068870_10134510 | Ga0068870_101345101 | 307 |
| 94 | 3300014325 | Ga0163163_10138908 | Ga0163163_101389083 | 307 |
| 95 | 3300021384 | Ga0213876_10003535 | Ga0213876_100035353 | 307 |
| 96 | 3300025903 | Ga0207680_10002186 | Ga0207680_100021867 | 307 |
| 97 | 3300025986 | Ga0207658_10125347 | Ga0207658_101253473 | 307 |
| 98 | 3300026035 | Ga0207703_10000042 | Ga0207703_10000042171 | 307 |
| 99 | 3300028379 | Ga0268266_10003936 | Ga0268266_100039368 | 307 |
| 100 | 3300028558 | Ga0265326_10011011 | Ga0265326_100110112 | 307 |
| 101 | 3300028563 | Ga0265319_1000627 | Ga0265319_10006276 | 307 |
| 102 | 3300028577 | Ga0265318_10020101 | Ga0265318_100201012 | 307 |
| 103 | 3300028654 | Ga0265322_10011917 | Ga0265322_100119171 | 307 |
| 104 | 3300028666 | Ga0265336_10000001 | Ga0265336_10000001762 | 307 |
| 105 | 3300028800 | Ga0265338_10000004 | Ga0265338_10000004121 | 307 |
| 106 | 3300031247 | Ga0265340_10000002 | Ga0265340_10000002121 | 307 |
| 107 | 3300031249 | Ga0265339_10012630 | Ga0265339_100126305 | 307 |
| 108 | 3300031344 | Ga0265316_10018663 | Ga0265316_100186636 | 307 |
| 109 | 3300035725 | Ga0373947_0080173 | Ga0373947_0080173_327_1379 | 307 |
| 110 | 3300037312 | Ga0395899_0154052 | Ga0395899_0154052_363_1376 | 307 |
| 111 | 3300037418 | Ga0395900_0070111 | Ga0395900_0070111_902_1915 | 307 |
| 112 | 3300037466 | Ga0395898_0004936 | Ga0395898_0004936_11971_12984 | 307 |
| 113 | 3300037466 | Ga0395898_0218574 | Ga0395898_0218574_395_1417 | 307 |
| 114 | 3300038443 | Ga0395901_0000308 | Ga0395901_0000308_11971_12984 | 307 |
| 115 | 3300038443 | Ga0395901_0087425 | Ga0395901_0087425_57_1058 | 307 |
| 116 | 3300039437 | Ga0436365_0663277 | Ga0436365_0663277_594_1604 | 307 |
| 117 | 3300046463 | Ga0495653_0064901 | Ga0495653_0064901_1162_2214 | 307 |
| 118 | 3300048922 | Ga0496119_0000623 | Ga0496119_0000623_20330_21334 | 307 |
| 119 | 3300006847 | Ga0075431_100024823 | Ga0075431_1000248236 | 308 |
| 120 | 3300050509 | nmdc:mga0qj67_72669_c1 | nmdc:mga0qj67_72669_c1_1153_2166 | 308 |
| 121 | 3300050510 | nmdc:mga06r32_3731_c1 | nmdc:mga06r32_3731_c1_12126_13139 | 308 |
| 122 | 3300025933 | Ga0207706_10028071 | Ga0207706_100280715 | 309 |
| 123 | 3300037853 | Ga0436364_0636613 | Ga0436364_0636613_17427_18473 | 309 |
| 124 | 3300044901 | Ga0466960_0023052 | Ga0466960_0023052_738_1778 | 309 |
| 125 | 3300045836 | Ga0466958_0008582 | Ga0466958_0008582_4490_5503 | 309 |
| 126 | 3300005535 | Ga0070684_100421576 | Ga0070684_1004215761 | 310 |
| 127 | 3300035113 | Ga0373936_0086542 | Ga0373936_0086542_116_1138 | 310 |
| 128 | 3300035171 | Ga0373946_0018966 | Ga0373946_0018966_791_1813 | 310 |
| 129 | 3300035725 | Ga0373947_0002801 | Ga0373947_0002801_8467_9489 | 310 |
| 130 | 3300046517 | Ga0495630_0072059 | Ga0495630_0072059_631_1653 | 310 |
| 131 | 3300046683 | Ga0495658_0060119 | Ga0495658_0060119_1029_2051 | 310 |
| 132 | 3300047321 | Ga0495676_0093384 | Ga0495676_0093384_457_1479 | 310 |
| 133 | 3300006844 | Ga0075428_100036543 | Ga0075428_1000365433 | 311 |
| 134 | 3300006847 | Ga0075431_100001823 | Ga0075431_10000182311 | 311 |
| 135 | 3300006880 | Ga0075429_100000334 | Ga0075429_10000033431 | 311 |
| 136 | 3300027907 | Ga0207428_10003328 | Ga0207428_100033287 | 311 |
| 137 | 3300027907 | Ga0207428_10301257 | Ga0207428_103012571 | 311 |
| 138 | 3300044719 | Ga0466971_0068133 | Ga0466971_0068133_379_1419 | 311 |
| 139 | 3300044842 | Ga0466957_0055210 | Ga0466957_0055210_1282_2322 | 311 |
| 140 | 3300045976 | Ga0466967_0064025 | Ga0466967_0064025_1152_2168 | 311 |
| 141 | 3300047320 | Ga0495672_0020852 | Ga0495672_0020852_568_1644 | 311 |
| 142 | 3300025944 | Ga0207661_10000165 | Ga0207661_1000016525 | 312 |
| 143 | 3300028556 | Ga0265337_1000069 | Ga0265337_100006947 | 312 |
| 144 | 3300028558 | Ga0265326_10000012 | Ga0265326_1000001235 | 312 |
| 145 | 3300028654 | Ga0265322_10000003 | Ga0265322_10000003322 | 312 |
| 146 | 3300029957 | Ga0265324_10000732 | Ga0265324_1000073213 | 312 |
| 147 | 3300031239 | Ga0265328_10014309 | Ga0265328_100143095 | 312 |
| 148 | 3300031240 | Ga0265320_10000001 | Ga0265320_10000001322 | 312 |
| 149 | 3300031251 | Ga0265327_10000003 | Ga0265327_10000003322 | 312 |
| 150 | 3300031711 | Ga0265314_10000044 | Ga0265314_10000044145 | 312 |
| 151 | 3300047321 | Ga0495676_0000974 | Ga0495676_0000974_18445_19485 | 312 |
| 152 | 3300009094 | Ga0111539_10006054 | Ga0111539_1000605410 | 313 |
| 153 | 3300009094 | Ga0111539_10010035 | Ga0111539_100100357 | 313 |
| 154 | 3300009147 | Ga0114129_10015100 | Ga0114129_100151007 | 313 |
| 155 | 3300025944 | Ga0207661_10002470 | Ga0207661_100024709 | 313 |
| 156 | 3300047320 | Ga0495672_0003313 | Ga0495672_0003313_1885_2919 | 313 |
| 157 | 3300048922 | Ga0496119_0004977 | Ga0496119_0004977_4641_5699 | 313 |
| 158 | 3300050507 | nmdc:mga05p37_23403_c1 | nmdc:mga05p37_23403_c1_5056_6084 | 313 |
| 159 | 3300050508 | nmdc:mga09592_17268_c1 | nmdc:mga09592_17268_c1_3722_4750 | 313 |
| 160 | 3300050510 | nmdc:mga06r32_62_c1 | nmdc:mga06r32_62_c1_11265_12293 | 313 |
| 161 | 3300050511 | nmdc:mga08y16_18060_c1 | nmdc:mga08y16_18060_c1_2267_3295 | 313 |
| 162 | 3300050511 | nmdc:mga08y16_4022_c1 | nmdc:mga08y16_4022_c1_9143_10171 | 313 |
| 163 | 3300046519 | Ga0495632_0064871 | Ga0495632_0064871_255_1316 | 316 |
| 164 | 3300005614 | Ga0068856_100021562 | Ga0068856_1000215626 | 317 |
| 165 | 3300009147 | Ga0114129_10272318 | Ga0114129_102723184 | 317 |
| 166 | 3300044901 | Ga0466960_0118859 | Ga0466960_0118859_211_1275 | 317 |
| 167 | 3300005457 | Ga0070662_100137236 | Ga0070662_1001372361 | 318 |
| 168 | 3300005548 | Ga0070665_100203045 | Ga0070665_1002030452 | 318 |
| 169 | 3300025903 | Ga0207680_10046129 | Ga0207680_100461291 | 318 |
| 170 | 3300025933 | Ga0207706_10111637 | Ga0207706_101116371 | 318 |
| 171 | 3300031344 | Ga0265316_10177544 | Ga0265316_101775443 | 318 |
| 172 | 3300031711 | Ga0265314_10119331 | Ga0265314_101193311 | 318 |
| 173 | 3300025914 | Ga0207671_10008150 | Ga0207671_100081502 | 319 |
| 174 | 3300005614 | Ga0068856_100028790 | Ga0068856_1000287903 | 320 |
| 175 | 3300026078 | Ga0207702_10044687 | Ga0207702_100446873 | 320 |
| 176 | 3300045836 | Ga0466958_0005333 | Ga0466958_0005333_5058_6128 | 320 |
| 177 | 3300005356 | Ga0070674_100141602 | Ga0070674_1001416022 | 322 |
| 178 | 3300005543 | Ga0070672_100305664 | Ga0070672_1003056642 | 322 |
| 179 | 3300025940 | Ga0207691_10138871 | Ga0207691_101388712 | 322 |
| 180 | 3300005338 | Ga0068868_100058817 | Ga0068868_1000588172 | 323 |
| 181 | 3300005456 | Ga0070678_100014181 | Ga0070678_1000141814 | 323 |
| 182 | 3300005545 | Ga0070695_100144764 | Ga0070695_1001447642 | 323 |
| 183 | 3300005549 | Ga0070704_100158833 | Ga0070704_1001588332 | 323 |
| 184 | 3300006175 | Ga0070712_100034486 | Ga0070712_1000344862 | 323 |
| 185 | 3300006881 | Ga0068865_100061554 | Ga0068865_1000615542 | 323 |
| 186 | 3300009148 | Ga0105243_10123592 | Ga0105243_101235922 | 323 |
| 187 | 3300009176 | Ga0105242_10072398 | Ga0105242_100723982 | 323 |
| 188 | 3300013296 | Ga0157374_10162385 | Ga0157374_101623852 | 323 |
| 189 | 3300013308 | Ga0157375_10069083 | Ga0157375_100690833 | 323 |
| 190 | 3300025901 | Ga0207688_10008352 | Ga0207688_100083522 | 323 |
| 191 | 3300025915 | Ga0207693_10009249 | Ga0207693_100092499 | 323 |
| 192 | 3300025927 | Ga0207687_10023293 | Ga0207687_100232932 | 323 |
| 193 | 3300025934 | Ga0207686_10049998 | Ga0207686_100499982 | 323 |
| 194 | 3300039437 | Ga0436365_0277770 | Ga0436365_0277770_1748_2830 | 323 |
| 195 | 3300046461 | Ga0495641_0031778 | Ga0495641_0031778_616_1686 | 323 |
| 196 | 3300048903 | Ga0496100_0021998 | Ga0496100_0021998_1039_2109 | 323 |
| 197 | 3300048904 | Ga0496101_0026075 | Ga0496101_0026075_81_1151 | 323 |
| 198 | 3300048905 | Ga0496102_0013713 | Ga0496102_0013713_5041_6111 | 323 |
| 199 | 3300048906 | Ga0496103_0075529 | Ga0496103_0075529_963_2033 | 323 |
| 200 | 3300048907 | Ga0496104_0044103 | Ga0496104_0044103_1384_2454 | 323 |
| 201 | 3300048908 | Ga0496105_0099173 | Ga0496105_0099173_71_1141 | 323 |
| 202 | 3300048909 | Ga0496106_0003206 | Ga0496106_0003206_3884_4954 | 323 |
| 203 | 3300048910 | Ga0496107_0033301 | Ga0496107_0033301_1089_2159 | 323 |
| 204 | 3300048912 | Ga0496109_0028102 | Ga0496109_0028102_1540_2610 | 323 |
| 205 | 3300048914 | Ga0496111_0004356 | Ga0496111_0004356_6868_7938 | 323 |
| 206 | 3300048915 | Ga0496112_0089557 | Ga0496112_0089557_1907_2977 | 323 |
| 207 | 3300048916 | Ga0496113_0028473 | Ga0496113_0028473_813_1883 | 323 |
| 208 | 3300048917 | Ga0496114_0019272 | Ga0496114_0019272_1047_2117 | 323 |
| 209 | 3300048918 | Ga0496115_0000815 | Ga0496115_0000815_2332_3402 | 323 |
| 210 | 3300005290 | Ga0065712_10088918 | Ga0065712_100889183 | 325 |
| 211 | 3300025904 | Ga0207647_10076080 | Ga0207647_100760802 | 325 |
| 212 | 3300001977 | JGI24746J21847_1005610 | JGI24746J21847_10056101 | 326 |
| 213 | 3300005334 | Ga0068869_100066384 | Ga0068869_1000663843 | 326 |
| 214 | 3300005337 | Ga0070682_100011375 | Ga0070682_1000113755 | 326 |
| 215 | 3300005338 | Ga0068868_100029363 | Ga0068868_1000293634 | 326 |
| 216 | 3300005341 | Ga0070691_10031598 | Ga0070691_100315983 | 326 |
| 217 | 3300005344 | Ga0070661_100069097 | Ga0070661_1000690972 | 326 |
| 218 | 3300005354 | Ga0070675_100065173 | Ga0070675_1000651733 | 326 |
| 219 | 3300005437 | Ga0070710_10019857 | Ga0070710_100198573 | 326 |
| 220 | 3300005440 | Ga0070705_100226814 | Ga0070705_1002268141 | 326 |
| 221 | 3300005441 | Ga0070700_100007856 | Ga0070700_1000078562 | 326 |
| 222 | 3300005455 | Ga0070663_100010708 | Ga0070663_1000107086 | 326 |
| 223 | 3300005456 | Ga0070678_100042998 | Ga0070678_1000429984 | 326 |
| 224 | 3300005457 | Ga0070662_100303454 | Ga0070662_1003034541 | 326 |
| 225 | 3300005466 | Ga0070685_10015550 | Ga0070685_100155503 | 326 |
| 226 | 3300005535 | Ga0070684_100063319 | Ga0070684_1000633192 | 326 |
| 227 | 3300005543 | Ga0070672_100317291 | Ga0070672_1003172912 | 326 |
| 228 | 3300005546 | Ga0070696_100231893 | Ga0070696_1002318932 | 326 |
| 229 | 3300005577 | Ga0068857_100039070 | Ga0068857_1000390704 | 326 |
| 230 | 3300005578 | Ga0068854_100024422 | Ga0068854_1000244223 | 326 |
| 231 | 3300005614 | Ga0068856_100043545 | Ga0068856_1000435456 | 326 |
| 232 | 3300005615 | Ga0070702_100053147 | Ga0070702_1000531474 | 326 |
| 233 | 3300005617 | Ga0068859_100288085 | Ga0068859_1002880852 | 326 |
| 234 | 3300005618 | Ga0068864_100129355 | Ga0068864_1001293553 | 326 |
| 235 | 3300005718 | Ga0068866_10072461 | Ga0068866_100724612 | 326 |
| 236 | 3300005719 | Ga0068861_100060152 | Ga0068861_1000601524 | 326 |
| 237 | 3300005834 | Ga0068851_10062972 | Ga0068851_100629722 | 326 |
| 238 | 3300005841 | Ga0068863_100094845 | Ga0068863_1000948454 | 326 |
| 239 | 3300005843 | Ga0068860_100085239 | Ga0068860_1000852393 | 326 |
| 240 | 3300005844 | Ga0068862_100324011 | Ga0068862_1003240111 | 326 |
| 241 | 3300006881 | Ga0068865_100033591 | Ga0068865_1000335913 | 326 |
| 242 | 3300006931 | Ga0097620_100288094 | Ga0097620_1002880942 | 326 |
| 243 | 3300009098 | Ga0105245_10028828 | Ga0105245_100288285 | 326 |
| 244 | 3300009148 | Ga0105243_10014897 | Ga0105243_100148973 | 326 |
| 245 | 3300009176 | Ga0105242_10042597 | Ga0105242_100425974 | 326 |
| 246 | 3300009177 | Ga0105248_10297472 | Ga0105248_102974722 | 326 |
| 247 | 3300010375 | Ga0105239_10085981 | Ga0105239_100859812 | 326 |
| 248 | 3300011119 | Ga0105246_10014325 | Ga0105246_100143253 | 326 |
| 249 | 3300013296 | Ga0157374_10012907 | Ga0157374_100129074 | 326 |
| 250 | 3300013307 | Ga0157372_10058782 | Ga0157372_100587825 | 326 |
| 251 | 3300014325 | Ga0163163_10050289 | Ga0163163_100502894 | 326 |
| 252 | 3300014745 | Ga0157377_10017680 | Ga0157377_100176802 | 326 |
| 253 | 3300025901 | Ga0207688_10000219 | Ga0207688_100002196 | 326 |
| 254 | 3300025906 | Ga0207699_10041618 | Ga0207699_100416182 | 326 |
| 255 | 3300025916 | Ga0207663_10299635 | Ga0207663_102996351 | 326 |
| 256 | 3300025926 | Ga0207659_10048280 | Ga0207659_100482803 | 326 |
| 257 | 3300025927 | Ga0207687_10053403 | Ga0207687_100534034 | 326 |
| 258 | 3300025935 | Ga0207709_10034054 | Ga0207709_100340543 | 326 |
| 259 | 3300025938 | Ga0207704_10011822 | Ga0207704_100118225 | 326 |
| 260 | 3300025940 | Ga0207691_10195074 | Ga0207691_101950742 | 326 |
| 261 | 3300025942 | Ga0207689_10081292 | Ga0207689_100812922 | 326 |
| 262 | 3300025945 | Ga0207679_10090120 | Ga0207679_100901202 | 326 |
| 263 | 3300025972 | Ga0207668_10067640 | Ga0207668_100676403 | 326 |
| 264 | 3300025981 | Ga0207640_10017262 | Ga0207640_100172624 | 326 |
| 265 | 3300026067 | Ga0207678_10014260 | Ga0207678_100142607 | 326 |
| 266 | 3300026075 | Ga0207708_10023745 | Ga0207708_100237453 | 326 |
| 267 | 3300026078 | Ga0207702_10045443 | Ga0207702_100454434 | 326 |
| 268 | 3300026095 | Ga0207676_10061238 | Ga0207676_100612385 | 326 |
| 269 | 3300026116 | Ga0207674_10046749 | Ga0207674_100467494 | 326 |
| 270 | 3300026118 | Ga0207675_100086348 | Ga0207675_1000863484 | 326 |
| 271 | 3300026121 | Ga0207683_10041578 | Ga0207683_100415783 | 326 |
| 272 | 3300028381 | Ga0268264_10139993 | Ga0268264_101399933 | 326 |
| 273 | 3300048904 | Ga0496101_0053015 | Ga0496101_0053015_1618_2676 | 326 |
| 274 | 3300048905 | Ga0496102_0026306 | Ga0496102_0026306_1855_2913 | 326 |
| 275 | 3300048906 | Ga0496103_0028317 | Ga0496103_0028317_409_1467 | 326 |
| 276 | 3300048907 | Ga0496104_0080515 | Ga0496104_0080515_608_1666 | 326 |
| 277 | 3300048908 | Ga0496105_0014811 | Ga0496105_0014811_2895_3953 | 326 |
| 278 | 3300048909 | Ga0496106_0088604 | Ga0496106_0088604_942_2000 | 326 |
| 279 | 3300048910 | Ga0496107_0073608 | Ga0496107_0073608_351_1409 | 326 |
| 280 | 3300048911 | Ga0496108_0179213 | Ga0496108_0179213_583_1641 | 326 |
| 281 | 3300048912 | Ga0496109_0101860 | Ga0496109_0101860_560_1618 | 326 |
| 282 | 3300048913 | Ga0496110_0076673 | Ga0496110_0076673_288_1346 | 326 |
| 283 | 3300048914 | Ga0496111_0037136 | Ga0496111_0037136_1835_2893 | 326 |
| 284 | 3300048915 | Ga0496112_0122705 | Ga0496112_0122705_475_1533 | 326 |
| 285 | 3300048916 | Ga0496113_0015292 | Ga0496113_0015292_2184_3242 | 326 |
| 286 | 3300048917 | Ga0496114_0034244 | Ga0496114_0034244_1674_2732 | 326 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8e0m-assembly4.cif.gz_K | homotrimeric variant of tctrp9, bgl15 | 0.2252 | 88 | 297 |
| 1i4l-assembly2.cif.gz_A-2 | crystal structure analysis of rac1-gdp in complex with arfaptin (p41) | 0.2132 | 24 | 209 |
| 8e0m-assembly4.cif.gz_K | homotrimeric variant of tctrp9, bgl15 | 0.2089 | 88 | 297 |
| 3ez0-assembly2.cif.gz_C | crystal structure of protein of unknown function with ferritin-like fold (yp_832262.1) from arthrobacter sp. fb24 at 2.33 a resolution | 0.2022 | 49 | 278 |
| 5c21-assembly1.cif.gz_B | crystal structure of native hlyd from e. coli | 0.197 | 36 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4J2X1_81_350_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.7853 | 36 | 278 | 3.30.40.10 |
| af_A0A0R4J2X1_81_350_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.7092 | 36 | 278 | 3.30.40.10 |
| af_Q09528_241_476_1.10.565.10 | Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor | 0.3942 | 123 | 209 | 1.10.565.10 |
| 4ijiF02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.3473 | 125 | 209 | 1.20.1050.10 |
| 4z90B02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain | 0.2924 | 119 | 209 | 1.20.58.390 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K2P600-F1-model_v4 | deleted | 0.9805 | 39 | 320 |
|
| AF-A0A7W4LW14-F1-model_v4 | Fatty acid desaturase (EC 1.14.19.-) | 0.9805 | 39 | 317 |
GO:0006629
GO:0016020 GO:0016717 |
| AF-A0A147KBS8-F1-model_v4 | Fatty acid desaturase | 0.9801 | 39 | 319 |
GO:0006629
GO:0016020 GO:0016717 |
| AF-A0A512CRQ0-F1-model_v4 | deleted | 0.9775 | 82 | 315 |
|
| AF-A0A3C1DH76-F1-model_v4 | Fatty acid desaturase | 0.9773 | 210 | 312 |
GO:0006629
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar