F387236

General Info

Members Datasets Scaffolds Average Seq Length
286 232 572 151

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100488467|Ga0070668_1004884672
Length 156
Sequence MSVHDLGLDLDAMVAVSVAEAFTGLEEGGVPIGAALFDVGGNLIGKGHNRRVQHDDPSSHGETDAFRNAGRQATYRDKILVSSLTPCYYCSGLIRQFGIPTLIVAESTNSPSGGGVPWLAEYGVEVVQFQVPELIEMFRTWTEANPEIWAEDAGMT

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
56 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
57 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
81 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
82 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
83 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
98 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
114 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
115 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
116 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
117 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
118 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
167 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
168 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
176 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
177 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
178 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
179 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
180 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
181 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
182 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
183 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
184 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
185 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
186 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
187 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
188 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
189 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
190 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
191 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
192 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
193 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
194 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
195 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
196 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
197 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
198 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
199 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
200 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
201 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
202 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
203 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
204 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
207 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
208 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
209 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
210 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
211 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
212 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
213 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
214 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
215 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
216 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
217 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
231 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
232 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.7
Rhizosphere 97.55
Stem 0
Stem Tuber 0
Unclassified 18.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100488467 3300005347 Bacteria 1064
2 JGI25407J50210_10000868 3300003373 Bacteria 6511
3 Ga0065704_10302753 3300005289 Bacteria 882
4 Ga0065715_10689976 3300005293 Bacteria 658
5 Ga0065707_10082242 3300005295 Bacteria 18446
6 Ga0070676_10332651 3300005328 Bacteria 1039
7 Ga0070683_100000051 3300005329 Bacteria 90543
8 Ga0070670_100017663 3300005331 Bacteria 6121
9 Ga0068868_101596068 3300005338 Bacteria 613
10 Ga0070675_100038926 3300005354 Bacteria 3878
11 Ga0070674_100338999 3300005356 Bacteria 1210
12 Ga0070709_10130079 3300005434 Bacteria 1717
13 Ga0070710_10038085 3300005437 Bacteria 2639
14 Ga0070711_100380638 3300005439 Bacteria 1141
15 Ga0070705_100041061 3300005440 Unclassified 2635
16 Ga0070700_100385102 3300005441 Bacteria 1050
17 Ga0070708_100312468 3300005445 Bacteria 1480
18 Ga0070662_100602687 3300005457 Bacteria 924
19 Ga0068867_101107286 3300005459 Bacteria 723
20 Ga0070707_100334237 3300005468 Unclassified 1472
21 Ga0070699_100111528 3300005518 Unclassified 2402
22 Ga0070684_100000061 3300005535 Bacteria 70520
23 Ga0070697_100168256 3300005536 Unclassified 1854
24 Ga0068853_100013685 3300005539 Bacteria 6628
25 Ga0070695_100016454 3300005545 Bacteria 4477
26 Ga0068855_100414736 3300005563 Unclassified 1474
27 Ga0068861_100044269 3300005719 Unclassified 3346
28 Ga0068863_100008713 3300005841 Bacteria 9910
29 Ga0068858_100102263 3300005842 Unclassified 2673
30 Ga0070717_10023071 3300006028 Bacteria 4925
31 Ga0070715_10002758 3300006163 Bacteria 5455
32 Ga0070716_100372269 3300006173 Bacteria 1018
33 Ga0070716_100434052 3300006173 Bacteria 953
34 Ga0075433_10091592 3300006852 Bacteria 2688
35 Ga0075434_100022700 3300006871 Bacteria 6110
36 Ga0068865_100957718 3300006881 Bacteria 747
37 Ga0097620_100285050 3300006931 Bacteria 1745
38 Ga0075435_100102195 3300007076 Bacteria 2376
39 Ga0105240_10085681 3300009093 Bacteria 3860
40 Ga0105245_10048500 3300009098 Bacteria 3799
41 Ga0105245_10221166 3300009098 Bacteria 1827
42 Ga0105247_11521388 3300009101 Unclassified 546
43 Ga0105248_10095285 3300009177 Unclassified 3351
44 Ga0105237_10463989 3300009545 Bacteria 1272
45 Ga0105249_10999482 3300009553 Bacteria 905
46 Ga0099796_10160076 3300010159 Bacteria 892
47 Ga0099796_10225042 3300010159 Unclassified 770
48 Ga0157369_10077858 3300013105 Bacteria 3554
49 Ga0157374_10144761 3300013296 Bacteria 2308
50 Ga0157374_10322951 3300013296 Eukaryota 1530
51 Ga0157374_10364220 3300013296 Bacteria 1438
52 Ga0157378_10001603 3300013297 Bacteria 20450
53 Ga0157378_10058351 3300013297 Bacteria 3442
54 Ga0163162_12554503 3300013306 Bacteria 588
55 Ga0157372_10975014 3300013307 Unclassified 982
56 Ga0157375_10127433 3300013308 Bacteria 2662
57 Ga0157375_10402843 3300013308 Bacteria 1535
58 Ga0157375_10987082 3300013308 Bacteria 982
59 Ga0163163_10090028 3300014325 Bacteria 3081
60 Ga0157380_11141177 3300014326 Unclassified 820
61 Ga0157379_10992940 3300014968 Bacteria 800
62 Ga0157376_10397066 3300014969 Bacteria 1332
63 Ga0213874_10137727 3300021377 Bacteria 843
64 Ga0228598_1003658 3300024227 Bacteria 3294
65 Ga0207697_10436905 3300025315 Bacteria 581
66 Ga0207692_10027885 3300025898 Bacteria 2665
67 Ga0207685_10001119 3300025905 Bacteria 5334
68 Ga0207699_10197074 3300025906 Bacteria 1362
69 Ga0207705_10017474 3300025909 Bacteria 5137
70 Ga0207684_10075079 3300025910 Bacteria 2873
71 Ga0207671_10497160 3300025914 Bacteria 972
72 Ga0207646_10251735 3300025922 Unclassified 1596
73 Ga0207650_10277015 3300025925 Bacteria 1365
74 Ga0207659_10042855 3300025926 Bacteria 3175
75 Ga0207687_10130651 3300025927 Bacteria 1892
76 Ga0207700_10018526 3300025928 Plasmid 4682
77 Ga0207665_10023980 3300025939 Bacteria 4021
78 Ga0207665_10274142 3300025939 Bacteria 1254
79 Ga0207661_10000046 3300025944 Bacteria 107171
80 Ga0207667_10747448 3300025949 Unclassified 977
81 Ga0207677_10968671 3300026023 Bacteria 770
82 Ga0207703_10021847 3300026035 Bacteria 5010
83 Ga0207639_10005043 3300026041 Bacteria 8894
84 Ga0207639_11011612 3300026041 Bacteria 778
85 Ga0207641_10024075 3300026088 Eukaryota 5017
86 Ga0207648_10844535 3300026089 Bacteria 854
87 Ga0207676_10358452 3300026095 Bacteria 1351
88 Ga0207675_100037202 3300026118 Bacteria 4540
89 Ga0207698_10225935 3300026142 Bacteria 1696
90 Ga0316177_1065110 3300030731 Bacteria 4003
91 Ga0314311_1124814 3300030733 Bacteria 5159
92 Ga0265328_10045018 3300031239 Bacteria 1623
93 Ga0265329_10096353 3300031242 Bacteria 940
94 Ga0265331_10003070 3300031250 Bacteria 10955
95 Ga0265316_10007965 3300031344 Bacteria 9905
96 Ga0307408_101609114 3300031548 Bacteria 617
97 Ga0265313_10192498 3300031595 Bacteria 852
98 Ga0307405_10481696 3300031731 Unclassified 990
99 Ga0307410_10036846 3300031852 Bacteria 3189
100 Ga0307406_10505766 3300031901 Bacteria 980
101 Ga0307407_10113780 3300031903 Bacteria 1703
102 Ga0307409_100007197 3300031995 Bacteria 6632
103 Ga0307416_100148799 3300032002 Bacteria 2143
104 Ga0307416_100343840 3300032002 Bacteria 1506
105 Ga0307416_100954806 3300032002 Unclassified 959
106 Ga0307416_101898846 3300032002 Bacteria 699
107 Ga0307416_102445898 3300032002 Bacteria 621
108 Ga0307414_10238101 3300032004 Unclassified 1505
109 Ga0307411_10115047 3300032005 Bacteria 1934
110 Ga0307411_10639494 3300032005 Unclassified 919
111 Ga0307415_100439590 3300032126 Bacteria 1124
112 Ga0316212_1027089 3300033547 Bacteria 804
113 Ga0373952_0168335 3300035092 Unclassified 625
114 Ga0373923_0011027 3300035111 Bacteria 3305
115 Ga0373954_0018973 3300035118 Bacteria 3100
116 Ga0373943_0166627 3300035170 Unclassified 1203
117 Ga0373955_0048762 3300035172 Bacteria 2298
118 Ga0373931_0037236 3300035691 Bacteria 2540
119 Ga0373935_0003408 3300035692 Bacteria 9233
120 Ga0373927_0009489 3300035695 Bacteria 6526
121 Ga0373933_0187063 3300035724 Unclassified 1322
122 Ga0373937_0003519 3300036401 Bacteria 13177
123 Ga0373937_0113731 3300036401 Bacteria 2519
124 Ga0373937_0150041 3300036401 Unclassified 2183
125 Ga0373925_0138085 3300037068 Bacteria 1906
126 Ga0395900_0625371 3300037418 Bacteria 1015
127 Ga0395900_1411461 3300037418 Bacteria 609
128 Ga0395898_0233257 3300037466 Bacteria 1755
129 Ga0395901_0303735 3300038443 Bacteria 1654
130 Ga0436363_1245108 3300039450 Bacteria 1238
131 Ga0436363_1635709 3300039450 Unclassified 1720
132 Ga0439461_0003467 3300041410 Bacteria 2596
133 Ga0439466_0010932 3300041411 Bacteria 3364
134 Ga0439465_0025785 3300041413 Bacteria 1856
135 Ga0451789_1355688 3300041443 Bacteria 505
136 Ga0439431_0003326 3300041997 Bacteria 3538
137 Ga0439445_0073155 3300042004 Bacteria 950
138 Ga0466972_0256858 3300044658 Bacteria 817
139 Ga0466966_0862935 3300044684 Bacteria 546
140 Ga0466961_0240716 3300044693 Bacteria 1112
141 Ga0466963_0005448 3300044694 Bacteria 7454
142 Ga0466963_0127682 3300044694 Bacteria 1754
143 Ga0466963_0582869 3300044694 Bacteria 790
144 Ga0466963_0867786 3300044694 Bacteria 636
145 Ga0466963_0996696 3300044694 Bacteria 590
146 Ga0466971_0016180 3300044719 Bacteria 3286
147 Ga0466971_0512613 3300044719 Bacteria 593
148 Ga0466970_0196658 3300044765 Bacteria 1121
149 Ga0466957_0019891 3300044842 Bacteria 3951
150 Ga0466957_0276453 3300044842 Bacteria 1123
151 Ga0466960_0007468 3300044901 Bacteria 4442
152 Ga0466959_0092572 3300045049 Bacteria 2170
153 Ga0466959_0267870 3300045049 Bacteria 1175
154 Ga0466958_0005563 3300045836 Bacteria 6793
155 Ga0466967_0025807 3300045976 Bacteria 4851
156 Ga0466967_0308795 3300045976 Bacteria 1523
157 Ga0466967_0530164 3300045976 Bacteria 1158
158 Ga0466967_0793229 3300045976 Bacteria 940
159 Ga0495592_0053720 3300046454 Unclassified 2987
160 Ga0495592_0166033 3300046454 Bacteria 1515
161 Ga0495638_0013476 3300046460 Bacteria 5565
162 Ga0495651_0000418 3300046462 Bacteria 32910
163 Ga0495651_0001926 3300046462 Bacteria 16057
164 Ga0495653_0061161 3300046463 Bacteria 2850
165 Ga0495653_0387580 3300046463 Bacteria 891
166 Ga0495580_0399689 3300046472 Bacteria 927
167 Ga0495608_0008032 3300046511 Bacteria 7416
168 Ga0495608_0129008 3300046511 Bacteria 1619
169 Ga0495618_0396080 3300046514 Unclassified 845
170 Ga0495628_0009432 3300046516 Bacteria 8331
171 Ga0495628_0065587 3300046516 Bacteria 2839
172 Ga0495630_0014817 3300046517 Bacteria 5686
173 Ga0495666_0063831 3300046526 Bacteria 1758
174 Ga0495652_0005951 3300046529 Bacteria 11407
175 Ga0495665_0001517 3300046531 Bacteria 12390
176 Ga0495586_0001446 3300046535 Bacteria 13112
177 Ga0495587_0322716 3300046536 Unclassified 862
178 Ga0495587_0454808 3300046536 Bacteria 709
179 Ga0495645_0101347 3300046543 Bacteria 2047
180 Ga0495667_0019703 3300046559 Bacteria 4552
181 Ga0495667_0050200 3300046559 Unclassified 2754
182 Ga0495667_0342041 3300046559 Bacteria 946
183 Ga0495625_0031616 3300046660 Bacteria 3934
184 Ga0495635_0110423 3300046663 Bacteria 1878
185 Ga0495657_0028560 3300046675 Bacteria 3922
186 Ga0495599_0159573 3300046678 Bacteria 1394
187 Ga0495623_0006222 3300046679 Bacteria 7762
188 Ga0495623_0245184 3300046679 Bacteria 1010
189 Ga0495646_0001498 3300046680 Bacteria 13918
190 Ga0495613_0030255 3300046689 Bacteria 4022
191 Ga0495613_0123795 3300046689 Bacteria 1855
192 Ga0495624_0014615 3300046690 Bacteria 5320
193 Ga0495624_0398084 3300046690 Bacteria 827
194 Ga0495600_0331577 3300046809 Unclassified 955
195 Ga0495604_0005422 3300047317 Bacteria 10115
196 Ga0495674_0018970 3300047319 Bacteria 6395
197 Ga0495674_0063760 3300047319 Bacteria 3205
198 Ga0495674_0068949 3300047319 Bacteria 3059
199 Ga0495676_0076481 3300047321 Bacteria 2556
200 Ga0495680_0002228 3300047322 Bacteria 20011
201 Ga0495680_0065341 3300047322 Bacteria 2786
202 Ga0495675_0030177 3300047444 Bacteria 3459
203 Ga0495675_0124608 3300047444 Bacteria 1603
204 Ga0495675_0423269 3300047444 Bacteria 773
205 Ga0495684_0009940 3300047471 Bacteria 7347
206 Ga0495684_0023631 3300047471 Unclassified 4727
207 Ga0495593_0007435 3300047673 Bacteria 6409
208 Ga0495593_0209024 3300047673 Unclassified 980
209 Ga0495602_0007827 3300048088 Bacteria 11175
210 Ga0495602_0035211 3300048088 Bacteria 4671
211 Ga0495602_0738319 3300048088 Bacteria 665
212 Ga0495614_0004876 3300048089 Bacteria 6058
213 Ga0496112_0142079 3300048915 Bacteria 2370
214 Ga0496121_0612606 3300048924 Bacteria 670
215 Ga0501291_004846 3300049514 Bacteria 1733
216 Ga0501292_002157 3300049515 Bacteria 2508
217 Ga0501293_003398 3300049516 Unclassified 1230
218 Ga0501036_0267683 3300049572 Bacteria 1431
219 Ga0501041_1034601 3300049577 Bacteria 529
220 Ga0501071_0546608 3300049587 Bacteria 889
221 Ga0501072_0374665 3300049588 Bacteria 1129
222 Ga0501076_0057761 3300049592 Bacteria 3082
223 Ga0501077_0165263 3300049593 Bacteria 1406
224 Ga0501202_012078 3300049652 Unclassified 1625
225 Ga0501206_011641 3300049653 Unclassified 1189
226 Ga0501207_007858 3300049654 Unclassified 1530
227 Ga0501208_128178 3300049655 Unclassified 564
228 Ga0501216_000161 3300049660 Bacteria 7103
229 Ga0501217_015266 3300049661 Bacteria 1746
230 Ga0501223_002915 3300049663 Unclassified 3753
231 Ga0501224_000279 3300049664 Bacteria 5914
232 Ga0501228_000330 3300049666 Bacteria 2927
233 Ga0501230_008937 3300049667 Bacteria 1529
234 Ga0501233_002822 3300049668 Unclassified 3087
235 Ga0501235_000409 3300049669 Bacteria 8299
236 Ga0501236_011165 3300049670 Bacteria 1189
237 Ga0501239_000503 3300049672 Bacteria 3061
238 Ga0501240_001097 3300049673 Bacteria 2524
239 Ga0501242_009324 3300049674 Unclassified 1160
240 Ga0501243_017578 3300049675 Unclassified 1161
241 Ga0501247_003436 3300049677 Bacteria 1696
242 Ga0501250_000310 3300049680 Bacteria 3091
243 Ga0501251_001947 3300049681 Bacteria 1961
244 Ga0501253_013488 3300049683 Unclassified 1303
245 Ga0501256_005249 3300049685 Unclassified 1136
246 Ga0501257_030493 3300049686 Unclassified 1298
247 Ga0501258_006014 3300049687 Unclassified 1192
248 Ga0501259_045080 3300049688 Unclassified 879
249 Ga0501261_003154 3300049690 Bacteria 2024
250 Ga0501221_007204 3300049704 Bacteria 1901
251 Ga0501225_0000695 3300049705 Bacteria 10516
252 Ga0501234_007781 3300049707 Bacteria 1675
253 Ga0501234_094937 3300049707 Unclassified 538
254 Ga0501245_002591 3300049708 Bacteria 2423
255 Ga0501079_0014256 3300049741 Bacteria 6060
256 Ga0501232_001972 3300049757 Bacteria 1721
257 Ga0501262_001703 3300049759 Bacteria 2465
258 Ga0501263_001648 3300049760 Bacteria 2149
259 Ga0501265_002113 3300049762 Bacteria 2266
260 Ga0501266_000827 3300049763 Bacteria 4040
261 Ga0501268_000986 3300049765 Bacteria 3376
262 Ga0501270_000477 3300049767 Bacteria 3420
263 Ga0501271_001983 3300049768 Bacteria 1794
264 Ga0501272_002784 3300049769 Bacteria 1745
265 Ga0501274_000212 3300049771 Bacteria 3774
266 Ga0501275_014835 3300049772 Unclassified 889
267 Ga0501279_066402 3300049775 Unclassified 600
268 Ga0501035_0115485 3300049822 Bacteria 2349
269 Ga0501045_0183097 3300049824 Bacteria 1561
270 Ga0501045_0745630 3300049824 Bacteria 722
271 Ga0501200_01062 3300049849 Unclassified 1014
272 nmdc:mga08y16_381589_c1 3300050511 Bacteria 1444
273 nmdc:mga0n895_23652_c1 3300050512 Bacteria 5778
274 nmdc:mga0rr50_45748_c1 3300050513 Eukaryota 3219
275 nmdc:mga0a205_563554_c1 3300050515 Unclassified 994
276 Ga0495601_0786911 3300053077 Unclassified 604
277 Ga0495612_0001009 3300053078 Bacteria 11576
278 Ga0501084_0055512 3300054114 Unclassified 3314
279 Ga0501084_0679310 3300054114 Bacteria 869
280 Ga0501082_0094753 3300060353 Bacteria 2580
281 Ga0501082_1179078 3300060353 Unclassified 669
282 Ga0466962_0003582 3300061719 Bacteria 7401
283 Ga0466962_0406253 3300061719 Bacteria 682
284 Ga0530510_0106072 3300061734 Bacteria 2056
285 2887447264 2887443736 Bacteria 4426037
286 2939588687 2939582691 Bacteria 7088898
287 Ga0070668_100488467
288 JGI25407J50210_10000868
289 Ga0065704_10302753
290 Ga0065715_10689976
291 Ga0065707_10082242
292 Ga0070676_10332651
293 Ga0070683_100000051
294 Ga0070670_100017663
295 Ga0068868_101596068
296 Ga0070675_100038926
297 Ga0070674_100338999
298 Ga0070709_10130079
299 Ga0070710_10038085
300 Ga0070711_100380638
301 Ga0070705_100041061
302 Ga0070700_100385102
303 Ga0070708_100312468
304 Ga0070662_100602687
305 Ga0068867_101107286
306 Ga0070707_100334237
307 Ga0070699_100111528
308 Ga0070684_100000061
309 Ga0070697_100168256
310 Ga0068853_100013685
311 Ga0070695_100016454
312 Ga0068855_100414736
313 Ga0068861_100044269
314 Ga0068863_100008713
315 Ga0068858_100102263
316 Ga0070717_10023071
317 Ga0070715_10002758
318 Ga0070716_100372269
319 Ga0070716_100434052
320 Ga0075433_10091592
321 Ga0075434_100022700
322 Ga0068865_100957718
323 Ga0097620_100285050
324 Ga0075435_100102195
325 Ga0105240_10085681
326 Ga0105245_10048500
327 Ga0105245_10221166
328 Ga0105247_11521388
329 Ga0105248_10095285
330 Ga0105237_10463989
331 Ga0105249_10999482
332 Ga0099796_10160076
333 Ga0099796_10225042
334 Ga0157369_10077858
335 Ga0157374_10144761
336 Ga0157374_10322951
337 Ga0157374_10364220
338 Ga0157378_10001603
339 Ga0157378_10058351
340 Ga0163162_12554503
341 Ga0157372_10975014
342 Ga0157375_10127433
343 Ga0157375_10402843
344 Ga0157375_10987082
345 Ga0163163_10090028
346 Ga0157380_11141177
347 Ga0157379_10992940
348 Ga0157376_10397066
349 Ga0213874_10137727
350 Ga0228598_1003658
351 Ga0207697_10436905
352 Ga0207692_10027885
353 Ga0207685_10001119
354 Ga0207699_10197074
355 Ga0207705_10017474
356 Ga0207684_10075079
357 Ga0207671_10497160
358 Ga0207646_10251735
359 Ga0207650_10277015
360 Ga0207659_10042855
361 Ga0207687_10130651
362 Ga0207700_10018526
363 Ga0207665_10023980
364 Ga0207665_10274142
365 Ga0207661_10000046
366 Ga0207667_10747448
367 Ga0207677_10968671
368 Ga0207703_10021847
369 Ga0207639_10005043
370 Ga0207639_11011612
371 Ga0207641_10024075
372 Ga0207648_10844535
373 Ga0207676_10358452
374 Ga0207675_100037202
375 Ga0207698_10225935
376 Ga0316177_1065110
377 Ga0314311_1124814
378 Ga0265328_10045018
379 Ga0265329_10096353
380 Ga0265331_10003070
381 Ga0265316_10007965
382 Ga0307408_101609114
383 Ga0265313_10192498
384 Ga0307405_10481696
385 Ga0307410_10036846
386 Ga0307406_10505766
387 Ga0307407_10113780
388 Ga0307409_100007197
389 Ga0307416_100148799
390 Ga0307416_100343840
391 Ga0307416_100954806
392 Ga0307416_101898846
393 Ga0307416_102445898
394 Ga0307414_10238101
395 Ga0307411_10115047
396 Ga0307411_10639494
397 Ga0307415_100439590
398 Ga0316212_1027089
399 Ga0373952_0168335
400 Ga0373923_0011027
401 Ga0373954_0018973
402 Ga0373943_0166627
403 Ga0373955_0048762
404 Ga0373931_0037236
405 Ga0373935_0003408
406 Ga0373927_0009489
407 Ga0373933_0187063
408 Ga0373937_0003519
409 Ga0373937_0113731
410 Ga0373937_0150041
411 Ga0373925_0138085
412 Ga0395900_0625371
413 Ga0395900_1411461
414 Ga0395898_0233257
415 Ga0395901_0303735
416 Ga0436363_1245108
417 Ga0436363_1635709
418 Ga0439461_0003467
419 Ga0439466_0010932
420 Ga0439465_0025785
421 Ga0451789_1355688
422 Ga0439431_0003326
423 Ga0439445_0073155
424 Ga0466972_0256858
425 Ga0466966_0862935
426 Ga0466961_0240716
427 Ga0466963_0005448
428 Ga0466963_0127682
429 Ga0466963_0582869
430 Ga0466963_0867786
431 Ga0466963_0996696
432 Ga0466971_0016180
433 Ga0466971_0512613
434 Ga0466970_0196658
435 Ga0466957_0019891
436 Ga0466957_0276453
437 Ga0466960_0007468
438 Ga0466959_0092572
439 Ga0466959_0267870
440 Ga0466958_0005563
441 Ga0466967_0025807
442 Ga0466967_0308795
443 Ga0466967_0530164
444 Ga0466967_0793229
445 Ga0495592_0053720
446 Ga0495592_0166033
447 Ga0495638_0013476
448 Ga0495651_0000418
449 Ga0495651_0001926
450 Ga0495653_0061161
451 Ga0495653_0387580
452 Ga0495580_0399689
453 Ga0495608_0008032
454 Ga0495608_0129008
455 Ga0495618_0396080
456 Ga0495628_0009432
457 Ga0495628_0065587
458 Ga0495630_0014817
459 Ga0495666_0063831
460 Ga0495652_0005951
461 Ga0495665_0001517
462 Ga0495586_0001446
463 Ga0495587_0322716
464 Ga0495587_0454808
465 Ga0495645_0101347
466 Ga0495667_0019703
467 Ga0495667_0050200
468 Ga0495667_0342041
469 Ga0495625_0031616
470 Ga0495635_0110423
471 Ga0495657_0028560
472 Ga0495599_0159573
473 Ga0495623_0006222
474 Ga0495623_0245184
475 Ga0495646_0001498
476 Ga0495613_0030255
477 Ga0495613_0123795
478 Ga0495624_0014615
479 Ga0495624_0398084
480 Ga0495600_0331577
481 Ga0495604_0005422
482 Ga0495674_0018970
483 Ga0495674_0063760
484 Ga0495674_0068949
485 Ga0495676_0076481
486 Ga0495680_0002228
487 Ga0495680_0065341
488 Ga0495675_0030177
489 Ga0495675_0124608
490 Ga0495675_0423269
491 Ga0495684_0009940
492 Ga0495684_0023631
493 Ga0495593_0007435
494 Ga0495593_0209024
495 Ga0495602_0007827
496 Ga0495602_0035211
497 Ga0495602_0738319
498 Ga0495614_0004876
499 Ga0496112_0142079
500 Ga0496121_0612606
501 Ga0501291_004846
502 Ga0501292_002157
503 Ga0501293_003398
504 Ga0501036_0267683
505 Ga0501041_1034601
506 Ga0501071_0546608
507 Ga0501072_0374665
508 Ga0501076_0057761
509 Ga0501077_0165263
510 Ga0501202_012078
511 Ga0501206_011641
512 Ga0501207_007858
513 Ga0501208_128178
514 Ga0501216_000161
515 Ga0501217_015266
516 Ga0501223_002915
517 Ga0501224_000279
518 Ga0501228_000330
519 Ga0501230_008937
520 Ga0501233_002822
521 Ga0501235_000409
522 Ga0501236_011165
523 Ga0501239_000503
524 Ga0501240_001097
525 Ga0501242_009324
526 Ga0501243_017578
527 Ga0501247_003436
528 Ga0501250_000310
529 Ga0501251_001947
530 Ga0501253_013488
531 Ga0501256_005249
532 Ga0501257_030493
533 Ga0501258_006014
534 Ga0501259_045080
535 Ga0501261_003154
536 Ga0501221_007204
537 Ga0501225_0000695
538 Ga0501234_007781
539 Ga0501234_094937
540 Ga0501245_002591
541 Ga0501079_0014256
542 Ga0501232_001972
543 Ga0501262_001703
544 Ga0501263_001648
545 Ga0501265_002113
546 Ga0501266_000827
547 Ga0501268_000986
548 Ga0501270_000477
549 Ga0501271_001983
550 Ga0501272_002784
551 Ga0501274_000212
552 Ga0501275_014835
553 Ga0501279_066402
554 Ga0501035_0115485
555 Ga0501045_0183097
556 Ga0501045_0745630
557 Ga0501200_01062
558 nmdc:mga08y16_381589_c1
559 nmdc:mga0n895_23652_c1
560 nmdc:mga0rr50_45748_c1
561 nmdc:mga0a205_563554_c1
562 Ga0495601_0786911
563 Ga0495612_0001009
564 Ga0501084_0055512
565 Ga0501084_0679310
566 Ga0501082_0094753
567 Ga0501082_1179078
568 Ga0466962_0003582
569 Ga0466962_0406253
570 Ga0530510_0106072
571 2887447264
572 2939588687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

9

106

0.87

PF14437

MafB19-deam

MafB19-like deaminase

9

132

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1p6o-assembly1.cif.gz_A the crystal structure of yeast cytosine deaminase bound to 4(r)-hydroxyl-3,4-dihydropyrimidine at 1.14 angstroms. 0.9499 1 151
1ysb-assembly1.cif.gz_A yeast cytosine deaminase triple mutant 0.9499 1 151
2o3k-assembly1.cif.gz_B yeast cytosine deaminase d92e triple mutant bound to transition state analogue hpy 0.9442 1 151
1ysd-assembly1.cif.gz_A yeast cytosine deaminase double mutant 0.9441 1 151
1p6o-assembly1.cif.gz_A the crystal structure of yeast cytosine deaminase bound to 4(r)-hydroxyl-3,4-dihydropyrimidine at 1.14 angstroms. 0.9378 1 151
ID Description Score Start End Superfamily
af_P78594_2_150_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9753 9 151 3.40.140.10
af_A0A1D8PFE5_422_777_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.9353 30 44 2.120.10.80
af_A0A1D6ELV0_114_227_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.931 9 107 3.40.140.10
af_P78594_2_150_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9305 9 151 3.40.140.10
af_A0A1D8PGE9_1_163_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9172 13 137 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A0C9YMB4-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9953 79 144 GO:0002100
GO:0052717
AF-A0A381YV54-F1-model_v4 CMP/dCMP-type deaminase domain-containing protein 0.9897 6 138 GO:0008835
AF-B5GGL2-F1-model_v4 Cytosine deaminase 0.9896 79 152 GO:0003824
AF-A0A1V4UY33-F1-model_v4 tRNA-specific adenosine deaminase 0.9883 11 150 GO:0008835
GO:0016020
AF-A0A853BSE4-F1-model_v4 Cytosine deaminase (EC 3.5.4.1) 0.9876 8 150 GO:0008835

Map