F387209

General Info

Members Datasets Scaffolds Average Seq Length
286 150 286 66

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10035733|Ga0070658_100357337
Length 77
Sequence MSSAPDEDAAAIVARALSRRPAKARPRFLRELLAHTAAGLVVIEGERAAGEAVYRLADAVVARGGRRPCGFRDTGRR

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
100 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
131 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
144 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
147 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
148 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
149 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.29
Nodule 0
Rhizoplane 1.4
Rhizosphere 89.16
Stem 0
Stem Tuber 0
Unclassified 3.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10103957 3300003215 Bacteria 663
2 Ga0055530_10001503 3300003791 Bacteria 16904
3 Ga0055531_10005447 3300003794 Bacteria 7450
4 Ga0055531_10007409 3300003794 Bacteria 5998
5 Ga0065165_1000103 3300005262 Bacteria 140705
6 Ga0065165_1009640 3300005262 Bacteria 4295
7 Ga0070658_10035733 3300005327 Bacteria 4003
8 Ga0070658_10061818 3300005327 Bacteria 3051
9 Ga0070658_10126680 3300005327 Bacteria 2126
10 Ga0070683_100963003 3300005329 Bacteria 819
11 Ga0070683_101407711 3300005329 Unclassified 670
12 Ga0070666_10693613 3300005335 Bacteria 746
13 Ga0070666_11448541 3300005335 Unclassified 513
14 Ga0070680_100046508 3300005336 Bacteria 3531
15 Ga0070680_100251671 3300005336 Bacteria 1494
16 Ga0070680_100922215 3300005336 Bacteria 754
17 Ga0070660_100083290 3300005339 Bacteria 2513
18 Ga0070660_100119790 3300005339 Bacteria 2100
19 Ga0070660_100265068 3300005339 Unclassified 1403
20 Ga0070661_100331672 3300005344 Bacteria 1190
21 Ga0070661_100844160 3300005344 Bacteria 753
22 Ga0070668_100003309 3300005347 Bacteria 11887
23 Ga0070668_100059345 3300005347 Bacteria 2961
24 Ga0070668_100723679 3300005347 Bacteria 879
25 Ga0070671_100364853 3300005355 Bacteria 1233
26 Ga0070659_100004474 3300005366 Bacteria 9987
27 Ga0070659_100637327 3300005366 Unclassified 918
28 Ga0070659_101771723 3300005366 Bacteria 553
29 Ga0070667_100063981 3300005367 Bacteria 3119
30 Ga0070678_100665944 3300005456 Bacteria 935
31 Ga0070681_10041486 3300005458 Bacteria 4612
32 Ga0070681_10152792 3300005458 Bacteria 2234
33 Ga0070707_101301585 3300005468 Unclassified 693
34 Ga0070698_102061602 3300005471 Bacteria 524
35 Ga0070679_100000814 3300005530 Bacteria 27054
36 Ga0070679_100012037 3300005530 Bacteria 8257
37 Ga0070679_100263674 3300005530 Bacteria 1678
38 Ga0070679_101147454 3300005530 Bacteria 722
39 Ga0068853_100426738 3300005539 Bacteria 1244
40 Ga0068853_100734250 3300005539 Unclassified 943
41 Ga0070665_100000015 3300005548 Bacteria 462744
42 Ga0070665_100013799 3300005548 Bacteria 8127
43 Ga0070665_100730349 3300005548 Bacteria 1003
44 Ga0068855_100075266 3300005563 Bacteria 3921
45 Ga0068855_100428702 3300005563 Bacteria 1446
46 Ga0068855_100865241 3300005563 Bacteria 957
47 Ga0070664_100547372 3300005564 Unclassified 1070
48 Ga0068857_100881829 3300005577 Bacteria 857
49 Ga0068854_100911842 3300005578 Bacteria 773
50 Ga0068854_101323344 3300005578 Unclassified 649
51 Ga0068856_100537482 3300005614 Bacteria 1190
52 Ga0068852_100555000 3300005616 Bacteria 1149
53 Ga0068859_100368134 3300005617 Bacteria 1532
54 Ga0068859_100391418 3300005617 Bacteria 1486
55 Ga0068859_100842706 3300005617 Bacteria 1003
56 Ga0068859_102605145 3300005617 Unclassified 556
57 Ga0068864_100084763 3300005618 Bacteria 2785
58 Ga0068864_101288855 3300005618 Bacteria 731
59 Ga0068864_101407539 3300005618 Unclassified 699
60 Ga0068861_100428539 3300005719 Bacteria 1180
61 Ga0068861_101420736 3300005719 Unclassified 678
62 Ga0068851_10555444 3300005834 Bacteria 694
63 Ga0068863_100137297 3300005841 Bacteria 2336
64 Ga0068863_100199814 3300005841 Bacteria 1923
65 Ga0068863_100896512 3300005841 Unclassified 887
66 Ga0068858_100271054 3300005842 Bacteria 1615
67 Ga0068858_101190470 3300005842 Bacteria 749
68 Ga0068860_100000165 3300005843 Bacteria 108321
69 Ga0068862_100006415 3300005844 Bacteria 9784
70 Ga0068862_100188773 3300005844 Bacteria 1853
71 Ga0068862_100387725 3300005844 Unclassified 1304
72 Ga0068862_101092317 3300005844 Bacteria 792
73 Ga0075362_10050826 3300006177 Bacteria 1854
74 Ga0097621_101608873 3300006237 Unclassified 618
75 Ga0068865_100015236 3300006881 Bacteria 4900
76 Ga0097620_100368132 3300006931 Bacteria 1532
77 Ga0097620_100391442 3300006931 Bacteria 1486
78 Ga0097620_100842804 3300006931 Bacteria 1003
79 Ga0097620_102605912 3300006931 Unclassified 556
80 Ga0105240_10000671 3300009093 Bacteria 62794
81 Ga0105240_10056296 3300009093 Bacteria 4921
82 Ga0105240_10067133 3300009093 Bacteria 4446
83 Ga0105240_10075185 3300009093 Bacteria 4167
84 Ga0105240_10506621 3300009093 Bacteria 1341
85 Ga0105240_11288601 3300009093 Unclassified 771
86 Ga0105245_10100268 3300009098 Bacteria 2679
87 Ga0105245_12812396 3300009098 Bacteria 539
88 Ga0105242_10616484 3300009176 Bacteria 1050
89 Ga0105248_10020343 3300009177 Bacteria 7353
90 Ga0105248_12309807 3300009177 Bacteria 612
91 Ga0105237_10409695 3300009545 Bacteria 1360
92 Ga0105238_10022500 3300009551 Bacteria 6424
93 Ga0105238_10127049 3300009551 Bacteria 2528
94 Ga0105238_10369282 3300009551 Bacteria 1425
95 Ga0105238_10941941 3300009551 Bacteria 883
96 Ga0105238_11035027 3300009551 Bacteria 842
97 Ga0105249_11324141 3300009553 Unclassified 792
98 Ga0105249_12462192 3300009553 Bacteria 593
99 Ga0105239_12712383 3300010375 Bacteria 578
100 Ga0105239_13138766 3300010375 Bacteria 538
101 Ga0157370_10086290 3300013104 Bacteria 2949
102 Ga0157374_10801535 3300013296 Bacteria 958
103 Ga0163162_10603185 3300013306 Bacteria 1224
104 Ga0163163_10034486 3300014325 Bacteria 4902
105 Ga0163163_10720409 3300014325 Bacteria 1061
106 Ga0163163_11143399 3300014325 Unclassified 841
107 Ga0209026_1001557 3300025250 Bacteria 9927
108 Ga0209758_1005267 3300025297 Bacteria 10116
109 Ga0209050_1000038 3300025298 Bacteria 412635
110 Ga0209257_1000138 3300025304 Bacteria 204131
111 Ga0209257_1003465 3300025304 Bacteria 13483
112 Ga0207680_10900959 3300025903 Bacteria 634
113 Ga0207705_10182970 3300025909 Bacteria 1582
114 Ga0207705_10187317 3300025909 Bacteria 1564
115 Ga0207705_10258148 3300025909 Bacteria 1330
116 Ga0207707_10126506 3300025912 Bacteria 2235
117 Ga0207695_10000876 3300025913 Bacteria 54758
118 Ga0207695_10002095 3300025913 Bacteria 30360
119 Ga0207695_10022127 3300025913 Bacteria 7229
120 Ga0207695_10119553 3300025913 Bacteria 2604
121 Ga0207695_10318548 3300025913 Bacteria 1445
122 Ga0207695_10588488 3300025913 Bacteria 994
123 Ga0207660_10215519 3300025917 Bacteria 1505
124 Ga0207660_11609707 3300025917 Bacteria 523
125 Ga0207657_10026754 3300025919 Bacteria 5293
126 Ga0207657_10056201 3300025919 Bacteria 3396
127 Ga0207657_10221852 3300025919 Bacteria 1514
128 Ga0207649_11357105 3300025920 Bacteria 562
129 Ga0207652_10082123 3300025921 Bacteria 2820
130 Ga0207652_10105042 3300025921 Bacteria 2499
131 Ga0207652_11274959 3300025921 Bacteria 637
132 Ga0207681_10995815 3300025923 Bacteria 703
133 Ga0207694_10117226 3300025924 Bacteria 2123
134 Ga0207694_10242418 3300025924 Bacteria 1473
135 Ga0207694_10363876 3300025924 Bacteria 1199
136 Ga0207694_10646195 3300025924 Bacteria 891
137 Ga0207694_10778493 3300025924 Bacteria 808
138 Ga0207650_10185694 3300025925 Bacteria 1659
139 Ga0207687_10091824 3300025927 Bacteria 2215
140 Ga0207644_10330099 3300025931 Bacteria 1235
141 Ga0207644_10415581 3300025931 Bacteria 1101
142 Ga0207690_10000111 3300025932 Bacteria 66639
143 Ga0207690_11633030 3300025932 Bacteria 539
144 Ga0207686_10398317 3300025934 Bacteria 1048
145 Ga0207704_10001481 3300025938 Bacteria 10521
146 Ga0207679_10520555 3300025945 Bacteria 1064
147 Ga0207667_10074611 3300025949 Bacteria 3523
148 Ga0207667_10222401 3300025949 Bacteria 1934
149 Ga0207667_10384383 3300025949 Bacteria 1430
150 Ga0207712_10567451 3300025961 Bacteria 978
151 Ga0207668_10002257 3300025972 Bacteria 11241
152 Ga0207668_10156040 3300025972 Bacteria 1773
153 Ga0207668_11005179 3300025972 Bacteria 745
154 Ga0207640_10948246 3300025981 Unclassified 754
155 Ga0207658_10048305 3300025986 Bacteria 3120
156 Ga0207677_11698325 3300026023 Unclassified 585
157 Ga0207703_10258045 3300026035 Bacteria 1574
158 Ga0207703_12007551 3300026035 Bacteria 555
159 Ga0207639_10532762 3300026041 Bacteria 1077
160 Ga0207639_10576544 3300026041 Bacteria 1035
161 Ga0207702_10251946 3300026078 Bacteria 1658
162 Ga0207702_11277566 3300026078 Unclassified 728
163 Ga0207641_10596629 3300026088 Unclassified 1081
164 Ga0207641_10921909 3300026088 Unclassified 868
165 Ga0207676_10067025 3300026095 Bacteria 2866
166 Ga0207676_10302523 3300026095 Bacteria 1461
167 Ga0207676_11855910 3300026095 Unclassified 601
168 Ga0207676_12089576 3300026095 Unclassified 565
169 Ga0207674_10781153 3300026116 Bacteria 922
170 Ga0207675_100998182 3300026118 Bacteria 855
171 Ga0207675_101690990 3300026118 Unclassified 653
172 Ga0207683_12166247 3300026121 Bacteria 504
173 Ga0207698_10485771 3300026142 Bacteria 1199
174 Ga0209981_1001311 3300027378 Bacteria 3151
175 Ga0209983_1013948 3300027665 Bacteria 1654
176 Ga0268266_10000005 3300028379 Bacteria 1448194
177 Ga0268266_10963682 3300028379 Bacteria 825
178 Ga0268266_11553619 3300028379 Bacteria 637
179 Ga0268265_10000867 3300028380 Bacteria 28355
180 Ga0268265_10099851 3300028380 Bacteria 2341
181 Ga0268265_10171282 3300028380 Unclassified 1856
182 Ga0268264_10000021 3300028381 Bacteria 481580
183 Ga0307517_10001415 3300028786 Bacteria 40367
184 Ga0307517_10123814 3300028786 Bacteria 1897
185 Ga0307511_10005612 3300030521 Bacteria 12736
186 Ga0307513_10013193 3300031456 Bacteria 10150
187 Ga0307513_10013559 3300031456 Bacteria 9996
188 Ga0307513_10060816 3300031456 Bacteria 4002
189 Ga0307513_11004628 3300031456 Bacteria 544
190 Ga0307405_11224614 3300031731 Bacteria 650
191 Ga0307411_10861090 3300032005 Bacteria 802
192 Ga0307510_10080734 3300033180 Bacteria 3160
193 Ga0373944_0033881 3300035089 Unclassified 1549
194 Ga0373941_0214883 3300035115 Bacteria 737
195 Ga0373943_0099873 3300035170 Bacteria 1516
196 Ga0373943_0516681 3300035170 Bacteria 699
197 Ga0373946_0043590 3300035171 Bacteria 1849
198 Ga0373935_0161554 3300035692 Unclassified 1527
199 Ga0373927_0000825 3300035695 Bacteria 23699
200 Ga0373947_0148403 3300035725 Bacteria 1509
201 Ga0373937_1007569 3300036401 Bacteria 782
202 Ga0373925_0000100 3300037068 Bacteria 93457
203 Ga0395899_0000178 3300037312 Bacteria 93671
204 Ga0395899_0015074 3300037312 Bacteria 5891
205 Ga0395899_0230043 3300037312 Bacteria 1280
206 Ga0395899_0295417 3300037312 Bacteria 1098
207 Ga0395899_0360437 3300037312 Bacteria 970
208 Ga0395899_0753550 3300037312 Bacteria 606
209 Ga0395900_0001522 3300037418 Bacteria 27543
210 Ga0395900_0006150 3300037418 Bacteria 12531
211 Ga0395900_0098796 3300037418 Bacteria 2999
212 Ga0395900_0182407 3300037418 Bacteria 2132
213 Ga0395900_0464790 3300037418 Bacteria 1219
214 Ga0395900_1155804 3300037418 Bacteria 690
215 Ga0395898_0006429 3300037466 Bacteria 12549
216 Ga0395898_0011470 3300037466 Bacteria 9202
217 Ga0395898_0150771 3300037466 Bacteria 2224
218 Ga0395898_0345684 3300037466 Bacteria 1418
219 Ga0395898_0496166 3300037466 Bacteria 1161
220 Ga0395898_0503410 3300037466 Bacteria 1152
221 Ga0395898_0642537 3300037466 Bacteria 1003
222 Ga0395905_0010228 3300037471 Bacteria 9143
223 Ga0395905_0058953 3300037471 Bacteria 3589
224 Ga0395905_0320687 3300037471 Bacteria 1439
225 Ga0395905_0324405 3300037471 Bacteria 1430
226 Ga0395905_0482663 3300037471 Bacteria 1139
227 Ga0395905_0500448 3300037471 Bacteria 1115
228 Ga0395905_0617494 3300037471 Unclassified 986
229 Ga0395905_1163211 3300037471 Bacteria 675
230 Ga0395905_1219377 3300037471 Unclassified 656
231 Ga0395901_0000001 3300038443 Bacteria 800383
232 Ga0395901_0010783 3300038443 Bacteria 9262
233 Ga0395901_0178811 3300038443 Bacteria 2225
234 Ga0395901_0702615 3300038443 Bacteria 1009
235 Ga0395901_0722608 3300038443 Bacteria 991
236 Ga0395901_0794903 3300038443 Bacteria 935
237 Ga0395901_0970247 3300038443 Bacteria 827
238 Ga0466965_0229254 3300044683 Bacteria 992
239 Ga0466966_0382812 3300044684 Bacteria 845
240 Ga0466961_0130245 3300044693 Bacteria 1577
241 Ga0466964_0727493 3300044706 Bacteria 555
242 Ga0453684_1078556 3300044712 Bacteria 850
243 Ga0466960_0532976 3300044901 Bacteria 691
244 Ga0495650_0232275 3300046471 Unclassified 632
245 Ga0495583_0173786 3300046506 Unclassified 884
246 Ga0495643_0411808 3300046522 Unclassified 594
247 Ga0495642_0160790 3300046528 Bacteria 974
248 Ga0495621_0056882 3300046539 Bacteria 1411
249 Ga0495597_0214603 3300046542 Bacteria 766
250 Ga0495668_0089258 3300046616 Bacteria 1689
251 Ga0495668_0206226 3300046616 Bacteria 1076
252 Ga0495668_0358218 3300046616 Bacteria 801
253 Ga0495668_0643897 3300046616 Unclassified 586
254 Ga0495668_0795519 3300046616 Bacteria 524
255 Ga0495611_0527507 3300046648 Bacteria 535
256 Ga0495625_0015429 3300046660 Bacteria 6051
257 Ga0495588_0416206 3300046674 Bacteria 705
258 Ga0495669_0001811 3300046684 Bacteria 8736
259 Ga0495669_0133675 3300046684 Bacteria 1169
260 Ga0495672_0010801 3300047320 Bacteria 6481
261 Ga0495685_143799 3300047447 Archaea 776
262 Ga0495686_0006376 3300047472 Bacteria 9049
263 Ga0496101_0385528 3300048904 Unclassified 1103
264 Ga0496112_0161590 3300048915 Bacteria 2207
265 Ga0496112_0231813 3300048915 Bacteria 1801
266 Ga0496115_0003565 3300048918 Bacteria 11196
267 Ga0501034_0311109 3300049571 Bacteria 1510
268 Ga0501037_0116160 3300049573 Bacteria 1926
269 Ga0501047_0005115 3300049581 Bacteria 12305
270 Ga0501047_0041799 3300049581 Bacteria 4429
271 Ga0501047_0409760 3300049581 Bacteria 1188
272 Ga0501048_0579569 3300049582 Bacteria 805
273 Ga0501048_1315608 3300049582 Bacteria 520
274 Ga0501083_1095804 3300049744 Bacteria 518
275 Ga0501035_0443881 3300049822 Bacteria 1074
276 Ga0501035_0888786 3300049822 Bacteria 706
277 Ga0501044_0004477 3300049823 Bacteria 15619
278 Ga0501044_1610501 3300049823 Bacteria 514
279 nmdc:mga03683_93278_c1 3300050489 Bacteria 891
280 nmdc:mga0k408_750795_c1 3300050493 Bacteria 570
281 nmdc:mga07m45_267094_c1 3300050496 Unclassified 995
282 Ga0500562_004266 3300053108 Bacteria 3617
283 Ga0500594_0024996 3300053118 Bacteria 1527
284 Ga0500595_004036 3300053119 Bacteria 6692
285 Ga0500645_000932 3300053730 Bacteria 16738
286 Ga0466962_0360971 3300061719 Bacteria 724

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0116160 Ga0501037_0116160_1602_1793 56
2 3300049822 Ga0501035_0443881 Ga0501035_0443881_459_650 56
3 3300049823 Ga0501044_0004477 Ga0501044_0004477_9874_10065 56
4 3300005327 Ga0070658_10061818 Ga0070658_100618183 63
5 3300005329 Ga0070683_100963003 Ga0070683_1009630032 63
6 3300005336 Ga0070680_100922215 Ga0070680_1009222152 63
7 3300005366 Ga0070659_101771723 Ga0070659_1017717231 63
8 3300005530 Ga0070679_100263674 Ga0070679_1002636744 63
9 3300005530 Ga0070679_101147454 Ga0070679_1011474541 63
10 3300005548 Ga0070665_100730349 Ga0070665_1007303493 63
11 3300005563 Ga0068855_100075266 Ga0068855_1000752662 63
12 3300005563 Ga0068855_100865241 Ga0068855_1008652412 63
13 3300005617 Ga0068859_100842706 Ga0068859_1008427063 63
14 3300005618 Ga0068864_101407539 Ga0068864_1014075392 63
15 3300005719 Ga0068861_101420736 Ga0068861_1014207362 63
16 3300005841 Ga0068863_100137297 Ga0068863_1001372973 63
17 3300005842 Ga0068858_100271054 Ga0068858_1002710542 63
18 3300005842 Ga0068858_101190470 Ga0068858_1011904701 63
19 3300006931 Ga0097620_100842804 Ga0097620_1008428041 63
20 3300009093 Ga0105240_10067133 Ga0105240_100671332 63
21 3300009093 Ga0105240_10075185 Ga0105240_100751852 63
22 3300009551 Ga0105238_10941941 Ga0105238_109419413 63
23 3300009551 Ga0105238_11035027 Ga0105238_110350272 63
24 3300025913 Ga0207695_10318548 Ga0207695_103185483 63
25 3300025917 Ga0207660_11609707 Ga0207660_116097072 63
26 3300025921 Ga0207652_11274959 Ga0207652_112749592 63
27 3300025924 Ga0207694_10646195 Ga0207694_106461952 63
28 3300025924 Ga0207694_10778493 Ga0207694_107784931 63
29 3300025932 Ga0207690_11633030 Ga0207690_116330301 63
30 3300025949 Ga0207667_10074611 Ga0207667_100746116 63
31 3300025949 Ga0207667_10384383 Ga0207667_103843833 63
32 3300026035 Ga0207703_10258045 Ga0207703_102580452 63
33 3300026078 Ga0207702_11277566 Ga0207702_112775662 63
34 3300026095 Ga0207676_11855910 Ga0207676_118559102 63
35 3300028379 Ga0268266_10963682 Ga0268266_109636823 63
36 3300031456 Ga0307513_10013559 Ga0307513_100135597 63
37 3300031456 Ga0307513_10060816 Ga0307513_100608166 63
38 3300033180 Ga0307510_10080734 Ga0307510_100807342 63
39 3300035115 Ga0373941_0214883 Ga0373941_0214883_301_498 63
40 3300035170 Ga0373943_0516681 Ga0373943_0516681_55_252 63
41 3300035692 Ga0373935_0161554 Ga0373935_0161554_727_924 63
42 3300035725 Ga0373947_0148403 Ga0373947_0148403_226_423 63
43 3300037312 Ga0395899_0000178 Ga0395899_0000178_18814_19011 63
44 3300037312 Ga0395899_0230043 Ga0395899_0230043_65_262 63
45 3300037312 Ga0395899_0295417 Ga0395899_0295417_145_342 63
46 3300037312 Ga0395899_0360437 Ga0395899_0360437_176_373 63
47 3300037312 Ga0395899_0753550 Ga0395899_0753550_33_230 63
48 3300037418 Ga0395900_0001522 Ga0395900_0001522_13988_14185 63
49 3300037418 Ga0395900_0098796 Ga0395900_0098796_48_245 63
50 3300037418 Ga0395900_0182407 Ga0395900_0182407_1447_1644 63
51 3300037418 Ga0395900_0464790 Ga0395900_0464790_364_561 63
52 3300037418 Ga0395900_1155804 Ga0395900_1155804_457_654 63
53 3300037466 Ga0395898_0006429 Ga0395898_0006429_186_383 63
54 3300037466 Ga0395898_0150771 Ga0395898_0150771_598_795 63
55 3300037466 Ga0395898_0345684 Ga0395898_0345684_278_475 63
56 3300037466 Ga0395898_0503410 Ga0395898_0503410_530_727 63
57 3300037466 Ga0395898_0642537 Ga0395898_0642537_598_795 63
58 3300037471 Ga0395905_0010228 Ga0395905_0010228_314_511 63
59 3300037471 Ga0395905_0058953 Ga0395905_0058953_2214_2450 63
60 3300037471 Ga0395905_0320687 Ga0395905_0320687_1037_1234 63
61 3300037471 Ga0395905_0500448 Ga0395905_0500448_796_993 63
62 3300037471 Ga0395905_1163211 Ga0395905_1163211_235_432 63
63 3300038443 Ga0395901_0000001 Ga0395901_0000001_29820_30017 63
64 3300038443 Ga0395901_0178811 Ga0395901_0178811_1470_1667 63
65 3300038443 Ga0395901_0702615 Ga0395901_0702615_211_408 63
66 3300038443 Ga0395901_0722608 Ga0395901_0722608_37_234 63
67 3300038443 Ga0395901_0794903 Ga0395901_0794903_563_760 63
68 3300038443 Ga0395901_0970247 Ga0395901_0970247_373_570 63
69 3300044683 Ga0466965_0229254 Ga0466965_0229254_519_716 63
70 3300044684 Ga0466966_0382812 Ga0466966_0382812_627_824 63
71 3300044693 Ga0466961_0130245 Ga0466961_0130245_679_876 63
72 3300044706 Ga0466964_0727493 Ga0466964_0727493_201_398 63
73 3300046616 Ga0495668_0643897 Ga0495668_0643897_74_283 63
74 3300046674 Ga0495588_0416206 Ga0495588_0416206_261_458 63
75 3300046684 Ga0495669_0001811 Ga0495669_0001811_849_1046 63
76 3300048915 Ga0496112_0231813 Ga0496112_0231813_755_952 63
77 3300049571 Ga0501034_0311109 Ga0501034_0311109_1179_1373 63
78 3300049581 Ga0501047_0041799 Ga0501047_0041799_3916_4113 63
79 3300049581 Ga0501047_0409760 Ga0501047_0409760_249_449 63
80 3300049582 Ga0501048_0579569 Ga0501048_0579569_545_742 63
81 3300049582 Ga0501048_1315608 Ga0501048_1315608_175_372 63
82 3300049822 Ga0501035_0888786 Ga0501035_0888786_405_602 63
83 3300003794 Ga0055531_10007409 Ga0055531_100074099 64
84 3300005262 Ga0065165_1009640 Ga0065165_10096403 64
85 3300005327 Ga0070658_10126680 Ga0070658_101266804 64
86 3300005329 Ga0070683_101407711 Ga0070683_1014077112 64
87 3300005335 Ga0070666_10693613 Ga0070666_106936132 64
88 3300005335 Ga0070666_11448541 Ga0070666_114485411 64
89 3300005336 Ga0070680_100046508 Ga0070680_1000465082 64
90 3300005339 Ga0070660_100083290 Ga0070660_1000832902 64
91 3300005339 Ga0070660_100119790 Ga0070660_1001197903 64
92 3300005344 Ga0070661_100331672 Ga0070661_1003316722 64
93 3300005344 Ga0070661_100844160 Ga0070661_1008441601 64
94 3300005347 Ga0070668_100003309 Ga0070668_1000033094 64
95 3300005347 Ga0070668_100059345 Ga0070668_1000593454 64
96 3300005347 Ga0070668_100723679 Ga0070668_1007236792 64
97 3300005355 Ga0070671_100364853 Ga0070671_1003648532 64
98 3300005366 Ga0070659_100004474 Ga0070659_10000447410 64
99 3300005366 Ga0070659_100637327 Ga0070659_1006373273 64
100 3300005367 Ga0070667_100063981 Ga0070667_1000639814 64
101 3300005458 Ga0070681_10041486 Ga0070681_100414861 64
102 3300005458 Ga0070681_10152792 Ga0070681_101527923 64
103 3300005468 Ga0070707_101301585 Ga0070707_1013015851 64
104 3300005530 Ga0070679_100012037 Ga0070679_1000120377 64
105 3300005539 Ga0068853_100426738 Ga0068853_1004267383 64
106 3300005539 Ga0068853_100734250 Ga0068853_1007342502 64
107 3300005548 Ga0070665_100000015 Ga0070665_100000015109 64
108 3300005548 Ga0070665_100013799 Ga0070665_10001379910 64
109 3300005564 Ga0070664_100547372 Ga0070664_1005473722 64
110 3300005578 Ga0068854_100911842 Ga0068854_1009118423 64
111 3300005578 Ga0068854_101323344 Ga0068854_1013233442 64
112 3300005614 Ga0068856_100537482 Ga0068856_1005374822 64
113 3300005616 Ga0068852_100555000 Ga0068852_1005550003 64
114 3300005617 Ga0068859_100368134 Ga0068859_1003681341 64
115 3300005617 Ga0068859_100391418 Ga0068859_1003914182 64
116 3300005617 Ga0068859_102605145 Ga0068859_1026051452 64
117 3300005618 Ga0068864_100084763 Ga0068864_1000847632 64
118 3300005618 Ga0068864_101288855 Ga0068864_1012888552 64
119 3300005719 Ga0068861_100428539 Ga0068861_1004285393 64
120 3300005834 Ga0068851_10555444 Ga0068851_105554442 64
121 3300005841 Ga0068863_100199814 Ga0068863_1001998142 64
122 3300005841 Ga0068863_100896512 Ga0068863_1008965122 64
123 3300005843 Ga0068860_100000165 Ga0068860_100000165106 64
124 3300005844 Ga0068862_100006415 Ga0068862_10000641513 64
125 3300005844 Ga0068862_100188773 Ga0068862_1001887734 64
126 3300005844 Ga0068862_100387725 Ga0068862_1003877253 64
127 3300005844 Ga0068862_101092317 Ga0068862_1010923172 64
128 3300006177 Ga0075362_10050826 Ga0075362_100508263 64
129 3300006237 Ga0097621_101608873 Ga0097621_1016088731 64
130 3300006881 Ga0068865_100015236 Ga0068865_1000152366 64
131 3300006931 Ga0097620_100368132 Ga0097620_1003681321 64
132 3300006931 Ga0097620_100391442 Ga0097620_1003914422 64
133 3300006931 Ga0097620_102605912 Ga0097620_1026059121 64
134 3300009093 Ga0105240_10056296 Ga0105240_100562961 64
135 3300009093 Ga0105240_10506621 Ga0105240_105066213 64
136 3300009093 Ga0105240_11288601 Ga0105240_112886012 64
137 3300009098 Ga0105245_10100268 Ga0105245_101002683 64
138 3300009098 Ga0105245_12812396 Ga0105245_128123962 64
139 3300009176 Ga0105242_10616484 Ga0105242_106164843 64
140 3300009177 Ga0105248_10020343 Ga0105248_100203432 64
141 3300009177 Ga0105248_12309807 Ga0105248_123098072 64
142 3300009545 Ga0105237_10409695 Ga0105237_104096953 64
143 3300009551 Ga0105238_10022500 Ga0105238_100225002 64
144 3300009551 Ga0105238_10127049 Ga0105238_101270493 64
145 3300009551 Ga0105238_10369282 Ga0105238_103692822 64
146 3300009553 Ga0105249_11324141 Ga0105249_113241412 64
147 3300009553 Ga0105249_12462192 Ga0105249_124621922 64
148 3300010375 Ga0105239_12712383 Ga0105239_127123832 64
149 3300010375 Ga0105239_13138766 Ga0105239_131387662 64
150 3300013104 Ga0157370_10086290 Ga0157370_100862903 64
151 3300013296 Ga0157374_10801535 Ga0157374_108015352 64
152 3300013306 Ga0163162_10603185 Ga0163162_106031852 64
153 3300014325 Ga0163163_10034486 Ga0163163_100344863 64
154 3300014325 Ga0163163_10720409 Ga0163163_107204093 64
155 3300014325 Ga0163163_11143399 Ga0163163_111433992 64
156 3300025250 Ga0209026_1001557 Ga0209026_10015575 64
157 3300025304 Ga0209257_1003465 Ga0209257_100346510 64
158 3300025903 Ga0207680_10900959 Ga0207680_109009592 64
159 3300025909 Ga0207705_10187317 Ga0207705_101873172 64
160 3300025909 Ga0207705_10258148 Ga0207705_102581482 64
161 3300025912 Ga0207707_10126506 Ga0207707_101265063 64
162 3300025913 Ga0207695_10000876 Ga0207695_1000087651 64
163 3300025913 Ga0207695_10022127 Ga0207695_100221276 64
164 3300025913 Ga0207695_10119553 Ga0207695_101195533 64
165 3300025913 Ga0207695_10588488 Ga0207695_105884882 64
166 3300025919 Ga0207657_10026754 Ga0207657_100267542 64
167 3300025919 Ga0207657_10056201 Ga0207657_100562016 64
168 3300025920 Ga0207649_11357105 Ga0207649_113571052 64
169 3300025921 Ga0207652_10105042 Ga0207652_101050423 64
170 3300025923 Ga0207681_10995815 Ga0207681_109958151 64
171 3300025924 Ga0207694_10117226 Ga0207694_101172262 64
172 3300025924 Ga0207694_10242418 Ga0207694_102424181 64
173 3300025924 Ga0207694_10363876 Ga0207694_103638763 64
174 3300025925 Ga0207650_10185694 Ga0207650_101856942 64
175 3300025927 Ga0207687_10091824 Ga0207687_100918242 64
176 3300025931 Ga0207644_10330099 Ga0207644_103300992 64
177 3300025931 Ga0207644_10415581 Ga0207644_104155812 64
178 3300025932 Ga0207690_10000111 Ga0207690_1000011153 64
179 3300025934 Ga0207686_10398317 Ga0207686_103983173 64
180 3300025938 Ga0207704_10001481 Ga0207704_100014816 64
181 3300025945 Ga0207679_10520555 Ga0207679_105205551 64
182 3300025949 Ga0207667_10222401 Ga0207667_102224013 64
183 3300025961 Ga0207712_10567451 Ga0207712_105674513 64
184 3300025972 Ga0207668_10002257 Ga0207668_1000225713 64
185 3300025972 Ga0207668_10156040 Ga0207668_101560402 64
186 3300025972 Ga0207668_11005179 Ga0207668_110051792 64
187 3300025981 Ga0207640_10948246 Ga0207640_109482462 64
188 3300025986 Ga0207658_10048305 Ga0207658_100483052 64
189 3300026023 Ga0207677_11698325 Ga0207677_116983252 64
190 3300026041 Ga0207639_10532762 Ga0207639_105327622 64
191 3300026041 Ga0207639_10576544 Ga0207639_105765442 64
192 3300026078 Ga0207702_10251946 Ga0207702_102519462 64
193 3300026088 Ga0207641_10596629 Ga0207641_105966292 64
194 3300026088 Ga0207641_10921909 Ga0207641_109219093 64
195 3300026095 Ga0207676_10067025 Ga0207676_100670252 64
196 3300026095 Ga0207676_10302523 Ga0207676_103025233 64
197 3300026095 Ga0207676_12089576 Ga0207676_120895761 64
198 3300026116 Ga0207674_10781153 Ga0207674_107811532 64
199 3300026118 Ga0207675_101690990 Ga0207675_1016909901 64
200 3300026142 Ga0207698_10485771 Ga0207698_104857712 64
201 3300027378 Ga0209981_1001311 Ga0209981_10013115 64
202 3300027665 Ga0209983_1013948 Ga0209983_10139482 64
203 3300028379 Ga0268266_10000005 Ga0268266_100000051008 64
204 3300028379 Ga0268266_11553619 Ga0268266_115536192 64
205 3300028380 Ga0268265_10000867 Ga0268265_1000086713 64
206 3300028380 Ga0268265_10099851 Ga0268265_100998514 64
207 3300028380 Ga0268265_10171282 Ga0268265_101712822 64
208 3300028381 Ga0268264_10000021 Ga0268264_10000021208 64
209 3300028786 Ga0307517_10001415 Ga0307517_100014159 64
210 3300028786 Ga0307517_10123814 Ga0307517_101238143 64
211 3300031456 Ga0307513_10013193 Ga0307513_100131933 64
212 3300031456 Ga0307513_11004628 Ga0307513_110046281 64
213 3300031731 Ga0307405_11224614 Ga0307405_112246142 64
214 3300032005 Ga0307411_10861090 Ga0307411_108610902 64
215 3300036401 Ga0373937_1007569 Ga0373937_1007569_339_536 64
216 3300037312 Ga0395899_0015074 Ga0395899_0015074_2810_3010 64
217 3300037418 Ga0395900_0006150 Ga0395900_0006150_6510_6710 64
218 3300037466 Ga0395898_0011470 Ga0395898_0011470_6630_6830 64
219 3300037471 Ga0395905_0482663 Ga0395905_0482663_411_656 64
220 3300038443 Ga0395901_0010783 Ga0395901_0010783_1831_2031 64
221 3300044712 Ga0453684_1078556 Ga0453684_1078556_81_275 64
222 3300046471 Ga0495650_0232275 Ga0495650_0232275_48_260 64
223 3300046506 Ga0495583_0173786 Ga0495583_0173786_386_589 64
224 3300046528 Ga0495642_0160790 Ga0495642_0160790_14_217 64
225 3300046542 Ga0495597_0214603 Ga0495597_0214603_331_528 64
226 3300046616 Ga0495668_0206226 Ga0495668_0206226_343_540 64
227 3300046616 Ga0495668_0795519 Ga0495668_0795519_50_247 64
228 3300046648 Ga0495611_0527507 Ga0495611_0527507_320_523 64
229 3300046660 Ga0495625_0015429 Ga0495625_0015429_2158_2355 64
230 3300046684 Ga0495669_0133675 Ga0495669_0133675_278_481 64
231 3300047320 Ga0495672_0010801 Ga0495672_0010801_934_1131 64
232 3300047447 Ga0495685_143799 Ga0495685_143799_251_454 64
233 3300047472 Ga0495686_0006376 Ga0495686_0006376_2461_2658 64
234 3300048904 Ga0496101_0385528 Ga0496101_0385528_209_406 64
235 3300048915 Ga0496112_0161590 Ga0496112_0161590_1688_1885 64
236 3300048918 Ga0496115_0003565 Ga0496115_0003565_7279_7476 64
237 3300049581 Ga0501047_0005115 Ga0501047_0005115_2522_2719 64
238 3300049744 Ga0501083_1095804 Ga0501083_1095804_47_244 64
239 3300049823 Ga0501044_1610501 Ga0501044_1610501_264_461 64
240 3300050489 nmdc:mga03683_93278_c1 nmdc:mga03683_93278_c1_98_325 64
241 3300050493 nmdc:mga0k408_750795_c1 nmdc:mga0k408_750795_c1_103_300 64
242 3300053108 Ga0500562_004266 Ga0500562_004266_167_364 64
243 3300053118 Ga0500594_0024996 Ga0500594_0024996_907_1104 64
244 3300053730 Ga0500645_000932 Ga0500645_000932_10070_10267 64
245 3300003215 JGI25153J46596_10103957 JGI25153J46596_101039572 65
246 3300003791 Ga0055530_10001503 Ga0055530_1000150312 65
247 3300003794 Ga0055531_10005447 Ga0055531_100054473 65
248 3300005262 Ga0065165_1000103 Ga0065165_1000103106 65
249 3300005327 Ga0070658_10035733 Ga0070658_100357337 65
250 3300005336 Ga0070680_100251671 Ga0070680_1002516713 65
251 3300005339 Ga0070660_100265068 Ga0070660_1002650683 65
252 3300005456 Ga0070678_100665944 Ga0070678_1006659441 65
253 3300005471 Ga0070698_102061602 Ga0070698_1020616021 65
254 3300005530 Ga0070679_100000814 Ga0070679_1000008142 65
255 3300005563 Ga0068855_100428702 Ga0068855_1004287023 65
256 3300005577 Ga0068857_100881829 Ga0068857_1008818293 65
257 3300009093 Ga0105240_10000671 Ga0105240_1000067151 65
258 3300025297 Ga0209758_1005267 Ga0209758_10052673 65
259 3300025298 Ga0209050_1000038 Ga0209050_1000038223 65
260 3300025304 Ga0209257_1000138 Ga0209257_1000138113 65
261 3300025909 Ga0207705_10182970 Ga0207705_101829703 65
262 3300025913 Ga0207695_10002095 Ga0207695_1000209510 65
263 3300025917 Ga0207660_10215519 Ga0207660_102155193 65
264 3300025919 Ga0207657_10221852 Ga0207657_102218523 65
265 3300025921 Ga0207652_10082123 Ga0207652_100821233 65
266 3300026035 Ga0207703_12007551 Ga0207703_120075512 65
267 3300026118 Ga0207675_100998182 Ga0207675_1009981821 65
268 3300026121 Ga0207683_12166247 Ga0207683_121662472 65
269 3300030521 Ga0307511_10005612 Ga0307511_1000561216 65
270 3300035089 Ga0373944_0033881 Ga0373944_0033881_661_891 65
271 3300035170 Ga0373943_0099873 Ga0373943_0099873_1070_1300 65
272 3300035171 Ga0373946_0043590 Ga0373946_0043590_671_901 65
273 3300035695 Ga0373927_0000825 Ga0373927_0000825_2826_3056 65
274 3300037068 Ga0373925_0000100 Ga0373925_0000100_70236_70466 65
275 3300037466 Ga0395898_0496166 Ga0395898_0496166_849_1049 65
276 3300037471 Ga0395905_0324405 Ga0395905_0324405_750_947 65
277 3300037471 Ga0395905_0617494 Ga0395905_0617494_514_711 65
278 3300037471 Ga0395905_1219377 Ga0395905_1219377_349_546 65
279 3300044901 Ga0466960_0532976 Ga0466960_0532976_25_222 65
280 3300046522 Ga0495643_0411808 Ga0495643_0411808_35_247 65
281 3300046539 Ga0495621_0056882 Ga0495621_0056882_181_408 65
282 3300046616 Ga0495668_0089258 Ga0495668_0089258_67_273 65
283 3300046616 Ga0495668_0358218 Ga0495668_0358218_285_491 65
284 3300050496 nmdc:mga07m45_267094_c1 nmdc:mga07m45_267094_c1_129_341 65
285 3300053119 Ga0500595_004036 Ga0500595_004036_1188_1394 65
286 3300061719 Ga0466962_0360971 Ga0466962_0360971_495_695 65

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p2c-assembly1.cif.gz_B crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution 0.9424 23 58
2p0v-assembly1.cif.gz_B crystal structure of bt3781 protein from bacteroides thetaiotaomicron, northeast structural genomics target btr58 0.9381 23 58
3on6-assembly1.cif.gz_B crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution 0.9211 23 61
3on6-assembly1.cif.gz_B crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution 0.565 23 61
3lwu-assembly1.cif.gz_A crystal structure of putative succinylglutamate desuccinylase/aspartoacylase (yp_749235.1) from shewanella frigidimarina ncimb 400 at 2.10 a resolution 0.5572 4 58
ID Description Score Start End Superfamily
af_Q54KW6_95_356_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 1.006 27 58 1.25.40.10
af_Q4V890_271_439_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9856 24 58 1.25.40.10
af_Q54IX4_60_323_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9687 26 57 1.25.40.10
3p2cB01 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.9423 23 58 1.50.10.10
af_Q75JR6_1322_1544_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9056 28 64 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A516NLL0-F1-model_v4 DoxX family protein 0.9807 24 59 GO:0016020
AF-A0A7V1WS33-F1-model_v4 Uncharacterized protein 0.9538 24 58 GO:0016020
AF-A0A7L9C1V9-F1-model_v4 Uncharacterized protein 0.9222 18 59 GO:0016020
AF-A0A6N2CNG9-F1-model_v4 Four helix bundle protein 0.9212 22 64
AF-A0A2U0AI25-F1-model_v4 Cation/multidrug efflux pump 0.8966 26 59

Feature Viewer

pLDDT pTM Quality
86.3 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map