F387209
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 286 | 150 | 286 | 66 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10035733|Ga0070658_100357337 |
| Length | 77 |
| Sequence | MSSAPDEDAAAIVARALSRRPAKARPRFLRELLAHTAAGLVVIEGERAAGEAVYRLADAVVARGGRRPCGFRDTGRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 3 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 4 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 53 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 94 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 95 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 96 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 97 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 98 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 99 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 100 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 101 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 102 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 103 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 104 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 105 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 106 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 111 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 114 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 115 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 116 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 117 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 118 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 119 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 135 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 136 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 144 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 145 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 146 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 147 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 148 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 149 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 150 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.29 |
| Nodule | 0 |
| Rhizoplane | 1.4 |
| Rhizosphere | 89.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10103957 | 3300003215 | Bacteria | 663 |
| 2 | Ga0055530_10001503 | 3300003791 | Bacteria | 16904 |
| 3 | Ga0055531_10005447 | 3300003794 | Bacteria | 7450 |
| 4 | Ga0055531_10007409 | 3300003794 | Bacteria | 5998 |
| 5 | Ga0065165_1000103 | 3300005262 | Bacteria | 140705 |
| 6 | Ga0065165_1009640 | 3300005262 | Bacteria | 4295 |
| 7 | Ga0070658_10035733 | 3300005327 | Bacteria | 4003 |
| 8 | Ga0070658_10061818 | 3300005327 | Bacteria | 3051 |
| 9 | Ga0070658_10126680 | 3300005327 | Bacteria | 2126 |
| 10 | Ga0070683_100963003 | 3300005329 | Bacteria | 819 |
| 11 | Ga0070683_101407711 | 3300005329 | Unclassified | 670 |
| 12 | Ga0070666_10693613 | 3300005335 | Bacteria | 746 |
| 13 | Ga0070666_11448541 | 3300005335 | Unclassified | 513 |
| 14 | Ga0070680_100046508 | 3300005336 | Bacteria | 3531 |
| 15 | Ga0070680_100251671 | 3300005336 | Bacteria | 1494 |
| 16 | Ga0070680_100922215 | 3300005336 | Bacteria | 754 |
| 17 | Ga0070660_100083290 | 3300005339 | Bacteria | 2513 |
| 18 | Ga0070660_100119790 | 3300005339 | Bacteria | 2100 |
| 19 | Ga0070660_100265068 | 3300005339 | Unclassified | 1403 |
| 20 | Ga0070661_100331672 | 3300005344 | Bacteria | 1190 |
| 21 | Ga0070661_100844160 | 3300005344 | Bacteria | 753 |
| 22 | Ga0070668_100003309 | 3300005347 | Bacteria | 11887 |
| 23 | Ga0070668_100059345 | 3300005347 | Bacteria | 2961 |
| 24 | Ga0070668_100723679 | 3300005347 | Bacteria | 879 |
| 25 | Ga0070671_100364853 | 3300005355 | Bacteria | 1233 |
| 26 | Ga0070659_100004474 | 3300005366 | Bacteria | 9987 |
| 27 | Ga0070659_100637327 | 3300005366 | Unclassified | 918 |
| 28 | Ga0070659_101771723 | 3300005366 | Bacteria | 553 |
| 29 | Ga0070667_100063981 | 3300005367 | Bacteria | 3119 |
| 30 | Ga0070678_100665944 | 3300005456 | Bacteria | 935 |
| 31 | Ga0070681_10041486 | 3300005458 | Bacteria | 4612 |
| 32 | Ga0070681_10152792 | 3300005458 | Bacteria | 2234 |
| 33 | Ga0070707_101301585 | 3300005468 | Unclassified | 693 |
| 34 | Ga0070698_102061602 | 3300005471 | Bacteria | 524 |
| 35 | Ga0070679_100000814 | 3300005530 | Bacteria | 27054 |
| 36 | Ga0070679_100012037 | 3300005530 | Bacteria | 8257 |
| 37 | Ga0070679_100263674 | 3300005530 | Bacteria | 1678 |
| 38 | Ga0070679_101147454 | 3300005530 | Bacteria | 722 |
| 39 | Ga0068853_100426738 | 3300005539 | Bacteria | 1244 |
| 40 | Ga0068853_100734250 | 3300005539 | Unclassified | 943 |
| 41 | Ga0070665_100000015 | 3300005548 | Bacteria | 462744 |
| 42 | Ga0070665_100013799 | 3300005548 | Bacteria | 8127 |
| 43 | Ga0070665_100730349 | 3300005548 | Bacteria | 1003 |
| 44 | Ga0068855_100075266 | 3300005563 | Bacteria | 3921 |
| 45 | Ga0068855_100428702 | 3300005563 | Bacteria | 1446 |
| 46 | Ga0068855_100865241 | 3300005563 | Bacteria | 957 |
| 47 | Ga0070664_100547372 | 3300005564 | Unclassified | 1070 |
| 48 | Ga0068857_100881829 | 3300005577 | Bacteria | 857 |
| 49 | Ga0068854_100911842 | 3300005578 | Bacteria | 773 |
| 50 | Ga0068854_101323344 | 3300005578 | Unclassified | 649 |
| 51 | Ga0068856_100537482 | 3300005614 | Bacteria | 1190 |
| 52 | Ga0068852_100555000 | 3300005616 | Bacteria | 1149 |
| 53 | Ga0068859_100368134 | 3300005617 | Bacteria | 1532 |
| 54 | Ga0068859_100391418 | 3300005617 | Bacteria | 1486 |
| 55 | Ga0068859_100842706 | 3300005617 | Bacteria | 1003 |
| 56 | Ga0068859_102605145 | 3300005617 | Unclassified | 556 |
| 57 | Ga0068864_100084763 | 3300005618 | Bacteria | 2785 |
| 58 | Ga0068864_101288855 | 3300005618 | Bacteria | 731 |
| 59 | Ga0068864_101407539 | 3300005618 | Unclassified | 699 |
| 60 | Ga0068861_100428539 | 3300005719 | Bacteria | 1180 |
| 61 | Ga0068861_101420736 | 3300005719 | Unclassified | 678 |
| 62 | Ga0068851_10555444 | 3300005834 | Bacteria | 694 |
| 63 | Ga0068863_100137297 | 3300005841 | Bacteria | 2336 |
| 64 | Ga0068863_100199814 | 3300005841 | Bacteria | 1923 |
| 65 | Ga0068863_100896512 | 3300005841 | Unclassified | 887 |
| 66 | Ga0068858_100271054 | 3300005842 | Bacteria | 1615 |
| 67 | Ga0068858_101190470 | 3300005842 | Bacteria | 749 |
| 68 | Ga0068860_100000165 | 3300005843 | Bacteria | 108321 |
| 69 | Ga0068862_100006415 | 3300005844 | Bacteria | 9784 |
| 70 | Ga0068862_100188773 | 3300005844 | Bacteria | 1853 |
| 71 | Ga0068862_100387725 | 3300005844 | Unclassified | 1304 |
| 72 | Ga0068862_101092317 | 3300005844 | Bacteria | 792 |
| 73 | Ga0075362_10050826 | 3300006177 | Bacteria | 1854 |
| 74 | Ga0097621_101608873 | 3300006237 | Unclassified | 618 |
| 75 | Ga0068865_100015236 | 3300006881 | Bacteria | 4900 |
| 76 | Ga0097620_100368132 | 3300006931 | Bacteria | 1532 |
| 77 | Ga0097620_100391442 | 3300006931 | Bacteria | 1486 |
| 78 | Ga0097620_100842804 | 3300006931 | Bacteria | 1003 |
| 79 | Ga0097620_102605912 | 3300006931 | Unclassified | 556 |
| 80 | Ga0105240_10000671 | 3300009093 | Bacteria | 62794 |
| 81 | Ga0105240_10056296 | 3300009093 | Bacteria | 4921 |
| 82 | Ga0105240_10067133 | 3300009093 | Bacteria | 4446 |
| 83 | Ga0105240_10075185 | 3300009093 | Bacteria | 4167 |
| 84 | Ga0105240_10506621 | 3300009093 | Bacteria | 1341 |
| 85 | Ga0105240_11288601 | 3300009093 | Unclassified | 771 |
| 86 | Ga0105245_10100268 | 3300009098 | Bacteria | 2679 |
| 87 | Ga0105245_12812396 | 3300009098 | Bacteria | 539 |
| 88 | Ga0105242_10616484 | 3300009176 | Bacteria | 1050 |
| 89 | Ga0105248_10020343 | 3300009177 | Bacteria | 7353 |
| 90 | Ga0105248_12309807 | 3300009177 | Bacteria | 612 |
| 91 | Ga0105237_10409695 | 3300009545 | Bacteria | 1360 |
| 92 | Ga0105238_10022500 | 3300009551 | Bacteria | 6424 |
| 93 | Ga0105238_10127049 | 3300009551 | Bacteria | 2528 |
| 94 | Ga0105238_10369282 | 3300009551 | Bacteria | 1425 |
| 95 | Ga0105238_10941941 | 3300009551 | Bacteria | 883 |
| 96 | Ga0105238_11035027 | 3300009551 | Bacteria | 842 |
| 97 | Ga0105249_11324141 | 3300009553 | Unclassified | 792 |
| 98 | Ga0105249_12462192 | 3300009553 | Bacteria | 593 |
| 99 | Ga0105239_12712383 | 3300010375 | Bacteria | 578 |
| 100 | Ga0105239_13138766 | 3300010375 | Bacteria | 538 |
| 101 | Ga0157370_10086290 | 3300013104 | Bacteria | 2949 |
| 102 | Ga0157374_10801535 | 3300013296 | Bacteria | 958 |
| 103 | Ga0163162_10603185 | 3300013306 | Bacteria | 1224 |
| 104 | Ga0163163_10034486 | 3300014325 | Bacteria | 4902 |
| 105 | Ga0163163_10720409 | 3300014325 | Bacteria | 1061 |
| 106 | Ga0163163_11143399 | 3300014325 | Unclassified | 841 |
| 107 | Ga0209026_1001557 | 3300025250 | Bacteria | 9927 |
| 108 | Ga0209758_1005267 | 3300025297 | Bacteria | 10116 |
| 109 | Ga0209050_1000038 | 3300025298 | Bacteria | 412635 |
| 110 | Ga0209257_1000138 | 3300025304 | Bacteria | 204131 |
| 111 | Ga0209257_1003465 | 3300025304 | Bacteria | 13483 |
| 112 | Ga0207680_10900959 | 3300025903 | Bacteria | 634 |
| 113 | Ga0207705_10182970 | 3300025909 | Bacteria | 1582 |
| 114 | Ga0207705_10187317 | 3300025909 | Bacteria | 1564 |
| 115 | Ga0207705_10258148 | 3300025909 | Bacteria | 1330 |
| 116 | Ga0207707_10126506 | 3300025912 | Bacteria | 2235 |
| 117 | Ga0207695_10000876 | 3300025913 | Bacteria | 54758 |
| 118 | Ga0207695_10002095 | 3300025913 | Bacteria | 30360 |
| 119 | Ga0207695_10022127 | 3300025913 | Bacteria | 7229 |
| 120 | Ga0207695_10119553 | 3300025913 | Bacteria | 2604 |
| 121 | Ga0207695_10318548 | 3300025913 | Bacteria | 1445 |
| 122 | Ga0207695_10588488 | 3300025913 | Bacteria | 994 |
| 123 | Ga0207660_10215519 | 3300025917 | Bacteria | 1505 |
| 124 | Ga0207660_11609707 | 3300025917 | Bacteria | 523 |
| 125 | Ga0207657_10026754 | 3300025919 | Bacteria | 5293 |
| 126 | Ga0207657_10056201 | 3300025919 | Bacteria | 3396 |
| 127 | Ga0207657_10221852 | 3300025919 | Bacteria | 1514 |
| 128 | Ga0207649_11357105 | 3300025920 | Bacteria | 562 |
| 129 | Ga0207652_10082123 | 3300025921 | Bacteria | 2820 |
| 130 | Ga0207652_10105042 | 3300025921 | Bacteria | 2499 |
| 131 | Ga0207652_11274959 | 3300025921 | Bacteria | 637 |
| 132 | Ga0207681_10995815 | 3300025923 | Bacteria | 703 |
| 133 | Ga0207694_10117226 | 3300025924 | Bacteria | 2123 |
| 134 | Ga0207694_10242418 | 3300025924 | Bacteria | 1473 |
| 135 | Ga0207694_10363876 | 3300025924 | Bacteria | 1199 |
| 136 | Ga0207694_10646195 | 3300025924 | Bacteria | 891 |
| 137 | Ga0207694_10778493 | 3300025924 | Bacteria | 808 |
| 138 | Ga0207650_10185694 | 3300025925 | Bacteria | 1659 |
| 139 | Ga0207687_10091824 | 3300025927 | Bacteria | 2215 |
| 140 | Ga0207644_10330099 | 3300025931 | Bacteria | 1235 |
| 141 | Ga0207644_10415581 | 3300025931 | Bacteria | 1101 |
| 142 | Ga0207690_10000111 | 3300025932 | Bacteria | 66639 |
| 143 | Ga0207690_11633030 | 3300025932 | Bacteria | 539 |
| 144 | Ga0207686_10398317 | 3300025934 | Bacteria | 1048 |
| 145 | Ga0207704_10001481 | 3300025938 | Bacteria | 10521 |
| 146 | Ga0207679_10520555 | 3300025945 | Bacteria | 1064 |
| 147 | Ga0207667_10074611 | 3300025949 | Bacteria | 3523 |
| 148 | Ga0207667_10222401 | 3300025949 | Bacteria | 1934 |
| 149 | Ga0207667_10384383 | 3300025949 | Bacteria | 1430 |
| 150 | Ga0207712_10567451 | 3300025961 | Bacteria | 978 |
| 151 | Ga0207668_10002257 | 3300025972 | Bacteria | 11241 |
| 152 | Ga0207668_10156040 | 3300025972 | Bacteria | 1773 |
| 153 | Ga0207668_11005179 | 3300025972 | Bacteria | 745 |
| 154 | Ga0207640_10948246 | 3300025981 | Unclassified | 754 |
| 155 | Ga0207658_10048305 | 3300025986 | Bacteria | 3120 |
| 156 | Ga0207677_11698325 | 3300026023 | Unclassified | 585 |
| 157 | Ga0207703_10258045 | 3300026035 | Bacteria | 1574 |
| 158 | Ga0207703_12007551 | 3300026035 | Bacteria | 555 |
| 159 | Ga0207639_10532762 | 3300026041 | Bacteria | 1077 |
| 160 | Ga0207639_10576544 | 3300026041 | Bacteria | 1035 |
| 161 | Ga0207702_10251946 | 3300026078 | Bacteria | 1658 |
| 162 | Ga0207702_11277566 | 3300026078 | Unclassified | 728 |
| 163 | Ga0207641_10596629 | 3300026088 | Unclassified | 1081 |
| 164 | Ga0207641_10921909 | 3300026088 | Unclassified | 868 |
| 165 | Ga0207676_10067025 | 3300026095 | Bacteria | 2866 |
| 166 | Ga0207676_10302523 | 3300026095 | Bacteria | 1461 |
| 167 | Ga0207676_11855910 | 3300026095 | Unclassified | 601 |
| 168 | Ga0207676_12089576 | 3300026095 | Unclassified | 565 |
| 169 | Ga0207674_10781153 | 3300026116 | Bacteria | 922 |
| 170 | Ga0207675_100998182 | 3300026118 | Bacteria | 855 |
| 171 | Ga0207675_101690990 | 3300026118 | Unclassified | 653 |
| 172 | Ga0207683_12166247 | 3300026121 | Bacteria | 504 |
| 173 | Ga0207698_10485771 | 3300026142 | Bacteria | 1199 |
| 174 | Ga0209981_1001311 | 3300027378 | Bacteria | 3151 |
| 175 | Ga0209983_1013948 | 3300027665 | Bacteria | 1654 |
| 176 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 177 | Ga0268266_10963682 | 3300028379 | Bacteria | 825 |
| 178 | Ga0268266_11553619 | 3300028379 | Bacteria | 637 |
| 179 | Ga0268265_10000867 | 3300028380 | Bacteria | 28355 |
| 180 | Ga0268265_10099851 | 3300028380 | Bacteria | 2341 |
| 181 | Ga0268265_10171282 | 3300028380 | Unclassified | 1856 |
| 182 | Ga0268264_10000021 | 3300028381 | Bacteria | 481580 |
| 183 | Ga0307517_10001415 | 3300028786 | Bacteria | 40367 |
| 184 | Ga0307517_10123814 | 3300028786 | Bacteria | 1897 |
| 185 | Ga0307511_10005612 | 3300030521 | Bacteria | 12736 |
| 186 | Ga0307513_10013193 | 3300031456 | Bacteria | 10150 |
| 187 | Ga0307513_10013559 | 3300031456 | Bacteria | 9996 |
| 188 | Ga0307513_10060816 | 3300031456 | Bacteria | 4002 |
| 189 | Ga0307513_11004628 | 3300031456 | Bacteria | 544 |
| 190 | Ga0307405_11224614 | 3300031731 | Bacteria | 650 |
| 191 | Ga0307411_10861090 | 3300032005 | Bacteria | 802 |
| 192 | Ga0307510_10080734 | 3300033180 | Bacteria | 3160 |
| 193 | Ga0373944_0033881 | 3300035089 | Unclassified | 1549 |
| 194 | Ga0373941_0214883 | 3300035115 | Bacteria | 737 |
| 195 | Ga0373943_0099873 | 3300035170 | Bacteria | 1516 |
| 196 | Ga0373943_0516681 | 3300035170 | Bacteria | 699 |
| 197 | Ga0373946_0043590 | 3300035171 | Bacteria | 1849 |
| 198 | Ga0373935_0161554 | 3300035692 | Unclassified | 1527 |
| 199 | Ga0373927_0000825 | 3300035695 | Bacteria | 23699 |
| 200 | Ga0373947_0148403 | 3300035725 | Bacteria | 1509 |
| 201 | Ga0373937_1007569 | 3300036401 | Bacteria | 782 |
| 202 | Ga0373925_0000100 | 3300037068 | Bacteria | 93457 |
| 203 | Ga0395899_0000178 | 3300037312 | Bacteria | 93671 |
| 204 | Ga0395899_0015074 | 3300037312 | Bacteria | 5891 |
| 205 | Ga0395899_0230043 | 3300037312 | Bacteria | 1280 |
| 206 | Ga0395899_0295417 | 3300037312 | Bacteria | 1098 |
| 207 | Ga0395899_0360437 | 3300037312 | Bacteria | 970 |
| 208 | Ga0395899_0753550 | 3300037312 | Bacteria | 606 |
| 209 | Ga0395900_0001522 | 3300037418 | Bacteria | 27543 |
| 210 | Ga0395900_0006150 | 3300037418 | Bacteria | 12531 |
| 211 | Ga0395900_0098796 | 3300037418 | Bacteria | 2999 |
| 212 | Ga0395900_0182407 | 3300037418 | Bacteria | 2132 |
| 213 | Ga0395900_0464790 | 3300037418 | Bacteria | 1219 |
| 214 | Ga0395900_1155804 | 3300037418 | Bacteria | 690 |
| 215 | Ga0395898_0006429 | 3300037466 | Bacteria | 12549 |
| 216 | Ga0395898_0011470 | 3300037466 | Bacteria | 9202 |
| 217 | Ga0395898_0150771 | 3300037466 | Bacteria | 2224 |
| 218 | Ga0395898_0345684 | 3300037466 | Bacteria | 1418 |
| 219 | Ga0395898_0496166 | 3300037466 | Bacteria | 1161 |
| 220 | Ga0395898_0503410 | 3300037466 | Bacteria | 1152 |
| 221 | Ga0395898_0642537 | 3300037466 | Bacteria | 1003 |
| 222 | Ga0395905_0010228 | 3300037471 | Bacteria | 9143 |
| 223 | Ga0395905_0058953 | 3300037471 | Bacteria | 3589 |
| 224 | Ga0395905_0320687 | 3300037471 | Bacteria | 1439 |
| 225 | Ga0395905_0324405 | 3300037471 | Bacteria | 1430 |
| 226 | Ga0395905_0482663 | 3300037471 | Bacteria | 1139 |
| 227 | Ga0395905_0500448 | 3300037471 | Bacteria | 1115 |
| 228 | Ga0395905_0617494 | 3300037471 | Unclassified | 986 |
| 229 | Ga0395905_1163211 | 3300037471 | Bacteria | 675 |
| 230 | Ga0395905_1219377 | 3300037471 | Unclassified | 656 |
| 231 | Ga0395901_0000001 | 3300038443 | Bacteria | 800383 |
| 232 | Ga0395901_0010783 | 3300038443 | Bacteria | 9262 |
| 233 | Ga0395901_0178811 | 3300038443 | Bacteria | 2225 |
| 234 | Ga0395901_0702615 | 3300038443 | Bacteria | 1009 |
| 235 | Ga0395901_0722608 | 3300038443 | Bacteria | 991 |
| 236 | Ga0395901_0794903 | 3300038443 | Bacteria | 935 |
| 237 | Ga0395901_0970247 | 3300038443 | Bacteria | 827 |
| 238 | Ga0466965_0229254 | 3300044683 | Bacteria | 992 |
| 239 | Ga0466966_0382812 | 3300044684 | Bacteria | 845 |
| 240 | Ga0466961_0130245 | 3300044693 | Bacteria | 1577 |
| 241 | Ga0466964_0727493 | 3300044706 | Bacteria | 555 |
| 242 | Ga0453684_1078556 | 3300044712 | Bacteria | 850 |
| 243 | Ga0466960_0532976 | 3300044901 | Bacteria | 691 |
| 244 | Ga0495650_0232275 | 3300046471 | Unclassified | 632 |
| 245 | Ga0495583_0173786 | 3300046506 | Unclassified | 884 |
| 246 | Ga0495643_0411808 | 3300046522 | Unclassified | 594 |
| 247 | Ga0495642_0160790 | 3300046528 | Bacteria | 974 |
| 248 | Ga0495621_0056882 | 3300046539 | Bacteria | 1411 |
| 249 | Ga0495597_0214603 | 3300046542 | Bacteria | 766 |
| 250 | Ga0495668_0089258 | 3300046616 | Bacteria | 1689 |
| 251 | Ga0495668_0206226 | 3300046616 | Bacteria | 1076 |
| 252 | Ga0495668_0358218 | 3300046616 | Bacteria | 801 |
| 253 | Ga0495668_0643897 | 3300046616 | Unclassified | 586 |
| 254 | Ga0495668_0795519 | 3300046616 | Bacteria | 524 |
| 255 | Ga0495611_0527507 | 3300046648 | Bacteria | 535 |
| 256 | Ga0495625_0015429 | 3300046660 | Bacteria | 6051 |
| 257 | Ga0495588_0416206 | 3300046674 | Bacteria | 705 |
| 258 | Ga0495669_0001811 | 3300046684 | Bacteria | 8736 |
| 259 | Ga0495669_0133675 | 3300046684 | Bacteria | 1169 |
| 260 | Ga0495672_0010801 | 3300047320 | Bacteria | 6481 |
| 261 | Ga0495685_143799 | 3300047447 | Archaea | 776 |
| 262 | Ga0495686_0006376 | 3300047472 | Bacteria | 9049 |
| 263 | Ga0496101_0385528 | 3300048904 | Unclassified | 1103 |
| 264 | Ga0496112_0161590 | 3300048915 | Bacteria | 2207 |
| 265 | Ga0496112_0231813 | 3300048915 | Bacteria | 1801 |
| 266 | Ga0496115_0003565 | 3300048918 | Bacteria | 11196 |
| 267 | Ga0501034_0311109 | 3300049571 | Bacteria | 1510 |
| 268 | Ga0501037_0116160 | 3300049573 | Bacteria | 1926 |
| 269 | Ga0501047_0005115 | 3300049581 | Bacteria | 12305 |
| 270 | Ga0501047_0041799 | 3300049581 | Bacteria | 4429 |
| 271 | Ga0501047_0409760 | 3300049581 | Bacteria | 1188 |
| 272 | Ga0501048_0579569 | 3300049582 | Bacteria | 805 |
| 273 | Ga0501048_1315608 | 3300049582 | Bacteria | 520 |
| 274 | Ga0501083_1095804 | 3300049744 | Bacteria | 518 |
| 275 | Ga0501035_0443881 | 3300049822 | Bacteria | 1074 |
| 276 | Ga0501035_0888786 | 3300049822 | Bacteria | 706 |
| 277 | Ga0501044_0004477 | 3300049823 | Bacteria | 15619 |
| 278 | Ga0501044_1610501 | 3300049823 | Bacteria | 514 |
| 279 | nmdc:mga03683_93278_c1 | 3300050489 | Bacteria | 891 |
| 280 | nmdc:mga0k408_750795_c1 | 3300050493 | Bacteria | 570 |
| 281 | nmdc:mga07m45_267094_c1 | 3300050496 | Unclassified | 995 |
| 282 | Ga0500562_004266 | 3300053108 | Bacteria | 3617 |
| 283 | Ga0500594_0024996 | 3300053118 | Bacteria | 1527 |
| 284 | Ga0500595_004036 | 3300053119 | Bacteria | 6692 |
| 285 | Ga0500645_000932 | 3300053730 | Bacteria | 16738 |
| 286 | Ga0466962_0360971 | 3300061719 | Bacteria | 724 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049573 | Ga0501037_0116160 | Ga0501037_0116160_1602_1793 | 56 |
| 2 | 3300049822 | Ga0501035_0443881 | Ga0501035_0443881_459_650 | 56 |
| 3 | 3300049823 | Ga0501044_0004477 | Ga0501044_0004477_9874_10065 | 56 |
| 4 | 3300005327 | Ga0070658_10061818 | Ga0070658_100618183 | 63 |
| 5 | 3300005329 | Ga0070683_100963003 | Ga0070683_1009630032 | 63 |
| 6 | 3300005336 | Ga0070680_100922215 | Ga0070680_1009222152 | 63 |
| 7 | 3300005366 | Ga0070659_101771723 | Ga0070659_1017717231 | 63 |
| 8 | 3300005530 | Ga0070679_100263674 | Ga0070679_1002636744 | 63 |
| 9 | 3300005530 | Ga0070679_101147454 | Ga0070679_1011474541 | 63 |
| 10 | 3300005548 | Ga0070665_100730349 | Ga0070665_1007303493 | 63 |
| 11 | 3300005563 | Ga0068855_100075266 | Ga0068855_1000752662 | 63 |
| 12 | 3300005563 | Ga0068855_100865241 | Ga0068855_1008652412 | 63 |
| 13 | 3300005617 | Ga0068859_100842706 | Ga0068859_1008427063 | 63 |
| 14 | 3300005618 | Ga0068864_101407539 | Ga0068864_1014075392 | 63 |
| 15 | 3300005719 | Ga0068861_101420736 | Ga0068861_1014207362 | 63 |
| 16 | 3300005841 | Ga0068863_100137297 | Ga0068863_1001372973 | 63 |
| 17 | 3300005842 | Ga0068858_100271054 | Ga0068858_1002710542 | 63 |
| 18 | 3300005842 | Ga0068858_101190470 | Ga0068858_1011904701 | 63 |
| 19 | 3300006931 | Ga0097620_100842804 | Ga0097620_1008428041 | 63 |
| 20 | 3300009093 | Ga0105240_10067133 | Ga0105240_100671332 | 63 |
| 21 | 3300009093 | Ga0105240_10075185 | Ga0105240_100751852 | 63 |
| 22 | 3300009551 | Ga0105238_10941941 | Ga0105238_109419413 | 63 |
| 23 | 3300009551 | Ga0105238_11035027 | Ga0105238_110350272 | 63 |
| 24 | 3300025913 | Ga0207695_10318548 | Ga0207695_103185483 | 63 |
| 25 | 3300025917 | Ga0207660_11609707 | Ga0207660_116097072 | 63 |
| 26 | 3300025921 | Ga0207652_11274959 | Ga0207652_112749592 | 63 |
| 27 | 3300025924 | Ga0207694_10646195 | Ga0207694_106461952 | 63 |
| 28 | 3300025924 | Ga0207694_10778493 | Ga0207694_107784931 | 63 |
| 29 | 3300025932 | Ga0207690_11633030 | Ga0207690_116330301 | 63 |
| 30 | 3300025949 | Ga0207667_10074611 | Ga0207667_100746116 | 63 |
| 31 | 3300025949 | Ga0207667_10384383 | Ga0207667_103843833 | 63 |
| 32 | 3300026035 | Ga0207703_10258045 | Ga0207703_102580452 | 63 |
| 33 | 3300026078 | Ga0207702_11277566 | Ga0207702_112775662 | 63 |
| 34 | 3300026095 | Ga0207676_11855910 | Ga0207676_118559102 | 63 |
| 35 | 3300028379 | Ga0268266_10963682 | Ga0268266_109636823 | 63 |
| 36 | 3300031456 | Ga0307513_10013559 | Ga0307513_100135597 | 63 |
| 37 | 3300031456 | Ga0307513_10060816 | Ga0307513_100608166 | 63 |
| 38 | 3300033180 | Ga0307510_10080734 | Ga0307510_100807342 | 63 |
| 39 | 3300035115 | Ga0373941_0214883 | Ga0373941_0214883_301_498 | 63 |
| 40 | 3300035170 | Ga0373943_0516681 | Ga0373943_0516681_55_252 | 63 |
| 41 | 3300035692 | Ga0373935_0161554 | Ga0373935_0161554_727_924 | 63 |
| 42 | 3300035725 | Ga0373947_0148403 | Ga0373947_0148403_226_423 | 63 |
| 43 | 3300037312 | Ga0395899_0000178 | Ga0395899_0000178_18814_19011 | 63 |
| 44 | 3300037312 | Ga0395899_0230043 | Ga0395899_0230043_65_262 | 63 |
| 45 | 3300037312 | Ga0395899_0295417 | Ga0395899_0295417_145_342 | 63 |
| 46 | 3300037312 | Ga0395899_0360437 | Ga0395899_0360437_176_373 | 63 |
| 47 | 3300037312 | Ga0395899_0753550 | Ga0395899_0753550_33_230 | 63 |
| 48 | 3300037418 | Ga0395900_0001522 | Ga0395900_0001522_13988_14185 | 63 |
| 49 | 3300037418 | Ga0395900_0098796 | Ga0395900_0098796_48_245 | 63 |
| 50 | 3300037418 | Ga0395900_0182407 | Ga0395900_0182407_1447_1644 | 63 |
| 51 | 3300037418 | Ga0395900_0464790 | Ga0395900_0464790_364_561 | 63 |
| 52 | 3300037418 | Ga0395900_1155804 | Ga0395900_1155804_457_654 | 63 |
| 53 | 3300037466 | Ga0395898_0006429 | Ga0395898_0006429_186_383 | 63 |
| 54 | 3300037466 | Ga0395898_0150771 | Ga0395898_0150771_598_795 | 63 |
| 55 | 3300037466 | Ga0395898_0345684 | Ga0395898_0345684_278_475 | 63 |
| 56 | 3300037466 | Ga0395898_0503410 | Ga0395898_0503410_530_727 | 63 |
| 57 | 3300037466 | Ga0395898_0642537 | Ga0395898_0642537_598_795 | 63 |
| 58 | 3300037471 | Ga0395905_0010228 | Ga0395905_0010228_314_511 | 63 |
| 59 | 3300037471 | Ga0395905_0058953 | Ga0395905_0058953_2214_2450 | 63 |
| 60 | 3300037471 | Ga0395905_0320687 | Ga0395905_0320687_1037_1234 | 63 |
| 61 | 3300037471 | Ga0395905_0500448 | Ga0395905_0500448_796_993 | 63 |
| 62 | 3300037471 | Ga0395905_1163211 | Ga0395905_1163211_235_432 | 63 |
| 63 | 3300038443 | Ga0395901_0000001 | Ga0395901_0000001_29820_30017 | 63 |
| 64 | 3300038443 | Ga0395901_0178811 | Ga0395901_0178811_1470_1667 | 63 |
| 65 | 3300038443 | Ga0395901_0702615 | Ga0395901_0702615_211_408 | 63 |
| 66 | 3300038443 | Ga0395901_0722608 | Ga0395901_0722608_37_234 | 63 |
| 67 | 3300038443 | Ga0395901_0794903 | Ga0395901_0794903_563_760 | 63 |
| 68 | 3300038443 | Ga0395901_0970247 | Ga0395901_0970247_373_570 | 63 |
| 69 | 3300044683 | Ga0466965_0229254 | Ga0466965_0229254_519_716 | 63 |
| 70 | 3300044684 | Ga0466966_0382812 | Ga0466966_0382812_627_824 | 63 |
| 71 | 3300044693 | Ga0466961_0130245 | Ga0466961_0130245_679_876 | 63 |
| 72 | 3300044706 | Ga0466964_0727493 | Ga0466964_0727493_201_398 | 63 |
| 73 | 3300046616 | Ga0495668_0643897 | Ga0495668_0643897_74_283 | 63 |
| 74 | 3300046674 | Ga0495588_0416206 | Ga0495588_0416206_261_458 | 63 |
| 75 | 3300046684 | Ga0495669_0001811 | Ga0495669_0001811_849_1046 | 63 |
| 76 | 3300048915 | Ga0496112_0231813 | Ga0496112_0231813_755_952 | 63 |
| 77 | 3300049571 | Ga0501034_0311109 | Ga0501034_0311109_1179_1373 | 63 |
| 78 | 3300049581 | Ga0501047_0041799 | Ga0501047_0041799_3916_4113 | 63 |
| 79 | 3300049581 | Ga0501047_0409760 | Ga0501047_0409760_249_449 | 63 |
| 80 | 3300049582 | Ga0501048_0579569 | Ga0501048_0579569_545_742 | 63 |
| 81 | 3300049582 | Ga0501048_1315608 | Ga0501048_1315608_175_372 | 63 |
| 82 | 3300049822 | Ga0501035_0888786 | Ga0501035_0888786_405_602 | 63 |
| 83 | 3300003794 | Ga0055531_10007409 | Ga0055531_100074099 | 64 |
| 84 | 3300005262 | Ga0065165_1009640 | Ga0065165_10096403 | 64 |
| 85 | 3300005327 | Ga0070658_10126680 | Ga0070658_101266804 | 64 |
| 86 | 3300005329 | Ga0070683_101407711 | Ga0070683_1014077112 | 64 |
| 87 | 3300005335 | Ga0070666_10693613 | Ga0070666_106936132 | 64 |
| 88 | 3300005335 | Ga0070666_11448541 | Ga0070666_114485411 | 64 |
| 89 | 3300005336 | Ga0070680_100046508 | Ga0070680_1000465082 | 64 |
| 90 | 3300005339 | Ga0070660_100083290 | Ga0070660_1000832902 | 64 |
| 91 | 3300005339 | Ga0070660_100119790 | Ga0070660_1001197903 | 64 |
| 92 | 3300005344 | Ga0070661_100331672 | Ga0070661_1003316722 | 64 |
| 93 | 3300005344 | Ga0070661_100844160 | Ga0070661_1008441601 | 64 |
| 94 | 3300005347 | Ga0070668_100003309 | Ga0070668_1000033094 | 64 |
| 95 | 3300005347 | Ga0070668_100059345 | Ga0070668_1000593454 | 64 |
| 96 | 3300005347 | Ga0070668_100723679 | Ga0070668_1007236792 | 64 |
| 97 | 3300005355 | Ga0070671_100364853 | Ga0070671_1003648532 | 64 |
| 98 | 3300005366 | Ga0070659_100004474 | Ga0070659_10000447410 | 64 |
| 99 | 3300005366 | Ga0070659_100637327 | Ga0070659_1006373273 | 64 |
| 100 | 3300005367 | Ga0070667_100063981 | Ga0070667_1000639814 | 64 |
| 101 | 3300005458 | Ga0070681_10041486 | Ga0070681_100414861 | 64 |
| 102 | 3300005458 | Ga0070681_10152792 | Ga0070681_101527923 | 64 |
| 103 | 3300005468 | Ga0070707_101301585 | Ga0070707_1013015851 | 64 |
| 104 | 3300005530 | Ga0070679_100012037 | Ga0070679_1000120377 | 64 |
| 105 | 3300005539 | Ga0068853_100426738 | Ga0068853_1004267383 | 64 |
| 106 | 3300005539 | Ga0068853_100734250 | Ga0068853_1007342502 | 64 |
| 107 | 3300005548 | Ga0070665_100000015 | Ga0070665_100000015109 | 64 |
| 108 | 3300005548 | Ga0070665_100013799 | Ga0070665_10001379910 | 64 |
| 109 | 3300005564 | Ga0070664_100547372 | Ga0070664_1005473722 | 64 |
| 110 | 3300005578 | Ga0068854_100911842 | Ga0068854_1009118423 | 64 |
| 111 | 3300005578 | Ga0068854_101323344 | Ga0068854_1013233442 | 64 |
| 112 | 3300005614 | Ga0068856_100537482 | Ga0068856_1005374822 | 64 |
| 113 | 3300005616 | Ga0068852_100555000 | Ga0068852_1005550003 | 64 |
| 114 | 3300005617 | Ga0068859_100368134 | Ga0068859_1003681341 | 64 |
| 115 | 3300005617 | Ga0068859_100391418 | Ga0068859_1003914182 | 64 |
| 116 | 3300005617 | Ga0068859_102605145 | Ga0068859_1026051452 | 64 |
| 117 | 3300005618 | Ga0068864_100084763 | Ga0068864_1000847632 | 64 |
| 118 | 3300005618 | Ga0068864_101288855 | Ga0068864_1012888552 | 64 |
| 119 | 3300005719 | Ga0068861_100428539 | Ga0068861_1004285393 | 64 |
| 120 | 3300005834 | Ga0068851_10555444 | Ga0068851_105554442 | 64 |
| 121 | 3300005841 | Ga0068863_100199814 | Ga0068863_1001998142 | 64 |
| 122 | 3300005841 | Ga0068863_100896512 | Ga0068863_1008965122 | 64 |
| 123 | 3300005843 | Ga0068860_100000165 | Ga0068860_100000165106 | 64 |
| 124 | 3300005844 | Ga0068862_100006415 | Ga0068862_10000641513 | 64 |
| 125 | 3300005844 | Ga0068862_100188773 | Ga0068862_1001887734 | 64 |
| 126 | 3300005844 | Ga0068862_100387725 | Ga0068862_1003877253 | 64 |
| 127 | 3300005844 | Ga0068862_101092317 | Ga0068862_1010923172 | 64 |
| 128 | 3300006177 | Ga0075362_10050826 | Ga0075362_100508263 | 64 |
| 129 | 3300006237 | Ga0097621_101608873 | Ga0097621_1016088731 | 64 |
| 130 | 3300006881 | Ga0068865_100015236 | Ga0068865_1000152366 | 64 |
| 131 | 3300006931 | Ga0097620_100368132 | Ga0097620_1003681321 | 64 |
| 132 | 3300006931 | Ga0097620_100391442 | Ga0097620_1003914422 | 64 |
| 133 | 3300006931 | Ga0097620_102605912 | Ga0097620_1026059121 | 64 |
| 134 | 3300009093 | Ga0105240_10056296 | Ga0105240_100562961 | 64 |
| 135 | 3300009093 | Ga0105240_10506621 | Ga0105240_105066213 | 64 |
| 136 | 3300009093 | Ga0105240_11288601 | Ga0105240_112886012 | 64 |
| 137 | 3300009098 | Ga0105245_10100268 | Ga0105245_101002683 | 64 |
| 138 | 3300009098 | Ga0105245_12812396 | Ga0105245_128123962 | 64 |
| 139 | 3300009176 | Ga0105242_10616484 | Ga0105242_106164843 | 64 |
| 140 | 3300009177 | Ga0105248_10020343 | Ga0105248_100203432 | 64 |
| 141 | 3300009177 | Ga0105248_12309807 | Ga0105248_123098072 | 64 |
| 142 | 3300009545 | Ga0105237_10409695 | Ga0105237_104096953 | 64 |
| 143 | 3300009551 | Ga0105238_10022500 | Ga0105238_100225002 | 64 |
| 144 | 3300009551 | Ga0105238_10127049 | Ga0105238_101270493 | 64 |
| 145 | 3300009551 | Ga0105238_10369282 | Ga0105238_103692822 | 64 |
| 146 | 3300009553 | Ga0105249_11324141 | Ga0105249_113241412 | 64 |
| 147 | 3300009553 | Ga0105249_12462192 | Ga0105249_124621922 | 64 |
| 148 | 3300010375 | Ga0105239_12712383 | Ga0105239_127123832 | 64 |
| 149 | 3300010375 | Ga0105239_13138766 | Ga0105239_131387662 | 64 |
| 150 | 3300013104 | Ga0157370_10086290 | Ga0157370_100862903 | 64 |
| 151 | 3300013296 | Ga0157374_10801535 | Ga0157374_108015352 | 64 |
| 152 | 3300013306 | Ga0163162_10603185 | Ga0163162_106031852 | 64 |
| 153 | 3300014325 | Ga0163163_10034486 | Ga0163163_100344863 | 64 |
| 154 | 3300014325 | Ga0163163_10720409 | Ga0163163_107204093 | 64 |
| 155 | 3300014325 | Ga0163163_11143399 | Ga0163163_111433992 | 64 |
| 156 | 3300025250 | Ga0209026_1001557 | Ga0209026_10015575 | 64 |
| 157 | 3300025304 | Ga0209257_1003465 | Ga0209257_100346510 | 64 |
| 158 | 3300025903 | Ga0207680_10900959 | Ga0207680_109009592 | 64 |
| 159 | 3300025909 | Ga0207705_10187317 | Ga0207705_101873172 | 64 |
| 160 | 3300025909 | Ga0207705_10258148 | Ga0207705_102581482 | 64 |
| 161 | 3300025912 | Ga0207707_10126506 | Ga0207707_101265063 | 64 |
| 162 | 3300025913 | Ga0207695_10000876 | Ga0207695_1000087651 | 64 |
| 163 | 3300025913 | Ga0207695_10022127 | Ga0207695_100221276 | 64 |
| 164 | 3300025913 | Ga0207695_10119553 | Ga0207695_101195533 | 64 |
| 165 | 3300025913 | Ga0207695_10588488 | Ga0207695_105884882 | 64 |
| 166 | 3300025919 | Ga0207657_10026754 | Ga0207657_100267542 | 64 |
| 167 | 3300025919 | Ga0207657_10056201 | Ga0207657_100562016 | 64 |
| 168 | 3300025920 | Ga0207649_11357105 | Ga0207649_113571052 | 64 |
| 169 | 3300025921 | Ga0207652_10105042 | Ga0207652_101050423 | 64 |
| 170 | 3300025923 | Ga0207681_10995815 | Ga0207681_109958151 | 64 |
| 171 | 3300025924 | Ga0207694_10117226 | Ga0207694_101172262 | 64 |
| 172 | 3300025924 | Ga0207694_10242418 | Ga0207694_102424181 | 64 |
| 173 | 3300025924 | Ga0207694_10363876 | Ga0207694_103638763 | 64 |
| 174 | 3300025925 | Ga0207650_10185694 | Ga0207650_101856942 | 64 |
| 175 | 3300025927 | Ga0207687_10091824 | Ga0207687_100918242 | 64 |
| 176 | 3300025931 | Ga0207644_10330099 | Ga0207644_103300992 | 64 |
| 177 | 3300025931 | Ga0207644_10415581 | Ga0207644_104155812 | 64 |
| 178 | 3300025932 | Ga0207690_10000111 | Ga0207690_1000011153 | 64 |
| 179 | 3300025934 | Ga0207686_10398317 | Ga0207686_103983173 | 64 |
| 180 | 3300025938 | Ga0207704_10001481 | Ga0207704_100014816 | 64 |
| 181 | 3300025945 | Ga0207679_10520555 | Ga0207679_105205551 | 64 |
| 182 | 3300025949 | Ga0207667_10222401 | Ga0207667_102224013 | 64 |
| 183 | 3300025961 | Ga0207712_10567451 | Ga0207712_105674513 | 64 |
| 184 | 3300025972 | Ga0207668_10002257 | Ga0207668_1000225713 | 64 |
| 185 | 3300025972 | Ga0207668_10156040 | Ga0207668_101560402 | 64 |
| 186 | 3300025972 | Ga0207668_11005179 | Ga0207668_110051792 | 64 |
| 187 | 3300025981 | Ga0207640_10948246 | Ga0207640_109482462 | 64 |
| 188 | 3300025986 | Ga0207658_10048305 | Ga0207658_100483052 | 64 |
| 189 | 3300026023 | Ga0207677_11698325 | Ga0207677_116983252 | 64 |
| 190 | 3300026041 | Ga0207639_10532762 | Ga0207639_105327622 | 64 |
| 191 | 3300026041 | Ga0207639_10576544 | Ga0207639_105765442 | 64 |
| 192 | 3300026078 | Ga0207702_10251946 | Ga0207702_102519462 | 64 |
| 193 | 3300026088 | Ga0207641_10596629 | Ga0207641_105966292 | 64 |
| 194 | 3300026088 | Ga0207641_10921909 | Ga0207641_109219093 | 64 |
| 195 | 3300026095 | Ga0207676_10067025 | Ga0207676_100670252 | 64 |
| 196 | 3300026095 | Ga0207676_10302523 | Ga0207676_103025233 | 64 |
| 197 | 3300026095 | Ga0207676_12089576 | Ga0207676_120895761 | 64 |
| 198 | 3300026116 | Ga0207674_10781153 | Ga0207674_107811532 | 64 |
| 199 | 3300026118 | Ga0207675_101690990 | Ga0207675_1016909901 | 64 |
| 200 | 3300026142 | Ga0207698_10485771 | Ga0207698_104857712 | 64 |
| 201 | 3300027378 | Ga0209981_1001311 | Ga0209981_10013115 | 64 |
| 202 | 3300027665 | Ga0209983_1013948 | Ga0209983_10139482 | 64 |
| 203 | 3300028379 | Ga0268266_10000005 | Ga0268266_100000051008 | 64 |
| 204 | 3300028379 | Ga0268266_11553619 | Ga0268266_115536192 | 64 |
| 205 | 3300028380 | Ga0268265_10000867 | Ga0268265_1000086713 | 64 |
| 206 | 3300028380 | Ga0268265_10099851 | Ga0268265_100998514 | 64 |
| 207 | 3300028380 | Ga0268265_10171282 | Ga0268265_101712822 | 64 |
| 208 | 3300028381 | Ga0268264_10000021 | Ga0268264_10000021208 | 64 |
| 209 | 3300028786 | Ga0307517_10001415 | Ga0307517_100014159 | 64 |
| 210 | 3300028786 | Ga0307517_10123814 | Ga0307517_101238143 | 64 |
| 211 | 3300031456 | Ga0307513_10013193 | Ga0307513_100131933 | 64 |
| 212 | 3300031456 | Ga0307513_11004628 | Ga0307513_110046281 | 64 |
| 213 | 3300031731 | Ga0307405_11224614 | Ga0307405_112246142 | 64 |
| 214 | 3300032005 | Ga0307411_10861090 | Ga0307411_108610902 | 64 |
| 215 | 3300036401 | Ga0373937_1007569 | Ga0373937_1007569_339_536 | 64 |
| 216 | 3300037312 | Ga0395899_0015074 | Ga0395899_0015074_2810_3010 | 64 |
| 217 | 3300037418 | Ga0395900_0006150 | Ga0395900_0006150_6510_6710 | 64 |
| 218 | 3300037466 | Ga0395898_0011470 | Ga0395898_0011470_6630_6830 | 64 |
| 219 | 3300037471 | Ga0395905_0482663 | Ga0395905_0482663_411_656 | 64 |
| 220 | 3300038443 | Ga0395901_0010783 | Ga0395901_0010783_1831_2031 | 64 |
| 221 | 3300044712 | Ga0453684_1078556 | Ga0453684_1078556_81_275 | 64 |
| 222 | 3300046471 | Ga0495650_0232275 | Ga0495650_0232275_48_260 | 64 |
| 223 | 3300046506 | Ga0495583_0173786 | Ga0495583_0173786_386_589 | 64 |
| 224 | 3300046528 | Ga0495642_0160790 | Ga0495642_0160790_14_217 | 64 |
| 225 | 3300046542 | Ga0495597_0214603 | Ga0495597_0214603_331_528 | 64 |
| 226 | 3300046616 | Ga0495668_0206226 | Ga0495668_0206226_343_540 | 64 |
| 227 | 3300046616 | Ga0495668_0795519 | Ga0495668_0795519_50_247 | 64 |
| 228 | 3300046648 | Ga0495611_0527507 | Ga0495611_0527507_320_523 | 64 |
| 229 | 3300046660 | Ga0495625_0015429 | Ga0495625_0015429_2158_2355 | 64 |
| 230 | 3300046684 | Ga0495669_0133675 | Ga0495669_0133675_278_481 | 64 |
| 231 | 3300047320 | Ga0495672_0010801 | Ga0495672_0010801_934_1131 | 64 |
| 232 | 3300047447 | Ga0495685_143799 | Ga0495685_143799_251_454 | 64 |
| 233 | 3300047472 | Ga0495686_0006376 | Ga0495686_0006376_2461_2658 | 64 |
| 234 | 3300048904 | Ga0496101_0385528 | Ga0496101_0385528_209_406 | 64 |
| 235 | 3300048915 | Ga0496112_0161590 | Ga0496112_0161590_1688_1885 | 64 |
| 236 | 3300048918 | Ga0496115_0003565 | Ga0496115_0003565_7279_7476 | 64 |
| 237 | 3300049581 | Ga0501047_0005115 | Ga0501047_0005115_2522_2719 | 64 |
| 238 | 3300049744 | Ga0501083_1095804 | Ga0501083_1095804_47_244 | 64 |
| 239 | 3300049823 | Ga0501044_1610501 | Ga0501044_1610501_264_461 | 64 |
| 240 | 3300050489 | nmdc:mga03683_93278_c1 | nmdc:mga03683_93278_c1_98_325 | 64 |
| 241 | 3300050493 | nmdc:mga0k408_750795_c1 | nmdc:mga0k408_750795_c1_103_300 | 64 |
| 242 | 3300053108 | Ga0500562_004266 | Ga0500562_004266_167_364 | 64 |
| 243 | 3300053118 | Ga0500594_0024996 | Ga0500594_0024996_907_1104 | 64 |
| 244 | 3300053730 | Ga0500645_000932 | Ga0500645_000932_10070_10267 | 64 |
| 245 | 3300003215 | JGI25153J46596_10103957 | JGI25153J46596_101039572 | 65 |
| 246 | 3300003791 | Ga0055530_10001503 | Ga0055530_1000150312 | 65 |
| 247 | 3300003794 | Ga0055531_10005447 | Ga0055531_100054473 | 65 |
| 248 | 3300005262 | Ga0065165_1000103 | Ga0065165_1000103106 | 65 |
| 249 | 3300005327 | Ga0070658_10035733 | Ga0070658_100357337 | 65 |
| 250 | 3300005336 | Ga0070680_100251671 | Ga0070680_1002516713 | 65 |
| 251 | 3300005339 | Ga0070660_100265068 | Ga0070660_1002650683 | 65 |
| 252 | 3300005456 | Ga0070678_100665944 | Ga0070678_1006659441 | 65 |
| 253 | 3300005471 | Ga0070698_102061602 | Ga0070698_1020616021 | 65 |
| 254 | 3300005530 | Ga0070679_100000814 | Ga0070679_1000008142 | 65 |
| 255 | 3300005563 | Ga0068855_100428702 | Ga0068855_1004287023 | 65 |
| 256 | 3300005577 | Ga0068857_100881829 | Ga0068857_1008818293 | 65 |
| 257 | 3300009093 | Ga0105240_10000671 | Ga0105240_1000067151 | 65 |
| 258 | 3300025297 | Ga0209758_1005267 | Ga0209758_10052673 | 65 |
| 259 | 3300025298 | Ga0209050_1000038 | Ga0209050_1000038223 | 65 |
| 260 | 3300025304 | Ga0209257_1000138 | Ga0209257_1000138113 | 65 |
| 261 | 3300025909 | Ga0207705_10182970 | Ga0207705_101829703 | 65 |
| 262 | 3300025913 | Ga0207695_10002095 | Ga0207695_1000209510 | 65 |
| 263 | 3300025917 | Ga0207660_10215519 | Ga0207660_102155193 | 65 |
| 264 | 3300025919 | Ga0207657_10221852 | Ga0207657_102218523 | 65 |
| 265 | 3300025921 | Ga0207652_10082123 | Ga0207652_100821233 | 65 |
| 266 | 3300026035 | Ga0207703_12007551 | Ga0207703_120075512 | 65 |
| 267 | 3300026118 | Ga0207675_100998182 | Ga0207675_1009981821 | 65 |
| 268 | 3300026121 | Ga0207683_12166247 | Ga0207683_121662472 | 65 |
| 269 | 3300030521 | Ga0307511_10005612 | Ga0307511_1000561216 | 65 |
| 270 | 3300035089 | Ga0373944_0033881 | Ga0373944_0033881_661_891 | 65 |
| 271 | 3300035170 | Ga0373943_0099873 | Ga0373943_0099873_1070_1300 | 65 |
| 272 | 3300035171 | Ga0373946_0043590 | Ga0373946_0043590_671_901 | 65 |
| 273 | 3300035695 | Ga0373927_0000825 | Ga0373927_0000825_2826_3056 | 65 |
| 274 | 3300037068 | Ga0373925_0000100 | Ga0373925_0000100_70236_70466 | 65 |
| 275 | 3300037466 | Ga0395898_0496166 | Ga0395898_0496166_849_1049 | 65 |
| 276 | 3300037471 | Ga0395905_0324405 | Ga0395905_0324405_750_947 | 65 |
| 277 | 3300037471 | Ga0395905_0617494 | Ga0395905_0617494_514_711 | 65 |
| 278 | 3300037471 | Ga0395905_1219377 | Ga0395905_1219377_349_546 | 65 |
| 279 | 3300044901 | Ga0466960_0532976 | Ga0466960_0532976_25_222 | 65 |
| 280 | 3300046522 | Ga0495643_0411808 | Ga0495643_0411808_35_247 | 65 |
| 281 | 3300046539 | Ga0495621_0056882 | Ga0495621_0056882_181_408 | 65 |
| 282 | 3300046616 | Ga0495668_0089258 | Ga0495668_0089258_67_273 | 65 |
| 283 | 3300046616 | Ga0495668_0358218 | Ga0495668_0358218_285_491 | 65 |
| 284 | 3300050496 | nmdc:mga07m45_267094_c1 | nmdc:mga07m45_267094_c1_129_341 | 65 |
| 285 | 3300053119 | Ga0500595_004036 | Ga0500595_004036_1188_1394 | 65 |
| 286 | 3300061719 | Ga0466962_0360971 | Ga0466962_0360971_495_695 | 65 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3p2c-assembly1.cif.gz_B | crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution | 0.9424 | 23 | 58 |
| 2p0v-assembly1.cif.gz_B | crystal structure of bt3781 protein from bacteroides thetaiotaomicron, northeast structural genomics target btr58 | 0.9381 | 23 | 58 |
| 3on6-assembly1.cif.gz_B | crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution | 0.9211 | 23 | 61 |
| 3on6-assembly1.cif.gz_B | crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution | 0.565 | 23 | 61 |
| 3lwu-assembly1.cif.gz_A | crystal structure of putative succinylglutamate desuccinylase/aspartoacylase (yp_749235.1) from shewanella frigidimarina ncimb 400 at 2.10 a resolution | 0.5572 | 4 | 58 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54KW6_95_356_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 1.006 | 27 | 58 | 1.25.40.10 |
| af_Q4V890_271_439_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9856 | 24 | 58 | 1.25.40.10 |
| af_Q54IX4_60_323_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9687 | 26 | 57 | 1.25.40.10 |
| 3p2cB01 | Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; | 0.9423 | 23 | 58 | 1.50.10.10 |
| af_Q75JR6_1322_1544_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9056 | 28 | 64 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A516NLL0-F1-model_v4 | DoxX family protein | 0.9807 | 24 | 59 |
GO:0016020
|
| AF-A0A7V1WS33-F1-model_v4 | Uncharacterized protein | 0.9538 | 24 | 58 |
GO:0016020
|
| AF-A0A7L9C1V9-F1-model_v4 | Uncharacterized protein | 0.9222 | 18 | 59 |
GO:0016020
|
| AF-A0A6N2CNG9-F1-model_v4 | Four helix bundle protein | 0.9212 | 22 | 64 |
|
| AF-A0A2U0AI25-F1-model_v4 | Cation/multidrug efflux pump | 0.8966 | 26 | 59 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar