F387094

General Info

Members Datasets Scaffolds Average Seq Length
285 201 285 279

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_0302474|Ga0501079_0302474_98_955
Length 276
Sequence MSTPTADIKAIVQEKYGEAARRAADGQPSCDPITGNLYDATQIGVLPIEAVVASLGCGNPTALADLKAGETVLDLGSGGGIDVLLSARRVGPTGKAYGLDMTDDMLALARENQKKAGLSNVEFLKGEIEHIPLPDDSVDVIISNCVINLSADKDAVLREAFRVLKPGGRFAVSDVIVRGADVPAAIRKSMELWIGCVAGALEESEYRQKLAAAGFTNVDVEPTRIYRAEDARAFLAGAGVEGDGLAESVDGRFLSAFVRAIKPAATQPCCGPTCCS

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
133 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
134 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.51
Rhizosphere 96.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10070153 3300005290 Bacteria 6281
2 Ga0070670_100009432 3300005331 Bacteria 8332
3 Ga0070670_100038764 3300005331 Bacteria 4097
4 Ga0070666_10037749 3300005335 Bacteria 3214
5 Ga0070682_100283638 3300005337 Bacteria 1208
6 Ga0068868_100025443 3300005338 Bacteria 4503
7 Ga0068868_100169114 3300005338 Bacteria 1809
8 Ga0070660_100025283 3300005339 Bacteria 4412
9 Ga0070689_100015181 3300005340 Bacteria 5612
10 Ga0070661_100001963 3300005344 Bacteria 14208
11 Ga0070668_100119126 3300005347 Bacteria 2108
12 Ga0070668_100428996 3300005347 Bacteria 1133
13 Ga0070669_100020261 3300005353 Bacteria 4751
14 Ga0070675_100030516 3300005354 Bacteria 4352
15 Ga0070671_100013636 3300005355 Bacteria 6555
16 Ga0070674_100015051 3300005356 Bacteria 4822
17 Ga0070674_100145854 3300005356 Bacteria 1781
18 Ga0070674_100368203 3300005356 Bacteria 1165
19 Ga0070673_100011978 3300005364 Bacteria 5939
20 Ga0070688_100019118 3300005365 Bacteria 3966
21 Ga0070659_100001604 3300005366 Bacteria 16266
22 Ga0070713_100000275 3300005436 Bacteria 33686
23 Ga0070710_10029363 3300005437 Bacteria 2950
24 Ga0070663_100090541 3300005455 Bacteria 2266
25 Ga0070678_100015596 3300005456 Bacteria 4834
26 Ga0070662_100000945 3300005457 Bacteria 17759
27 Ga0070681_10070535 3300005458 Bacteria 3459
28 Ga0068867_100098947 3300005459 Bacteria 2224
29 Ga0070706_100299075 3300005467 Bacteria 1502
30 Ga0070707_100006652 3300005468 Bacteria 10709
31 Ga0070698_100002036 3300005471 Bacteria 22475
32 Ga0070699_100001905 3300005518 Bacteria 18836
33 Ga0070697_100023491 3300005536 Bacteria 4903
34 Ga0070697_100036597 3300005536 Bacteria 3964
35 Ga0068853_100008541 3300005539 Bacteria 8231
36 Ga0070686_100172148 3300005544 Bacteria 1532
37 Ga0070696_100138184 3300005546 Bacteria 1778
38 Ga0070693_100146008 3300005547 Bacteria 1494
39 Ga0068855_100001032 3300005563 Bacteria 34674
40 Ga0070664_100001473 3300005564 Bacteria 18771
41 Ga0068854_100184610 3300005578 Bacteria 1631
42 Ga0068856_100002808 3300005614 Bacteria 17829
43 Ga0070702_100147758 3300005615 Bacteria 1505
44 Ga0068859_100005500 3300005617 Bacteria 12901
45 Ga0068859_100028416 3300005617 Bacteria 5606
46 Ga0068864_100116315 3300005618 Bacteria 2386
47 Ga0068861_100225432 3300005719 Bacteria 1586
48 Ga0068860_100002245 3300005843 Bacteria 20334
49 Ga0068860_100047058 3300005843 Bacteria 4111
50 Ga0070716_100003978 3300006173 Bacteria 7014
51 Ga0070712_100000411 3300006175 Bacteria 24429
52 Ga0097621_100004739 3300006237 Bacteria 9507
53 Ga0097621_100428980 3300006237 Bacteria 1188
54 Ga0068871_100010534 3300006358 Bacteria 6754
55 Ga0068871_100201963 3300006358 Bacteria 1716
56 Ga0075428_100001289 3300006844 Bacteria 26687
57 Ga0075428_100001360 3300006844 Bacteria 25966
58 Ga0075433_10003888 3300006852 Bacteria 11558
59 Ga0075434_100023737 3300006871 Bacteria 5983
60 Ga0068865_100016796 3300006881 Bacteria 4691
61 Ga0068865_100190387 3300006881 Bacteria 1586
62 Ga0075436_100021059 3300006914 Bacteria 4473
63 Ga0075436_100120076 3300006914 Bacteria 1838
64 Ga0097620_100005500 3300006931 Bacteria 12901
65 Ga0097620_100028417 3300006931 Bacteria 5606
66 Ga0075435_100013833 3300007076 Bacteria 6015
67 Ga0111539_10000633 3300009094 Bacteria 45453
68 Ga0111539_10026019 3300009094 Bacteria 7161
69 Ga0105245_10240063 3300009098 Bacteria 1756
70 Ga0105245_10663136 3300009098 Bacteria 1074
71 Ga0105247_10175413 3300009101 Bacteria 1427
72 Ga0105247_10244949 3300009101 Bacteria 1223
73 Ga0114129_10055625 3300009147 Bacteria 5545
74 Ga0105243_10063935 3300009148 Bacteria 2951
75 Ga0105243_10066790 3300009148 Bacteria 2893
76 Ga0105243_10537000 3300009148 Bacteria 1115
77 Ga0105241_10670247 3300009174 Bacteria 944
78 Ga0105242_10195033 3300009176 Bacteria 1795
79 Ga0105248_10153547 3300009177 Bacteria 2597
80 Ga0105248_10359127 3300009177 Bacteria 1640
81 Ga0105248_10472984 3300009177 Bacteria 1413
82 Ga0105239_10091397 3300010375 Bacteria 3359
83 Ga0105239_10104711 3300010375 Bacteria 3133
84 Ga0157373_10001435 3300013100 Bacteria 18179
85 Ga0157371_10002573 3300013102 Bacteria 17202
86 Ga0157369_10036396 3300013105 Bacteria 5393
87 Ga0163162_10070953 3300013306 Bacteria 3536
88 Ga0163162_10353021 3300013306 Bacteria 1603
89 Ga0157372_10003054 3300013307 Bacteria 18034
90 Ga0163163_10000001 3300014325 Bacteria 622185
91 Ga0163163_10155589 3300014325 Bacteria 2330
92 Ga0157380_10030451 3300014326 Bacteria 4133
93 Ga0157380_10240176 3300014326 Bacteria 1633
94 Ga0157379_10030390 3300014968 Bacteria 4808
95 Ga0157379_10066048 3300014968 Bacteria 3234
96 Ga0157379_10126706 3300014968 Bacteria 2297
97 Ga0157376_10336965 3300014969 Bacteria 1439
98 Ga0207697_10000902 3300025315 Bacteria 16783
99 Ga0207682_10076943 3300025893 Bacteria 1423
100 Ga0207710_10169770 3300025900 Bacteria 1066
101 Ga0207688_10022599 3300025901 Bacteria 3442
102 Ga0207680_10024508 3300025903 Bacteria 3313
103 Ga0207685_10139888 3300025905 Bacteria 1084
104 Ga0207699_10006172 3300025906 Bacteria 5778
105 Ga0207645_10017015 3300025907 Bacteria 4804
106 Ga0207693_10000350 3300025915 Bacteria 42606
107 Ga0207663_10145629 3300025916 Bacteria 1656
108 Ga0207657_10002908 3300025919 Bacteria 18390
109 Ga0207649_10013104 3300025920 Bacteria 4624
110 Ga0207646_10085952 3300025922 Bacteria 2813
111 Ga0207681_10019749 3300025923 Bacteria 4263
112 Ga0207681_10023103 3300025923 Bacteria 3972
113 Ga0207650_10010113 3300025925 Bacteria 6465
114 Ga0207659_10001249 3300025926 Bacteria 15242
115 Ga0207659_10019636 3300025926 Bacteria 4452
116 Ga0207659_10314878 3300025926 Bacteria 1289
117 Ga0207700_10000632 3300025928 Bacteria 20587
118 Ga0207644_10216429 3300025931 Bacteria 1516
119 Ga0207690_10001502 3300025932 Bacteria 14581
120 Ga0207706_10000636 3300025933 Bacteria 37249
121 Ga0207706_10157577 3300025933 Bacteria 1996
122 Ga0207686_10009551 3300025934 Bacteria 5263
123 Ga0207686_10112644 3300025934 Bacteria 1838
124 Ga0207709_10154289 3300025935 Bacteria 1594
125 Ga0207670_10030944 3300025936 Bacteria 3423
126 Ga0207669_10172186 3300025937 Bacteria 1542
127 Ga0207669_10260266 3300025937 Bacteria 1297
128 Ga0207704_10008968 3300025938 Bacteria 4807
129 Ga0207704_10197683 3300025938 Bacteria 1468
130 Ga0207704_10456963 3300025938 Bacteria 1020
131 Ga0207665_10007006 3300025939 Bacteria 7463
132 Ga0207665_10007473 3300025939 Bacteria 7223
133 Ga0207691_10115105 3300025940 Bacteria 2388
134 Ga0207691_10418550 3300025940 Bacteria 1142
135 Ga0207711_10467936 3300025941 Bacteria 1174
136 Ga0207679_10001289 3300025945 Bacteria 15834
137 Ga0207667_10009245 3300025949 Bacteria 11637
138 Ga0207651_10147363 3300025960 Bacteria 1827
139 Ga0207668_10194279 3300025972 Bacteria 1611
140 Ga0207640_10334259 3300025981 Bacteria 1211
141 Ga0207677_10017734 3300026023 Bacteria 4254
142 Ga0207677_10310422 3300026023 Bacteria 1306
143 Ga0207703_10275448 3300026035 Bacteria 1526
144 Ga0207639_10004010 3300026041 Bacteria 9940
145 Ga0207678_10053062 3300026067 Bacteria 3495
146 Ga0207708_10142518 3300026075 Bacteria 1881
147 Ga0207702_10008296 3300026078 Bacteria 8778
148 Ga0207648_10029421 3300026089 Bacteria 4872
149 Ga0207648_10182010 3300026089 Bacteria 1860
150 Ga0207676_10184866 3300026095 Bacteria 1828
151 Ga0207675_100194529 3300026118 Bacteria 1946
152 Ga0207683_10018386 3300026121 Bacteria 5963
153 Ga0210000_1010572 3300027462 Bacteria 1366
154 Ga0209995_1006660 3300027471 Bacteria 1857
155 Ga0209971_1004981 3300027682 Bacteria 3156
156 Ga0209998_10010194 3300027717 Bacteria 1945
157 Ga0209974_10000626 3300027876 Bacteria 11888
158 Ga0207428_10077165 3300027907 Bacteria 2608
159 Ga0268265_10041700 3300028380 Bacteria 3399
160 Ga0268264_10009514 3300028381 Bacteria 8050
161 Ga0268264_10059702 3300028381 Bacteria 3196
162 Ga0265338_10016718 3300028800 Bacteria 7950
163 Ga0265760_10002540 3300031090 Bacteria 5326
164 Ga0316575_10042904 3300031665 Bacteria 1792
165 Ga0307405_10029223 3300031731 Bacteria 3220
166 Ga0307405_10174272 3300031731 Bacteria 1538
167 Ga0307412_10118509 3300031911 Bacteria 1902
168 Ga0307409_100068543 3300031995 Bacteria 2806
169 Ga0307416_100159351 3300032002 Bacteria 2083
170 Ga0307414_10091227 3300032004 Bacteria 2264
171 Ga0307411_10111196 3300032005 Bacteria 1961
172 Ga0307415_100538194 3300032126 Bacteria 1028
173 Ga0373928_0030309 3300035084 Bacteria 1195
174 Ga0373952_0023563 3300035092 Bacteria 1316
175 Ga0316574_0322018 3300035398 Bacteria 981
176 Ga0373933_0007544 3300035724 Bacteria 5944
177 Ga0373933_0180127 3300035724 Bacteria 1348
178 Ga0373937_0000685 3300036401 Bacteria 29468
179 Ga0373937_0099839 3300036401 Bacteria 2692
180 Ga0436361_1121322 3300039447 Bacteria 2425
181 Ga0451577_0164240 3300042876 Bacteria 2000
182 Ga0453684_0438098 3300044712 Bacteria 1457
183 Ga0495592_0042563 3300046454 Bacteria 3401
184 Ga0495587_0186996 3300046536 Bacteria 1173
185 Ga0495645_0074260 3300046543 Bacteria 2449
186 Ga0495634_0107074 3300046642 Bacteria 1801
187 Ga0495658_0095285 3300046683 Bacteria 1769
188 Ga0495613_0068487 3300046689 Bacteria 2588
189 Ga0495600_0126365 3300046809 Bacteria 1663
190 Ga0495680_0368099 3300047322 Bacteria 998
191 Ga0495684_0152081 3300047471 Bacteria 1729
192 Ga0495602_0034202 3300048088 Bacteria 4758
193 Ga0496101_0365363 3300048904 Bacteria 1135
194 Ga0496102_0003788 3300048905 Bacteria 12788
195 Ga0496103_0127746 3300048906 Bacteria 1622
196 Ga0496106_0002584 3300048909 Bacteria 13475
197 Ga0496107_0050167 3300048910 Bacteria 3008
198 Ga0496108_0064111 3300048911 Bacteria 3095
199 Ga0496109_0103259 3300048912 Bacteria 2646
200 Ga0496110_0476954 3300048913 Bacteria 1136
201 Ga0496114_0207200 3300048917 Bacteria 1719
202 Ga0496115_0343083 3300048918 Bacteria 1219
203 Ga0501031_0006928 3300049568 Bacteria 7399
204 Ga0501031_0019643 3300049568 Bacteria 4402
205 Ga0501032_0004869 3300049569 Bacteria 10049
206 Ga0501032_0190308 3300049569 Bacteria 1341
207 Ga0501033_0002876 3300049570 Bacteria 14423
208 Ga0501033_0038014 3300049570 Bacteria 3601
209 Ga0501034_0006850 3300049571 Bacteria 12193
210 Ga0501036_0001299 3300049572 Bacteria 19129
211 Ga0501036_0002999 3300049572 Bacteria 13429
212 Ga0501036_0102242 3300049572 Bacteria 2424
213 Ga0501036_0137827 3300049572 Bacteria 2059
214 Ga0501037_0003751 3300049573 Bacteria 11027
215 Ga0501038_0001040 3300049574 Bacteria 25051
216 Ga0501038_0006769 3300049574 Bacteria 10586
217 Ga0501038_0009869 3300049574 Bacteria 8738
218 Ga0501039_0001916 3300049575 Bacteria 15417
219 Ga0501039_0118984 3300049575 Bacteria 2069
220 Ga0501040_0031590 3300049576 Bacteria 3580
221 Ga0501041_0001037 3300049577 Bacteria 15209
222 Ga0501041_0009309 3300049577 Bacteria 5784
223 Ga0501041_0152973 3300049577 Bacteria 1441
224 Ga0501042_0000469 3300049578 Bacteria 20886
225 Ga0501042_0011149 3300049578 Bacteria 6057
226 Ga0501043_0003239 3300049579 Bacteria 13442
227 Ga0501046_0003123 3300049580 Bacteria 15290
228 Ga0501046_0005720 3300049580 Bacteria 11093
229 Ga0501047_0005069 3300049581 Bacteria 12361
230 Ga0501048_0002129 3300049582 Bacteria 15100
231 Ga0501048_0005244 3300049582 Bacteria 9874
232 Ga0501048_0019312 3300049582 Bacteria 5001
233 Ga0501068_0003676 3300049584 Bacteria 8300
234 Ga0501068_0040307 3300049584 Bacteria 2803
235 Ga0501069_0005336 3300049585 Bacteria 6683
236 Ga0501069_0102432 3300049585 Bacteria 1626
237 Ga0501070_0003874 3300049586 Bacteria 12907
238 Ga0501071_0000825 3300049587 Bacteria 16530
239 Ga0501071_0026276 3300049587 Bacteria 4085
240 Ga0501072_0000985 3300049588 Bacteria 21023
241 Ga0501072_0004123 3300049588 Bacteria 11000
242 Ga0501073_0002451 3300049589 Bacteria 13855
243 Ga0501074_0001367 3300049590 Bacteria 16187
244 Ga0501074_0002034 3300049590 Bacteria 13960
245 Ga0501075_0000021 3300049591 Bacteria 66125
246 Ga0501075_0000050 3300049591 Bacteria 49555
247 Ga0501076_0000008 3300049592 Bacteria 121885
248 Ga0501076_0000070 3300049592 Bacteria 50841
249 Ga0501076_0020029 3300049592 Bacteria 5117
250 Ga0501077_0000022 3300049593 Bacteria 77945
251 Ga0501079_0001769 3300049741 Bacteria 15409
252 Ga0501079_0025626 3300049741 Bacteria 4520
253 Ga0501079_0033661 3300049741 Bacteria 3942
254 Ga0501079_0302474 3300049741 Bacteria 1252
255 Ga0501080_0001332 3300049742 Bacteria 20587
256 Ga0501080_0009288 3300049742 Bacteria 8966
257 Ga0501080_0124962 3300049742 Bacteria 2383
258 Ga0501081_0000039 3300049743 Bacteria 48570
259 Ga0501081_0001028 3300049743 Bacteria 16673
260 Ga0501081_0184388 3300049743 Bacteria 1510
261 Ga0501083_0002940 3300049744 Bacteria 11799
262 Ga0501083_0013831 3300049744 Bacteria 5643
263 Ga0501035_0000826 3300049822 Bacteria 33043
264 Ga0501035_0015423 3300049822 Bacteria 7048
265 Ga0501044_0004852 3300049823 Bacteria 15037
266 Ga0501044_0198300 3300049823 Bacteria 1966
267 Ga0501045_0001097 3300049824 Bacteria 17895
268 Ga0501045_0068567 3300049824 Bacteria 2606
269 Ga0501045_0114052 3300049824 Bacteria 2004
270 nmdc:mga08y16_30508_c1 3300050511 Bacteria 5674
271 nmdc:mga0rr50_2204_c1 3300050513 Bacteria 10930
272 nmdc:mga08x19_32234_c1 3300050514 Bacteria 3301
273 nmdc:mga08x19_8940_c1 3300050514 Bacteria 5977
274 nmdc:mga0a205_14298_c1 3300050515 Bacteria 7402
275 Ga0501084_0000088 3300054114 Bacteria 66729
276 Ga0501084_0004068 3300054114 Bacteria 11912
277 Ga0501084_0005332 3300054114 Bacteria 10529
278 Ga0590071_013383 3300059421 Bacteria 1920
279 Ga0590075_012745 3300059424 Bacteria 2044
280 Ga0590077_014865 3300059426 Bacteria 1623
281 Ga0501082_0002539 3300060353 Bacteria 15986
282 Ga0501082_0024639 3300060353 Bacteria 5186
283 Ga0501082_0162636 3300060353 Bacteria 1940
284 Ga0501082_0329690 3300060353 Bacteria 1330
285 Ga0530510_0000012 3300061734 Bacteria 115789

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031731 Ga0307405_10174272 Ga0307405_101742722 246
2 3300031911 Ga0307412_10118509 Ga0307412_101185092 246
3 3300032002 Ga0307416_100159351 Ga0307416_1001593512 246
4 3300032004 Ga0307414_10091227 Ga0307414_100912273 246
5 3300032005 Ga0307411_10111196 Ga0307411_101111963 246
6 3300032126 Ga0307415_100538194 Ga0307415_1005381941 246
7 3300025916 Ga0207663_10145629 Ga0207663_101456292 251
8 3300014969 Ga0157376_10336965 Ga0157376_103369652 253
9 3300026035 Ga0207703_10275448 Ga0207703_102754482 256
10 3300042876 Ga0451577_0164240 Ga0451577_0164240_1008_1811 259
11 3300035092 Ga0373952_0023563 Ga0373952_0023563_146_994 261
12 3300044712 Ga0453684_0438098 Ga0453684_0438098_26_1102 261
13 3300009147 Ga0114129_10055625 Ga0114129_100556257 262
14 3300014325 Ga0163163_10000001 Ga0163163_10000001208 264
15 3300005843 Ga0068860_100002245 Ga0068860_10000224512 265
16 3300006237 Ga0097621_100428980 Ga0097621_1004289802 265
17 3300006358 Ga0068871_100201963 Ga0068871_1002019632 265
18 3300028381 Ga0268264_10009514 Ga0268264_100095149 265
19 3300006914 Ga0075436_100021059 Ga0075436_1000210592 266
20 3300010375 Ga0105239_10091397 Ga0105239_100913972 266
21 3300035084 Ga0373928_0030309 Ga0373928_0030309_208_1026 266
22 3300050514 nmdc:mga08x19_8940_c1 nmdc:mga08x19_8940_c1_1735_2535 266
23 3300005347 Ga0070668_100119126 Ga0070668_1001191263 267
24 3300005356 Ga0070674_100145854 Ga0070674_1001458541 267
25 3300005456 Ga0070678_100015596 Ga0070678_1000155962 267
26 3300009177 Ga0105248_10472984 Ga0105248_104729842 267
27 3300025893 Ga0207682_10076943 Ga0207682_100769432 267
28 3300025972 Ga0207668_10194279 Ga0207668_101942792 267
29 3300026121 Ga0207683_10018386 Ga0207683_100183862 267
30 3300031665 Ga0316575_10042904 Ga0316575_100429042 267
31 3300035398 Ga0316574_0322018 Ga0316574_0322018_23_829 267
32 3300013306 Ga0163162_10070953 Ga0163162_100709535 269
33 3300014325 Ga0163163_10155589 Ga0163163_101555893 269
34 3300014968 Ga0157379_10126706 Ga0157379_101267061 269
35 3300006844 Ga0075428_100001289 Ga0075428_10000128925 270
36 3300009094 Ga0111539_10000633 Ga0111539_100006336 270
37 3300028800 Ga0265338_10016718 Ga0265338_100167182 270
38 3300005467 Ga0070706_100299075 Ga0070706_1002990752 271
39 3300005468 Ga0070707_100006652 Ga0070707_1000066523 271
40 3300005471 Ga0070698_100002036 Ga0070698_10000203614 271
41 3300005518 Ga0070699_100001905 Ga0070699_10000190512 271
42 3300005536 Ga0070697_100023491 Ga0070697_1000234914 271
43 3300006852 Ga0075433_10003888 Ga0075433_100038888 271
44 3300006871 Ga0075434_100023737 Ga0075434_1000237378 271
45 3300006914 Ga0075436_100120076 Ga0075436_1001200763 271
46 3300007076 Ga0075435_100013833 Ga0075435_1000138338 271
47 3300009177 Ga0105248_10359127 Ga0105248_103591272 271
48 3300025922 Ga0207646_10085952 Ga0207646_100859522 271
49 3300025939 Ga0207665_10007006 Ga0207665_100070068 271
50 3300025941 Ga0207711_10467936 Ga0207711_104679362 271
51 3300039447 Ga0436361_1121322 Ga0436361_1121322_258_1115 271
52 3300050513 nmdc:mga0rr50_2204_c1 nmdc:mga0rr50_2204_c1_4185_5000 271
53 3300050514 nmdc:mga08x19_32234_c1 nmdc:mga08x19_32234_c1_1391_2206 271
54 3300050515 nmdc:mga0a205_14298_c1 nmdc:mga0a205_14298_c1_1327_2142 271
55 3300046683 Ga0495658_0095285 Ga0495658_0095285_522_1376 272
56 3300047322 Ga0495680_0368099 Ga0495680_0368099_80_934 272
57 3300049568 Ga0501031_0006928 Ga0501031_0006928_3200_4024 272
58 3300049569 Ga0501032_0190308 Ga0501032_0190308_12_836 272
59 3300049570 Ga0501033_0038014 Ga0501033_0038014_455_1279 272
60 3300049572 Ga0501036_0001299 Ga0501036_0001299_12471_13295 272
61 3300049572 Ga0501036_0137827 Ga0501036_0137827_142_960 272
62 3300049574 Ga0501038_0001040 Ga0501038_0001040_12410_13234 272
63 3300049575 Ga0501039_0001916 Ga0501039_0001916_500_1324 272
64 3300049577 Ga0501041_0001037 Ga0501041_0001037_8015_8839 272
65 3300049577 Ga0501041_0152973 Ga0501041_0152973_39_896 272
66 3300049578 Ga0501042_0000469 Ga0501042_0000469_7593_8417 272
67 3300049580 Ga0501046_0003123 Ga0501046_0003123_2017_2841 272
68 3300049582 Ga0501048_0005244 Ga0501048_0005244_2679_3503 272
69 3300049584 Ga0501068_0040307 Ga0501068_0040307_498_1322 272
70 3300049585 Ga0501069_0102432 Ga0501069_0102432_436_1260 272
71 3300049587 Ga0501071_0000825 Ga0501071_0000825_1240_2064 272
72 3300049588 Ga0501072_0004123 Ga0501072_0004123_5526_6350 272
73 3300049590 Ga0501074_0001367 Ga0501074_0001367_6882_7706 272
74 3300049591 Ga0501075_0000050 Ga0501075_0000050_5389_6213 272
75 3300049592 Ga0501076_0000008 Ga0501076_0000008_113236_114060 272
76 3300049593 Ga0501077_0000022 Ga0501077_0000022_12463_13287 272
77 3300049741 Ga0501079_0033661 Ga0501079_0033661_2747_3571 272
78 3300049741 Ga0501079_0302474 Ga0501079_0302474_98_955 272
79 3300049742 Ga0501080_0001332 Ga0501080_0001332_4297_5121 272
80 3300049743 Ga0501081_0000039 Ga0501081_0000039_32322_33146 272
81 3300049743 Ga0501081_0184388 Ga0501081_0184388_20_838 272
82 3300049744 Ga0501083_0013831 Ga0501083_0013831_3901_4725 272
83 3300049822 Ga0501035_0015423 Ga0501035_0015423_2342_3166 272
84 3300049824 Ga0501045_0001097 Ga0501045_0001097_4651_5475 272
85 3300049824 Ga0501045_0068567 Ga0501045_0068567_532_1350 272
86 3300054114 Ga0501084_0000088 Ga0501084_0000088_337_1161 272
87 3300060353 Ga0501082_0162636 Ga0501082_0162636_615_1433 272
88 3300036401 Ga0373937_0099839 Ga0373937_0099839_698_1537 273
89 3300046642 Ga0495634_0107074 Ga0495634_0107074_295_1149 274
90 3300048088 Ga0495602_0034202 Ga0495602_0034202_307_1134 274
91 3300025937 Ga0207669_10260266 Ga0207669_102602662 275
92 3300005338 Ga0068868_100169114 Ga0068868_1001691143 276
93 3300005544 Ga0070686_100172148 Ga0070686_1001721481 276
94 3300006237 Ga0097621_100004739 Ga0097621_10000473912 276
95 3300006358 Ga0068871_100010534 Ga0068871_1000105344 276
96 3300006881 Ga0068865_100016796 Ga0068865_1000167964 276
97 3300025934 Ga0207686_10009551 Ga0207686_100095517 276
98 3300025938 Ga0207704_10008968 Ga0207704_100089685 276
99 3300026023 Ga0207677_10310422 Ga0207677_103104221 276
100 3300046809 Ga0495600_0126365 Ga0495600_0126365_152_1009 276
101 3300048917 Ga0496114_0207200 Ga0496114_0207200_745_1599 276
102 3300059421 Ga0590071_013383 Ga0590071_013383_623_1564 276
103 3300059424 Ga0590075_012745 Ga0590075_012745_275_1216 276
104 3300059426 Ga0590077_014865 Ga0590077_014865_426_1367 276
105 3300005356 Ga0070674_100015051 Ga0070674_1000150514 277
106 3300005459 Ga0068867_100098947 Ga0068867_1000989473 277
107 3300005546 Ga0070696_100138184 Ga0070696_1001381843 277
108 3300009101 Ga0105247_10175413 Ga0105247_101754132 277
109 3300009148 Ga0105243_10066790 Ga0105243_100667904 277
110 3300009176 Ga0105242_10195033 Ga0105242_101950332 277
111 3300014326 Ga0157380_10240176 Ga0157380_102401761 277
112 3300025934 Ga0207686_10112644 Ga0207686_101126442 277
113 3300025937 Ga0207669_10172186 Ga0207669_101721863 277
114 3300025938 Ga0207704_10456963 Ga0207704_104569632 277
115 3300025940 Ga0207691_10418550 Ga0207691_104185501 277
116 3300026075 Ga0207708_10142518 Ga0207708_101425183 277
117 3300026089 Ga0207648_10029421 Ga0207648_100294213 277
118 3300026089 Ga0207648_10182010 Ga0207648_101820102 277
119 3300031731 Ga0307405_10029223 Ga0307405_100292236 277
120 3300031995 Ga0307409_100068543 Ga0307409_1000685434 277
121 3300009098 Ga0105245_10663136 Ga0105245_106631361 278
122 3300014326 Ga0157380_10030451 Ga0157380_100304512 278
123 3300014968 Ga0157379_10030390 Ga0157379_100303903 278
124 3300005436 Ga0070713_100000275 Ga0070713_10000027525 279
125 3300005437 Ga0070710_10029363 Ga0070710_100293633 279
126 3300005719 Ga0068861_100225432 Ga0068861_1002254322 279
127 3300006173 Ga0070716_100003978 Ga0070716_1000039787 279
128 3300006175 Ga0070712_100000411 Ga0070712_10000041115 279
129 3300025905 Ga0207685_10139888 Ga0207685_101398881 279
130 3300025906 Ga0207699_10006172 Ga0207699_100061723 279
131 3300025915 Ga0207693_10000350 Ga0207693_1000035029 279
132 3300025923 Ga0207681_10023103 Ga0207681_100231031 279
133 3300025928 Ga0207700_10000632 Ga0207700_1000063217 279
134 3300025933 Ga0207706_10157577 Ga0207706_101575773 279
135 3300025939 Ga0207665_10007473 Ga0207665_100074736 279
136 3300026118 Ga0207675_100194529 Ga0207675_1001945293 279
137 3300028380 Ga0268265_10041700 Ga0268265_100417004 279
138 3300048918 Ga0496115_0343083 Ga0496115_0343083_144_1004 279
139 3300049568 Ga0501031_0019643 Ga0501031_0019643_2614_3453 279
140 3300049569 Ga0501032_0004869 Ga0501032_0004869_1320_2159 279
141 3300049570 Ga0501033_0002876 Ga0501033_0002876_12906_13745 279
142 3300049571 Ga0501034_0006850 Ga0501034_0006850_4494_5333 279
143 3300049572 Ga0501036_0002999 Ga0501036_0002999_7753_8592 279
144 3300049573 Ga0501037_0003751 Ga0501037_0003751_498_1337 279
145 3300049574 Ga0501038_0006769 Ga0501038_0006769_5689_6528 279
146 3300049579 Ga0501043_0003239 Ga0501043_0003239_11328_12167 279
147 3300049580 Ga0501046_0005720 Ga0501046_0005720_6808_7647 279
148 3300049581 Ga0501047_0005069 Ga0501047_0005069_7029_7868 279
149 3300049582 Ga0501048_0002129 Ga0501048_0002129_6560_7399 279
150 3300049584 Ga0501068_0003676 Ga0501068_0003676_3863_4702 279
151 3300049585 Ga0501069_0005336 Ga0501069_0005336_2060_2899 279
152 3300049586 Ga0501070_0003874 Ga0501070_0003874_7575_8414 279
153 3300049589 Ga0501073_0002451 Ga0501073_0002451_5761_6600 279
154 3300049590 Ga0501074_0002034 Ga0501074_0002034_7541_8380 279
155 3300049592 Ga0501076_0020029 Ga0501076_0020029_87_926 279
156 3300049741 Ga0501079_0001769 Ga0501079_0001769_11045_11884 279
157 3300049742 Ga0501080_0009288 Ga0501080_0009288_6922_7761 279
158 3300049744 Ga0501083_0002940 Ga0501083_0002940_9238_10077 279
159 3300049822 Ga0501035_0000826 Ga0501035_0000826_25465_26304 279
160 3300049823 Ga0501044_0004852 Ga0501044_0004852_4833_5672 279
161 3300054114 Ga0501084_0004068 Ga0501084_0004068_3319_4158 279
162 3300060353 Ga0501082_0002539 Ga0501082_0002539_11215_12054 279
163 3300060353 Ga0501082_0329690 Ga0501082_0329690_14_898 280
164 3300005335 Ga0070666_10037749 Ga0070666_100377491 281
165 3300005337 Ga0070682_100283638 Ga0070682_1002836382 281
166 3300005339 Ga0070660_100025283 Ga0070660_1000252832 281
167 3300005344 Ga0070661_100001963 Ga0070661_1000019633 281
168 3300005353 Ga0070669_100020261 Ga0070669_1000202612 281
169 3300005355 Ga0070671_100013636 Ga0070671_1000136369 281
170 3300005364 Ga0070673_100011978 Ga0070673_1000119784 281
171 3300005366 Ga0070659_100001604 Ga0070659_10000160415 281
172 3300005457 Ga0070662_100000945 Ga0070662_10000094517 281
173 3300005458 Ga0070681_10070535 Ga0070681_100705353 281
174 3300005539 Ga0068853_100008541 Ga0068853_1000085417 281
175 3300005547 Ga0070693_100146008 Ga0070693_1001460082 281
176 3300005563 Ga0068855_100001032 Ga0068855_10000103214 281
177 3300005564 Ga0070664_100001473 Ga0070664_1000014734 281
178 3300005578 Ga0068854_100184610 Ga0068854_1001846102 281
179 3300005614 Ga0068856_100002808 Ga0068856_10000280817 281
180 3300009174 Ga0105241_10670247 Ga0105241_106702471 281
181 3300010375 Ga0105239_10104711 Ga0105239_101047112 281
182 3300013100 Ga0157373_10001435 Ga0157373_100014354 281
183 3300013102 Ga0157371_10002573 Ga0157371_1000257317 281
184 3300013105 Ga0157369_10036396 Ga0157369_100363964 281
185 3300013306 Ga0163162_10353021 Ga0163162_103530212 281
186 3300013307 Ga0157372_10003054 Ga0157372_100030544 281
187 3300025903 Ga0207680_10024508 Ga0207680_100245084 281
188 3300025907 Ga0207645_10017015 Ga0207645_100170154 281
189 3300025919 Ga0207657_10002908 Ga0207657_100029084 281
190 3300025920 Ga0207649_10013104 Ga0207649_100131046 281
191 3300025923 Ga0207681_10019749 Ga0207681_100197491 281
192 3300025926 Ga0207659_10019636 Ga0207659_100196364 281
193 3300025931 Ga0207644_10216429 Ga0207644_102164292 281
194 3300025932 Ga0207690_10001502 Ga0207690_100015024 281
195 3300025933 Ga0207706_10000636 Ga0207706_1000063624 281
196 3300025945 Ga0207679_10001289 Ga0207679_1000128910 281
197 3300025949 Ga0207667_10009245 Ga0207667_1000924512 281
198 3300025960 Ga0207651_10147363 Ga0207651_101473633 281
199 3300025981 Ga0207640_10334259 Ga0207640_103342592 281
200 3300026041 Ga0207639_10004010 Ga0207639_100040102 281
201 3300026067 Ga0207678_10053062 Ga0207678_100530624 281
202 3300026078 Ga0207702_10008296 Ga0207702_100082969 281
203 3300027462 Ga0210000_1010572 Ga0210000_10105721 281
204 3300027471 Ga0209995_1006660 Ga0209995_10066601 281
205 3300027682 Ga0209971_1004981 Ga0209971_10049812 281
206 3300027717 Ga0209998_10010194 Ga0209998_100101942 281
207 3300027876 Ga0209974_10000626 Ga0209974_100006268 281
208 3300048905 Ga0496102_0003788 Ga0496102_0003788_3611_4456 281
209 3300048906 Ga0496103_0127746 Ga0496103_0127746_536_1381 281
210 3300048909 Ga0496106_0002584 Ga0496106_0002584_24_869 281
211 3300048910 Ga0496107_0050167 Ga0496107_0050167_1103_1948 281
212 3300031090 Ga0265760_10002540 Ga0265760_100025407 282
213 3300005617 Ga0068859_100005500 Ga0068859_10000550010 283
214 3300006844 Ga0075428_100001360 Ga0075428_1000013608 283
215 3300006931 Ga0097620_100005500 Ga0097620_10000550010 283
216 3300009148 Ga0105243_10063935 Ga0105243_100639354 283
217 3300009177 Ga0105248_10153547 Ga0105248_101535474 283
218 3300025935 Ga0207709_10154289 Ga0207709_101542892 283
219 3300035724 Ga0373933_0007544 Ga0373933_0007544_776_1627 283
220 3300036401 Ga0373937_0000685 Ga0373937_0000685_14516_15367 283
221 3300046543 Ga0495645_0074260 Ga0495645_0074260_733_1584 283
222 3300046689 Ga0495613_0068487 Ga0495613_0068487_23_874 283
223 3300047471 Ga0495684_0152081 Ga0495684_0152081_90_941 283
224 3300005340 Ga0070689_100015181 Ga0070689_1000151816 284
225 3300005354 Ga0070675_100030516 Ga0070675_1000305167 284
226 3300005365 Ga0070688_100019118 Ga0070688_1000191185 284
227 3300005615 Ga0070702_100147758 Ga0070702_1001477583 284
228 3300005617 Ga0068859_100028416 Ga0068859_1000284163 284
229 3300005843 Ga0068860_100047058 Ga0068860_1000470583 284
230 3300006881 Ga0068865_100190387 Ga0068865_1001903872 284
231 3300006931 Ga0097620_100028417 Ga0097620_1000284173 284
232 3300009094 Ga0111539_10026019 Ga0111539_100260194 284
233 3300009101 Ga0105247_10244949 Ga0105247_102449492 284
234 3300009148 Ga0105243_10537000 Ga0105243_105370002 284
235 3300014968 Ga0157379_10066048 Ga0157379_100660482 284
236 3300025900 Ga0207710_10169770 Ga0207710_101697702 284
237 3300025926 Ga0207659_10001249 Ga0207659_100012497 284
238 3300025936 Ga0207670_10030944 Ga0207670_100309447 284
239 3300025938 Ga0207704_10197683 Ga0207704_101976832 284
240 3300025940 Ga0207691_10115105 Ga0207691_101151052 284
241 3300026095 Ga0207676_10184866 Ga0207676_101848662 284
242 3300027907 Ga0207428_10077165 Ga0207428_100771651 284
243 3300028381 Ga0268264_10059702 Ga0268264_100597027 284
244 3300035724 Ga0373933_0180127 Ga0373933_0180127_150_1004 284
245 3300049572 Ga0501036_0102242 Ga0501036_0102242_1497_2366 284
246 3300049574 Ga0501038_0009869 Ga0501038_0009869_7289_8158 284
247 3300049575 Ga0501039_0118984 Ga0501039_0118984_1042_1911 284
248 3300049576 Ga0501040_0031590 Ga0501040_0031590_2648_3517 284
249 3300049577 Ga0501041_0009309 Ga0501041_0009309_2960_3829 284
250 3300049578 Ga0501042_0011149 Ga0501042_0011149_4851_5720 284
251 3300049582 Ga0501048_0019312 Ga0501048_0019312_782_1651 284
252 3300049587 Ga0501071_0026276 Ga0501071_0026276_2872_3741 284
253 3300049588 Ga0501072_0000985 Ga0501072_0000985_12337_13206 284
254 3300049591 Ga0501075_0000021 Ga0501075_0000021_50538_51407 284
255 3300049592 Ga0501076_0000070 Ga0501076_0000070_18882_19751 284
256 3300049741 Ga0501079_0025626 Ga0501079_0025626_3397_4266 284
257 3300049742 Ga0501080_0124962 Ga0501080_0124962_498_1367 284
258 3300049743 Ga0501081_0001028 Ga0501081_0001028_14241_15110 284
259 3300049823 Ga0501044_0198300 Ga0501044_0198300_806_1660 284
260 3300049824 Ga0501045_0114052 Ga0501045_0114052_635_1504 284
261 3300050511 nmdc:mga08y16_30508_c1 nmdc:mga08y16_30508_c1_1622_2476 284
262 3300054114 Ga0501084_0005332 Ga0501084_0005332_5961_6830 284
263 3300060353 Ga0501082_0024639 Ga0501082_0024639_3743_4612 284
264 3300061734 Ga0530510_0000012 Ga0530510_0000012_79635_80504 284
265 3300046454 Ga0495592_0042563 Ga0495592_0042563_906_1763 285
266 3300046536 Ga0495587_0186996 Ga0495587_0186996_95_952 285
267 3300005536 Ga0070697_100036597 Ga0070697_1000365973 286
268 3300005331 Ga0070670_100009432 Ga0070670_1000094325 287
269 3300005618 Ga0068864_100116315 Ga0068864_1001163153 287
270 3300025925 Ga0207650_10010113 Ga0207650_100101131 287
271 3300025926 Ga0207659_10314878 Ga0207659_103148782 287
272 3300005356 Ga0070674_100368203 Ga0070674_1003682031 289
273 3300009098 Ga0105245_10240063 Ga0105245_102400632 292
274 3300005338 Ga0068868_100025443 Ga0068868_1000254434 294
275 3300005347 Ga0070668_100428996 Ga0070668_1004289961 294
276 3300005455 Ga0070663_100090541 Ga0070663_1000905412 294
277 3300026023 Ga0207677_10017734 Ga0207677_100177344 294
278 3300005290 Ga0065712_10070153 Ga0065712_100701534 300
279 3300005331 Ga0070670_100038764 Ga0070670_1000387644 300
280 3300025315 Ga0207697_10000902 Ga0207697_1000090211 300
281 3300025901 Ga0207688_10022599 Ga0207688_100225993 300
282 3300048904 Ga0496101_0365363 Ga0496101_0365363_197_1099 300
283 3300048911 Ga0496108_0064111 Ga0496108_0064111_296_1198 300
284 3300048912 Ga0496109_0103259 Ga0496109_0103259_1424_2326 300
285 3300048913 Ga0496110_0476954 Ga0496110_0476954_85_987 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

73

172

0.97

PF13847

Methyltransf_31

Methyltransferase domain

66

230

0.94

PF13649

Methyltransf_25

Methyltransferase domain

72

168

0.94

PF08242

Methyltransf_12

Methyltransferase domain

73

170

0.94

PF01170

UPF0020

RMKL-like, methyltransferase domain

25

146

0.89

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

61

198

0.88

PF05148

Methyltransf_8

Hypothetical methyltransferase

117

207

0.87

PF05175

MTS

Methyltransferase small domain

57

197

0.83

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

41

194

0.82

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

50

174

0.8

PF13489

Methyltransf_23

Methyltransferase domain

56

220

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pyj-assembly1.cif.gz_A human apo-comt, single domain swap 0.8852 79 148
1dl5-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase 0.8593 74 181
7r6k-assembly1.cif.gz_q state e2 nucleolar 60s ribosomal intermediate - model for noc2/noc3 region 0.8397 68 150
5k0b-assembly4.cif.gz_D crystal structure of comt in complex with 2,4-dimethyl-5-[3-(1-phenylethyl)-1h-pyrazol-5-yl]-1,3-thiazole 0.8293 78 148
5fhr-assembly1.cif.gz_B crystal structure of y200l mutant of rat catechol-o-methyltransferase in complex with adomet and 3,5-dinitrocatechol 0.8272 78 148
ID Description Score Start End Superfamily
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9468 77 131 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9253 72 137 3.40.50.150
af_Q58847_2_138_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9021 73 148 3.40.50.150
af_I1K0P7_74_216_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8981 73 148 3.40.50.150
af_B7ZXR6_266_358_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.897 68 132 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7Y2YV63-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9329 108 271 GO:0008168
GO:0032259
AF-A0A7C5MMU4-F1-model_v4 FkbM family methyltransferase 0.9232 70 132 GO:0008168
GO:0032259
AF-A0A7Y2YV63-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9221 108 271 GO:0008168
GO:0032259
AF-A0A2V9PP58-F1-model_v4 Methyltransferase domain-containing protein 0.9208 75 148
AF-A0A7W0W5C5-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9194 1 271 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
75.95 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map