F386908

General Info

Members Datasets Scaffolds Average Seq Length
285 196 284 362

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0051513|Ga0373923_0051513_84_1268
Length 394
Sequence MHVMVPDVGVSRGVHPPVLIEILSAWLIMPLLSRWPRGEDTPVPPPARSVVIDAGHRPRLEALARSRTAPLREVQRARIVLAAADGASNAAIARDLSITEHTVRTWRNRFAEHGLRGLADRPRPGRPPIYGPDTHLRIVAAVTSELPEADSVWSHRLLAEYLHETDGISASQIGRILADLDLKPHRVRGWLTRRADPAFFTKAAEVCDLYLHQPEGSVVICTDEKTAIAARSRKHPGQPCQPGRVTRREFEYVRHGTVSIIAALDVHSGQVHTERIGRNNSDAFIDFLTRLEQRIDPTLTIHLVLDNGSSHTSKTTKQWLREHPRFQPHYTPAHASWLDQAELFFSILTRRLLRRGEFTSQQDLADRIENFVAVYNRTAKPFRWTYDGRPLKAA

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
76 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
77 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
80 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
81 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
82 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
94 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
97 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
98 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
99 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
100 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
101 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
102 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
103 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
104 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
105 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
106 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
107 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
108 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
196 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.35
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0.35
Rhizoplane 1.75
Rhizosphere 94.39
Stem 0
Stem Tuber 0
Unclassified 3.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10028821 3300003373 Bacteria 1440
2 Ga0070683_100243909 3300005329 Bacteria 1709
3 Ga0070682_100106840 3300005337 Bacteria 1858
4 Ga0070661_100127904 3300005344 Bacteria 1906
5 Ga0070659_100150603 3300005366 Bacteria 1898
6 Ga0070709_10138316 3300005434 Bacteria 1670
7 Ga0070714_100002272 3300005435 Bacteria 14127
8 Ga0070714_100044007 3300005435 Bacteria 3778
9 Ga0070714_100091291 3300005435 Bacteria 2668
10 Ga0070710_10093299 3300005437 Bacteria 1779
11 Ga0070711_100208917 3300005439 Bacteria 1511
12 Ga0070708_100163587 3300005445 Bacteria 2074
13 Ga0070708_100293787 3300005445 Bacteria 1530
14 Ga0070708_100374463 3300005445 Bacteria 1342
15 Ga0070663_100122103 3300005455 Bacteria 1969
16 Ga0070662_100235665 3300005457 Bacteria 1466
17 Ga0070706_100057197 3300005467 Bacteria 3598
18 Ga0070706_100090812 3300005467 Bacteria 2832
19 Ga0070679_100165417 3300005530 Bacteria 2185
20 Ga0070684_100208630 3300005535 Bacteria 1780
21 Ga0070695_100272660 3300005545 Bacteria 1240
22 Ga0068855_100511915 3300005563 Bacteria 1303
23 Ga0070664_100038128 3300005564 Bacteria 4044
24 Ga0068857_100199548 3300005577 Bacteria 1823
25 Ga0068856_100224349 3300005614 Bacteria 1894
26 Ga0068852_100099778 3300005616 Bacteria 2618
27 Ga0068861_100149753 3300005719 Bacteria 1913
28 Ga0081455_10016086 3300005937 Bacteria 7236
29 Ga0081455_10218041 3300005937 Bacteria 1416
30 Ga0081538_10004093 3300005981 Bacteria 13557
31 Ga0081538_10017846 3300005981 Bacteria 5362
32 Ga0081538_10054403 3300005981 Bacteria 2367
33 Ga0070717_10140222 3300006028 Bacteria 2085
34 Ga0070716_100125342 3300006173 Bacteria 1615
35 Ga0070712_100219359 3300006175 Bacteria 1505
36 Ga0075428_100301847 3300006844 Bacteria 1721
37 Ga0075428_100530893 3300006844 Bacteria 1258
38 Ga0075430_100092116 3300006846 Bacteria 2534
39 Ga0075431_100196972 3300006847 Bacteria 2062
40 Ga0075431_100241065 3300006847 Bacteria 1839
41 Ga0075434_100029816 3300006871 Bacteria 5370
42 Ga0075429_100030851 3300006880 Bacteria 4658
43 Ga0075429_100050937 3300006880 Bacteria 3602
44 Ga0075429_100157677 3300006880 Bacteria 1987
45 Ga0075429_100290070 3300006880 Bacteria 1433
46 Ga0075435_100296384 3300007076 Bacteria 1383
47 Ga0111539_10494952 3300009094 Bacteria 1424
48 Ga0114129_10074609 3300009147 Bacteria 4725
49 Ga0114129_10076371 3300009147 Bacteria 4664
50 Ga0114129_10835936 3300009147 Bacteria 1172
51 Ga0157369_10298957 3300013105 Bacteria 1675
52 Ga0163162_10227799 3300013306 Bacteria 1994
53 Ga0157375_10405524 3300013308 Bacteria 1530
54 Ga0163163_10160968 3300014325 Bacteria 2290
55 Ga0182008_10069440 3300014497 Bacteria 1733
56 Ga0182007_10051216 3300015262 Bacteria 1362
57 Ga0163161_10269795 3300017792 Bacteria 1331
58 Ga0207692_10103008 3300025898 Bacteria 1571
59 Ga0207688_10070346 3300025901 Bacteria 1984
60 Ga0207699_10142376 3300025906 Bacteria 1577
61 Ga0207705_10140312 3300025909 Bacteria 1804
62 Ga0207684_10010683 3300025910 Bacteria 8065
63 Ga0207684_10329253 3300025910 Unclassified 1316
64 Ga0207707_10184338 3300025912 Bacteria 1821
65 Ga0207693_10135481 3300025915 Bacteria 1936
66 Ga0207693_10148291 3300025915 Bacteria 1844
67 Ga0207700_10454381 3300025928 Bacteria 1129
68 Ga0207664_10004314 3300025929 Bacteria 9628
69 Ga0207706_10035090 3300025933 Bacteria 4461
70 Ga0207661_10211108 3300025944 Bacteria 1711
71 Ga0207667_10537699 3300025949 Bacteria 1183
72 Ga0207712_10361336 3300025961 Bacteria 1210
73 Ga0207668_10060168 3300025972 Bacteria 2665
74 Ga0207702_10235738 3300026078 Bacteria 1712
75 Ga0207674_10262351 3300026116 Bacteria 1675
76 Ga0207675_100246194 3300026118 Bacteria 1729
77 Ga0207698_10055996 3300026142 Bacteria 3042
78 Ga0265765_1005666 3300030879 Bacteria 1314
79 Ga0307513_10194318 3300031456 Bacteria 1877
80 Ga0307513_10246140 3300031456 Bacteria 1588
81 Ga0307408_100096683 3300031548 Bacteria 2241
82 Ga0307408_100442701 3300031548 Bacteria 1125
83 Ga0307516_10014342 3300031730 Bacteria 8391
84 Ga0307516_10168373 3300031730 Bacteria 1933
85 Ga0307405_10484605 3300031731 Bacteria 988
86 Ga0307413_10038838 3300031824 Bacteria 2762
87 Ga0307413_10118870 3300031824 Bacteria 1785
88 Ga0307413_10281338 3300031824 Bacteria 1251
89 Ga0307410_10313941 3300031852 Unclassified 1241
90 Ga0307410_10321683 3300031852 Bacteria 1227
91 Ga0307406_10228157 3300031901 Bacteria 1389
92 Ga0307406_10242668 3300031901 Bacteria 1352
93 Ga0307407_10135107 3300031903 Bacteria 1583
94 Ga0307407_10243871 3300031903 Bacteria 1227
95 Ga0307409_100102432 3300031995 Bacteria 2378
96 Ga0307409_100546232 3300031995 Unclassified 1136
97 Ga0307416_100102395 3300032002 Bacteria 2496
98 Ga0307416_100322556 3300032002 Unclassified 1548
99 Ga0307416_100364027 3300032002 Bacteria 1469
100 Ga0307416_100658586 3300032002 Bacteria 1132
101 Ga0307414_10271584 3300032004 Bacteria 1420
102 Ga0307411_10105159 3300032005 Bacteria 2006
103 Ga0307415_100082553 3300032126 Bacteria 2299
104 Ga0307415_100084443 3300032126 Unclassified 2278
105 Ga0307415_100191429 3300032126 Bacteria 1614
106 Ga0307415_100301138 3300032126 Unclassified 1328
107 Ga0307415_100345957 3300032126 Unclassified 1249
108 Ga0307415_100376038 3300032126 Unclassified 1204
109 Ga0307507_10071534 3300033179 Bacteria 3135
110 Ga0373934_0052361 3300035086 Bacteria 1618
111 Ga0373923_0024682 3300035111 Bacteria 2374
112 Ga0373923_0051513 3300035111 Bacteria 1727
113 Ga0373936_0018063 3300035113 Bacteria 2720
114 Ga0373936_0049852 3300035113 Unclassified 1692
115 Ga0373953_0000273 3300035117 Bacteria 14158
116 Ga0373953_0057096 3300035117 Bacteria 1588
117 Ga0373954_0047901 3300035118 Bacteria 2001
118 Ga0373954_0070084 3300035118 Bacteria 1665
119 Ga0373954_0072168 3300035118 Bacteria 1641
120 Ga0373956_0068494 3300035119 Bacteria 1616
121 Ga0373956_0071949 3300035119 Bacteria 1578
122 Ga0373957_0001230 3300035120 Bacteria 6846
123 Ga0373957_0030803 3300035120 Bacteria 1967
124 Ga0373955_0024250 3300035172 Bacteria 3100
125 Ga0373955_0045756 3300035172 Bacteria 2362
126 Ga0373955_0106181 3300035172 Bacteria 1618
127 Ga0373924_0051585 3300035410 Bacteria 1706
128 Ga0373924_0060941 3300035410 Bacteria 1578
129 Ga0373935_0095185 3300035692 Bacteria 1955
130 Ga0373935_0126864 3300035692 Bacteria 1710
131 Ga0373933_0086155 3300035724 Bacteria 1932
132 Ga0373933_0130736 3300035724 Bacteria 1578
133 Ga0373933_0203233 3300035724 Bacteria 1268
134 Ga0373937_0099871 3300036401 Bacteria 2692
135 Ga0373937_0105262 3300036401 Bacteria 2621
136 Ga0373937_0171415 3300036401 Bacteria 2036
137 Ga0373937_0255218 3300036401 Unclassified 1653
138 Ga0373937_0278751 3300036401 Bacteria 1578
139 Ga0395900_0072829 3300037418 Bacteria 3531
140 Ga0395900_0168104 3300037418 Bacteria 2234
141 Ga0395898_0208505 3300037466 Bacteria 1864
142 Ga0395905_0226567 3300037471 Bacteria 1748
143 Ga0436364_1226908 3300037853 Bacteria 2164
144 Ga0436364_1306821 3300037853 Bacteria 1716
145 Ga0395901_0006347 3300038443 Bacteria 11977
146 Ga0395901_0040352 3300038443 Bacteria 4834
147 Ga0395901_0295961 3300038443 Bacteria 1678
148 Ga0395901_0491525 3300038443 Bacteria 1250
149 Ga0395901_0540934 3300038443 Unclassified 1181
150 Ga0451791_0426859 3300041451 Bacteria 2381
151 Ga0451843_0000369 3300041509 Bacteria 2588
152 Ga0451853_2142169 3300041512 Bacteria 2615
153 Ga0439443_011430 3300042003 Unclassified 1300
154 Ga0439448_0028913 3300042005 Bacteria 1752
155 Ga0439448_0090884 3300042005 Unclassified 1031
156 Ga0439450_001433 3300042008 Bacteria 3489
157 Ga0439450_022540 3300042008 Bacteria 1360
158 Ga0439451_008361 3300042009 Bacteria 2099
159 Ga0439454_005905 3300042011 Bacteria 1483
160 Ga0439455_0041431 3300042012 Bacteria 1180
161 Ga0439456_016576 3300042013 Bacteria 1541
162 Ga0439463_002242 3300042016 Bacteria 4959
163 Ga0439463_018782 3300042016 Bacteria 1721
164 Ga0439444_0001067 3300042437 Bacteria 3412
165 Ga0439464_0033251 3300042439 Bacteria 1451
166 Ga0439460_0031351 3300042461 Bacteria 1516
167 Ga0450916_007760 3300042530 Bacteria 1294
168 Ga0439440_0016179 3300042993 Bacteria 1628
169 Ga0439440_0020344 3300042993 Bacteria 1487
170 Ga0439440_0030638 3300042993 Bacteria 1267
171 Ga0439440_0031289 3300042993 Bacteria 1257
172 Ga0495638_0113730 3300046460 Bacteria 1605
173 Ga0495641_0056347 3300046461 Bacteria 1782
174 Ga0495651_0165715 3300046462 Bacteria 1578
175 Ga0495651_0189317 3300046462 Bacteria 1449
176 Ga0495653_0151687 3300046463 Bacteria 1618
177 Ga0495639_0067245 3300046475 Bacteria 1650
178 Ga0495662_0050579 3300046476 Bacteria 2006
179 Ga0495664_0022174 3300046477 Bacteria 3677
180 Ga0495664_0046973 3300046477 Bacteria 2561
181 Ga0495664_0068196 3300046477 Bacteria 2122
182 Ga0495596_0048412 3300046500 Bacteria 1667
183 Ga0495607_0102949 3300046501 Bacteria 1526
184 Ga0495583_0045078 3300046506 Bacteria 2041
185 Ga0495606_0089987 3300046507 Bacteria 1890
186 Ga0495608_0119633 3300046511 Bacteria 1689
187 Ga0495608_0134777 3300046511 Bacteria 1578
188 Ga0495618_0025964 3300046514 Bacteria 3639
189 Ga0495618_0054072 3300046514 Bacteria 2539
190 Ga0495618_0220950 3300046514 Bacteria 1195
191 Ga0495620_0038792 3300046515 Bacteria 2111
192 Ga0495628_0183132 3300046516 Bacteria 1583
193 Ga0495643_0041453 3300046522 Bacteria 2509
194 Ga0495666_0071809 3300046526 Bacteria 1645
195 Ga0495652_0152370 3300046529 Bacteria 1804
196 Ga0495652_0180823 3300046529 Bacteria 1618
197 Ga0495640_0088083 3300046533 Bacteria 2052
198 Ga0495640_0117284 3300046533 Bacteria 1733
199 Ga0495587_0110580 3300046536 Bacteria 1578
200 Ga0495645_0012519 3300046543 Bacteria 5979
201 Ga0495645_0066925 3300046543 Bacteria 2594
202 Ga0495667_0077938 3300046559 Bacteria 2154
203 Ga0495667_0130422 3300046559 Bacteria 1621
204 Ga0495668_0081580 3300046616 Bacteria 1774
205 Ga0495634_0119086 3300046642 Bacteria 1692
206 Ga0495635_0081138 3300046663 Bacteria 2219
207 Ga0495659_0010368 3300046664 Bacteria 2987
208 Ga0495659_0031963 3300046664 Bacteria 1839
209 Ga0495657_0083250 3300046675 Bacteria 2065
210 Ga0495657_0129536 3300046675 Bacteria 1581
211 Ga0495599_0098793 3300046678 Bacteria 1819
212 Ga0495623_0081525 3300046679 Bacteria 2000
213 Ga0495623_0156631 3300046679 Unclassified 1342
214 Ga0495646_0015760 3300046680 Bacteria 4798
215 Ga0495658_0065845 3300046683 Bacteria 2091
216 Ga0495600_0135738 3300046809 Bacteria 1598
217 Ga0495660_0104686 3300046810 Bacteria 1451
218 Ga0495581_0024769 3300047315 Bacteria 3477
219 Ga0495581_0110031 3300047315 Bacteria 1602
220 Ga0495604_0152359 3300047317 Bacteria 1641
221 Ga0495604_0155333 3300047317 Bacteria 1621
222 Ga0495636_0024226 3300047318 Bacteria 2460
223 Ga0495636_0075965 3300047318 Bacteria 1440
224 Ga0495674_0084611 3300047319 Bacteria 2718
225 Ga0495672_0204824 3300047320 Bacteria 984
226 Ga0495680_0162854 3300047322 Bacteria 1618
227 Ga0495687_013624 3300047443 Bacteria 4229
228 Ga0495675_0122574 3300047444 Bacteria 1618
229 Ga0495684_0096952 3300047471 Bacteria 2231
230 Ga0495684_0204284 3300047471 Bacteria 1455
231 Ga0495602_0081808 3300048088 Plasmid 2713
232 Ga0495602_0158421 3300048088 Bacteria 1770
233 Ga0495615_0004980 3300048090 Bacteria 2359
234 Ga0496104_0233885 3300048907 Bacteria 1749
235 Ga0496105_0128099 3300048908 Bacteria 2093
236 Ga0496109_0102093 3300048912 Bacteria 2662
237 Ga0496113_0189373 3300048916 Bacteria 1633
238 Ga0501031_0196765 3300049568 Bacteria 1315
239 Ga0501033_0176718 3300049570 Bacteria 1531
240 Ga0501034_0435162 3300049571 Bacteria 1231
241 Ga0501036_0206663 3300049572 Bacteria 1650
242 Ga0501037_0202434 3300049573 Bacteria 1402
243 Ga0501038_0232247 3300049574 Bacteria 1467
244 Ga0501039_0257941 3300049575 Bacteria 1370
245 Ga0501040_0205599 3300049576 Bacteria 1398
246 Ga0501041_0037789 3300049577 Bacteria 2926
247 Ga0501043_0051976 3300049579 Bacteria 3220
248 Ga0501048_0242329 3300049582 Bacteria 1279
249 Ga0501068_0006176 3300049584 Bacteria 6591
250 Ga0501069_0105377 3300049585 Bacteria 1602
251 Ga0501070_0215209 3300049586 Bacteria 1576
252 Ga0501071_0065495 3300049587 Bacteria 2638
253 Ga0501072_0291032 3300049588 Bacteria 1298
254 Ga0501073_0133693 3300049589 Bacteria 1719
255 Ga0501074_0244699 3300049590 Bacteria 1275
256 Ga0501075_0323246 3300049591 Bacteria 1175
257 Ga0501076_0005984 3300049592 Bacteria 8783
258 Ga0501079_0287929 3300049741 Bacteria 1284
259 Ga0501080_0370940 3300049742 Bacteria 1290
260 Ga0501081_0049867 3300049743 Bacteria 2883
261 Ga0501083_0082006 3300049744 Bacteria 2138
262 Ga0501035_0110922 3300049822 Bacteria 2404
263 Ga0501044_0175511 3300049823 Bacteria 2112
264 Ga0501045_0265670 3300049824 Bacteria 1277
265 nmdc:mga05p37_334461_c1 3300050507 Bacteria 1788
266 nmdc:mga05p37_47813_c1 3300050507 Bacteria 5261
267 nmdc:mga05p37_50094_c1 3300050507 Bacteria 5136
268 nmdc:mga05p37_651262_c1 3300050507 Bacteria 1180
269 nmdc:mga09592_304467_c1 3300050508 Bacteria 1382
270 nmdc:mga09592_72288_c1 3300050508 Bacteria 2929
271 nmdc:mga06r32_109321_c1 3300050510 Bacteria 2719
272 nmdc:mga06r32_438354_c1 3300050510 Bacteria 1287
273 nmdc:mga0rr50_215088_c1 3300050513 Bacteria 1585
274 Ga0495601_0021259 3300053077 Bacteria 3972
275 Ga0495601_0121633 3300053077 Bacteria 1695
276 Ga0495601_0139962 3300053077 Bacteria 1578
277 Ga0495612_0007394 3300053078 Bacteria 4489
278 Ga0495595_0021657 3300053084 Bacteria 2810
279 Ga0495619_0071697 3300053085 Bacteria 2318
280 Ga0495619_0078928 3300053085 Bacteria 2213
281 Ga0500660_118688 3300053100 Bacteria 1106
282 Ga0501084_0342081 3300054114 Bacteria 1263
283 Ga0501082_0390346 3300060353 Bacteria 1214
284 Ga0530510_0283200 3300061734 Bacteria 1238

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0204824 Ga0495672_0204824_91_909 242
2 3300042005 Ga0439448_0090884 Ga0439448_0090884_33_926 284
3 3300050507 nmdc:mga05p37_651262_c1 nmdc:mga05p37_651262_c1_12_914 285
4 3300031731 Ga0307405_10484605 Ga0307405_104846051 287
5 3300053100 Ga0500660_118688 Ga0500660_118688_33_1070 296
6 3300046477 Ga0495664_0068196 Ga0495664_0068196_145_1080 298
7 3300053077 Ga0495601_0139962 Ga0495601_0139962_182_1117 298
8 3300014497 Ga0182008_10069440 Ga0182008_100694401 302
9 3300009147 Ga0114129_10074609 Ga0114129_100746092 307
10 3300046514 Ga0495618_0025964 Ga0495618_0025964_2020_2982 307
11 3300036401 Ga0373937_0255218 Ga0373937_0255218_634_1602 309
12 3300046810 Ga0495660_0104686 Ga0495660_0104686_49_1020 310
13 3300009147 Ga0114129_10076371 Ga0114129_100763714 313
14 3300048916 Ga0496113_0189373 Ga0496113_0189373_355_1491 315
15 3300005981 Ga0081538_10054403 Ga0081538_100544033 322
16 3300005344 Ga0070661_100127904 Ga0070661_1001279042 323
17 3300005530 Ga0070679_100165417 Ga0070679_1001654172 323
18 3300005564 Ga0070664_100038128 Ga0070664_1000381284 323
19 3300005577 Ga0068857_100199548 Ga0068857_1001995481 323
20 3300005614 Ga0068856_100224349 Ga0068856_1002243493 323
21 3300014325 Ga0163163_10160968 Ga0163163_101609683 323
22 3300025912 Ga0207707_10184338 Ga0207707_101843382 323
23 3300026078 Ga0207702_10235738 Ga0207702_102357383 323
24 3300026116 Ga0207674_10262351 Ga0207674_102623511 323
25 3300042008 Ga0439450_001433 Ga0439450_001433_1011_2162 323
26 3300042016 Ga0439463_018782 Ga0439463_018782_481_1632 323
27 3300042993 Ga0439440_0016179 Ga0439440_0016179_430_1581 323
28 3300047315 Ga0495581_0110031 Ga0495581_0110031_440_1558 323
29 3300048907 Ga0496104_0233885 Ga0496104_0233885_448_1614 323
30 3300048908 Ga0496105_0128099 Ga0496105_0128099_641_1807 323
31 3300048912 Ga0496109_0102093 Ga0496109_0102093_536_1702 323
32 3300005366 Ga0070659_100150603 Ga0070659_1001506032 324
33 3300006175 Ga0070712_100219359 Ga0070712_1002193592 324
34 3300025915 Ga0207693_10135481 Ga0207693_101354812 324
35 3300037418 Ga0395900_0168104 Ga0395900_0168104_100_1221 324
36 3300038443 Ga0395901_0040352 Ga0395901_0040352_721_1842 324
37 3300046664 Ga0495659_0031963 Ga0495659_0031963_669_1790 324
38 3300047318 Ga0495636_0075965 Ga0495636_0075965_282_1403 324
39 3300048090 Ga0495615_0004980 Ga0495615_0004980_386_1507 324
40 3300005467 Ga0070706_100090812 Ga0070706_1000908123 325
41 3300005981 Ga0081538_10017846 Ga0081538_100178465 325
42 3300025910 Ga0207684_10010683 Ga0207684_100106839 325
43 3300005435 Ga0070714_100002272 Ga0070714_1000022728 326
44 3300005937 Ga0081455_10016086 Ga0081455_100160867 326
45 3300025929 Ga0207664_10004314 Ga0207664_100043145 326
46 3300046501 Ga0495607_0102949 Ga0495607_0102949_19_1038 326
47 3300038443 Ga0395901_0540934 Ga0395901_0540934_82_1137 328
48 3300031824 Ga0307413_10281338 Ga0307413_102813381 329
49 3300031852 Ga0307410_10321683 Ga0307410_103216831 329
50 3300031901 Ga0307406_10242668 Ga0307406_102426681 329
51 3300031903 Ga0307407_10243871 Ga0307407_102438711 329
52 3300032002 Ga0307416_100658586 Ga0307416_1006585861 329
53 3300032126 Ga0307415_100082553 Ga0307415_1000825533 329
54 3300032126 Ga0307415_100084443 Ga0307415_1000844433 329
55 3300041512 Ga0451853_2142169 Ga0451853_2142169_318_1463 329
56 3300046664 Ga0495659_0010368 Ga0495659_0010368_109_1137 329
57 3300047318 Ga0495636_0024226 Ga0495636_0024226_1306_2334 329
58 iso_pu_bacteria 8055412473 8055418396 329
59 3300005445 Ga0070708_100374463 Ga0070708_1003744631 330
60 3300005937 Ga0081455_10218041 Ga0081455_102180412 330
61 3300006880 Ga0075429_100050937 Ga0075429_1000509373 330
62 3300031824 Ga0307413_10038838 Ga0307413_100388384 330
63 3300042009 Ga0439451_008361 Ga0439451_008361_595_1746 330
64 3300042993 Ga0439440_0031289 Ga0439440_0031289_72_1223 330
65 3300050508 nmdc:mga09592_72288_c1 nmdc:mga09592_72288_c1_1681_2841 330
66 3300031456 Ga0307513_10194318 Ga0307513_101943183 331
67 3300031730 Ga0307516_10014342 Ga0307516_100143427 331
68 3300035086 Ga0373934_0052361 Ga0373934_0052361_432_1589 331
69 3300035111 Ga0373923_0024682 Ga0373923_0024682_761_1918 331
70 3300035113 Ga0373936_0018063 Ga0373936_0018063_1109_2266 331
71 3300035117 Ga0373953_0000273 Ga0373953_0000273_12567_13724 331
72 3300035118 Ga0373954_0047901 Ga0373954_0047901_339_1490 331
73 3300035118 Ga0373954_0072168 Ga0373954_0072168_452_1609 331
74 3300035119 Ga0373956_0071949 Ga0373956_0071949_30_1187 331
75 3300035120 Ga0373957_0001230 Ga0373957_0001230_5258_6415 331
76 3300035172 Ga0373955_0106181 Ga0373955_0106181_432_1589 331
77 3300035410 Ga0373924_0060941 Ga0373924_0060941_392_1549 331
78 3300035692 Ga0373935_0095185 Ga0373935_0095185_448_1605 331
79 3300035724 Ga0373933_0130736 Ga0373933_0130736_30_1187 331
80 3300036401 Ga0373937_0278751 Ga0373937_0278751_392_1549 331
81 3300037418 Ga0395900_0072829 Ga0395900_0072829_2229_3479 331
82 3300037466 Ga0395898_0208505 Ga0395898_0208505_461_1711 331
83 3300037471 Ga0395905_0226567 Ga0395905_0226567_376_1626 331
84 3300038443 Ga0395901_0295961 Ga0395901_0295961_83_1333 331
85 3300046462 Ga0495651_0165715 Ga0495651_0165715_30_1187 331
86 3300046463 Ga0495653_0151687 Ga0495653_0151687_432_1589 331
87 3300046477 Ga0495664_0046973 Ga0495664_0046973_1360_2517 331
88 3300046500 Ga0495596_0048412 Ga0495596_0048412_416_1612 331
89 3300046511 Ga0495608_0134777 Ga0495608_0134777_30_1187 331
90 3300046514 Ga0495618_0054072 Ga0495618_0054072_875_2086 331
91 3300046516 Ga0495628_0183132 Ga0495628_0183132_35_1192 331
92 3300046529 Ga0495652_0180823 Ga0495652_0180823_432_1589 331
93 3300046536 Ga0495587_0110580 Ga0495587_0110580_30_1187 331
94 3300046543 Ga0495645_0066925 Ga0495645_0066925_1405_2562 331
95 3300046559 Ga0495667_0130422 Ga0495667_0130422_33_1190 331
96 3300046642 Ga0495634_0119086 Ga0495634_0119086_398_1555 331
97 3300046663 Ga0495635_0081138 Ga0495635_0081138_671_1828 331
98 3300046675 Ga0495657_0129536 Ga0495657_0129536_33_1190 331
99 3300046679 Ga0495623_0081525 Ga0495623_0081525_432_1589 331
100 3300046680 Ga0495646_0015760 Ga0495646_0015760_3612_4769 331
101 3300047317 Ga0495604_0155333 Ga0495604_0155333_33_1190 331
102 3300047319 Ga0495674_0084611 Ga0495674_0084611_130_1287 331
103 3300047322 Ga0495680_0162854 Ga0495680_0162854_432_1589 331
104 3300047444 Ga0495675_0122574 Ga0495675_0122574_30_1187 331
105 3300047471 Ga0495684_0096952 Ga0495684_0096952_903_2060 331
106 3300053077 Ga0495601_0121633 Ga0495601_0121633_85_1242 331
107 3300053084 Ga0495595_0021657 Ga0495595_0021657_1262_2419 331
108 3300053085 Ga0495619_0078928 Ga0495619_0078928_1019_2176 331
109 3300006847 Ga0075431_100196972 Ga0075431_1001969722 332
110 3300050510 nmdc:mga06r32_109321_c1 nmdc:mga06r32_109321_c1_904_2079 332
111 3300050507 nmdc:mga05p37_50094_c1 nmdc:mga05p37_50094_c1_484_1533 334
112 3300007076 Ga0075435_100296384 Ga0075435_1002963841 335
113 3300050513 nmdc:mga0rr50_215088_c1 nmdc:mga0rr50_215088_c1_380_1426 335
114 3300005435 Ga0070714_100044007 Ga0070714_1000440071 336
115 3300006028 Ga0070717_10140222 Ga0070717_101402222 336
116 3300035113 Ga0373936_0049852 Ga0373936_0049852_504_1652 336
117 3300038443 Ga0395901_0491525 Ga0395901_0491525_91_1185 336
118 3300046533 Ga0495640_0117284 Ga0495640_0117284_179_1246 336
119 3300005329 Ga0070683_100243909 Ga0070683_1002439092 337
120 3300005337 Ga0070682_100106840 Ga0070682_1001068401 337
121 3300005434 Ga0070709_10138316 Ga0070709_101383161 337
122 3300005435 Ga0070714_100091291 Ga0070714_1000912911 337
123 3300005437 Ga0070710_10093299 Ga0070710_100932992 337
124 3300005439 Ga0070711_100208917 Ga0070711_1002089171 337
125 3300005445 Ga0070708_100163587 Ga0070708_1001635872 337
126 3300005445 Ga0070708_100293787 Ga0070708_1002937871 337
127 3300005455 Ga0070663_100122103 Ga0070663_1001221032 337
128 3300005467 Ga0070706_100057197 Ga0070706_1000571973 337
129 3300005535 Ga0070684_100208630 Ga0070684_1002086301 337
130 3300005616 Ga0068852_100099778 Ga0068852_1000997782 337
131 3300006173 Ga0070716_100125342 Ga0070716_1001253422 337
132 3300006871 Ga0075434_100029816 Ga0075434_1000298164 337
133 3300006880 Ga0075429_100030851 Ga0075429_1000308514 337
134 3300009094 Ga0111539_10494952 Ga0111539_104949522 337
135 3300013105 Ga0157369_10298957 Ga0157369_102989572 337
136 3300013308 Ga0157375_10405524 Ga0157375_104055241 337
137 3300025898 Ga0207692_10103008 Ga0207692_101030082 337
138 3300025901 Ga0207688_10070346 Ga0207688_100703462 337
139 3300025906 Ga0207699_10142376 Ga0207699_101423761 337
140 3300025909 Ga0207705_10140312 Ga0207705_101403122 337
141 3300025910 Ga0207684_10329253 Ga0207684_103292531 337
142 3300025915 Ga0207693_10148291 Ga0207693_101482913 337
143 3300025928 Ga0207700_10454381 Ga0207700_104543811 337
144 3300025944 Ga0207661_10211108 Ga0207661_102111081 337
145 3300026142 Ga0207698_10055996 Ga0207698_100559961 337
146 3300030879 Ga0265765_1005666 Ga0265765_10056661 337
147 3300031456 Ga0307513_10246140 Ga0307513_102461401 337
148 3300031730 Ga0307516_10168373 Ga0307516_101683732 337
149 3300033179 Ga0307507_10071534 Ga0307507_100715342 337
150 3300035111 Ga0373923_0051513 Ga0373923_0051513_84_1268 337
151 3300035117 Ga0373953_0057096 Ga0373953_0057096_254_1438 337
152 3300035118 Ga0373954_0070084 Ga0373954_0070084_28_1212 337
153 3300035119 Ga0373956_0068494 Ga0373956_0068494_56_1240 337
154 3300035120 Ga0373957_0030803 Ga0373957_0030803_706_1890 337
155 3300035172 Ga0373955_0024250 Ga0373955_0024250_373_1557 337
156 3300035172 Ga0373955_0045756 Ga0373955_0045756_1157_2212 337
157 3300035410 Ga0373924_0051585 Ga0373924_0051585_116_1300 337
158 3300035692 Ga0373935_0126864 Ga0373935_0126864_465_1649 337
159 3300035724 Ga0373933_0086155 Ga0373933_0086155_709_1893 337
160 3300035724 Ga0373933_0203233 Ga0373933_0203233_57_1184 337
161 3300036401 Ga0373937_0099871 Ga0373937_0099871_296_1435 337
162 3300036401 Ga0373937_0105262 Ga0373937_0105262_412_1596 337
163 3300036401 Ga0373937_0171415 Ga0373937_0171415_390_1517 337
164 3300037853 Ga0436364_1226908 Ga0436364_1226908_457_1596 337
165 3300037853 Ga0436364_1306821 Ga0436364_1306821_349_1401 337
166 3300041451 Ga0451791_0426859 Ga0451791_0426859_539_1708 337
167 3300041509 Ga0451843_0000369 Ga0451843_0000369_572_1741 337
168 3300042005 Ga0439448_0028913 Ga0439448_0028913_559_1611 337
169 3300042008 Ga0439450_022540 Ga0439450_022540_195_1247 337
170 3300042012 Ga0439455_0041431 Ga0439455_0041431_42_1094 337
171 3300042013 Ga0439456_016576 Ga0439456_016576_324_1376 337
172 3300042016 Ga0439463_002242 Ga0439463_002242_1125_2177 337
173 3300042437 Ga0439444_0001067 Ga0439444_0001067_1507_2559 337
174 3300042439 Ga0439464_0033251 Ga0439464_0033251_119_1171 337
175 3300042461 Ga0439460_0031351 Ga0439460_0031351_90_1142 337
176 3300042993 Ga0439440_0030638 Ga0439440_0030638_165_1217 337
177 3300046460 Ga0495638_0113730 Ga0495638_0113730_52_1107 337
178 3300046461 Ga0495641_0056347 Ga0495641_0056347_94_1278 337
179 3300046462 Ga0495651_0189317 Ga0495651_0189317_93_1277 337
180 3300046475 Ga0495639_0067245 Ga0495639_0067245_410_1594 337
181 3300046476 Ga0495662_0050579 Ga0495662_0050579_771_1955 337
182 3300046477 Ga0495664_0022174 Ga0495664_0022174_2469_3608 337
183 3300046506 Ga0495583_0045078 Ga0495583_0045078_881_1939 337
184 3300046507 Ga0495606_0089987 Ga0495606_0089987_714_1772 337
185 3300046511 Ga0495608_0119633 Ga0495608_0119633_448_1632 337
186 3300046514 Ga0495618_0220950 Ga0495618_0220950_86_1144 337
187 3300046515 Ga0495620_0038792 Ga0495620_0038792_216_1274 337
188 3300046522 Ga0495643_0041453 Ga0495643_0041453_565_1623 337
189 3300046526 Ga0495666_0071809 Ga0495666_0071809_28_1212 337
190 3300046529 Ga0495652_0152370 Ga0495652_0152370_267_1433 337
191 3300046533 Ga0495640_0088083 Ga0495640_0088083_698_1882 337
192 3300046543 Ga0495645_0012519 Ga0495645_0012519_982_2121 337
193 3300046559 Ga0495667_0077938 Ga0495667_0077938_818_2002 337
194 3300046616 Ga0495668_0081580 Ga0495668_0081580_108_1166 337
195 3300046675 Ga0495657_0083250 Ga0495657_0083250_761_1945 337
196 3300046678 Ga0495599_0098793 Ga0495599_0098793_304_1443 337
197 3300046679 Ga0495623_0156631 Ga0495623_0156631_73_1200 337
198 3300046683 Ga0495658_0065845 Ga0495658_0065845_102_1286 337
199 3300046809 Ga0495600_0135738 Ga0495600_0135738_53_1237 337
200 3300047315 Ga0495581_0024769 Ga0495581_0024769_590_1648 337
201 3300047317 Ga0495604_0152359 Ga0495604_0152359_410_1594 337
202 3300047443 Ga0495687_013624 Ga0495687_013624_868_1926 337
203 3300047471 Ga0495684_0204284 Ga0495684_0204284_259_1443 337
204 3300048088 Ga0495602_0081808 Ga0495602_0081808_540_1667 337
205 3300048088 Ga0495602_0158421 Ga0495602_0158421_482_1666 337
206 3300049568 Ga0501031_0196765 Ga0501031_0196765_109_1161 337
207 3300049570 Ga0501033_0176718 Ga0501033_0176718_92_1144 337
208 3300049571 Ga0501034_0435162 Ga0501034_0435162_81_1133 337
209 3300049572 Ga0501036_0206663 Ga0501036_0206663_105_1157 337
210 3300049573 Ga0501037_0202434 Ga0501037_0202434_201_1253 337
211 3300049574 Ga0501038_0232247 Ga0501038_0232247_144_1196 337
212 3300049575 Ga0501039_0257941 Ga0501039_0257941_173_1225 337
213 3300049576 Ga0501040_0205599 Ga0501040_0205599_195_1247 337
214 3300049577 Ga0501041_0037789 Ga0501041_0037789_1791_2843 337
215 3300049579 Ga0501043_0051976 Ga0501043_0051976_106_1158 337
216 3300049582 Ga0501048_0242329 Ga0501048_0242329_93_1145 337
217 3300049584 Ga0501068_0006176 Ga0501068_0006176_1734_2786 337
218 3300049585 Ga0501069_0105377 Ga0501069_0105377_143_1195 337
219 3300049586 Ga0501070_0215209 Ga0501070_0215209_165_1217 337
220 3300049587 Ga0501071_0065495 Ga0501071_0065495_155_1207 337
221 3300049588 Ga0501072_0291032 Ga0501072_0291032_52_1104 337
222 3300049589 Ga0501073_0133693 Ga0501073_0133693_174_1226 337
223 3300049590 Ga0501074_0244699 Ga0501074_0244699_59_1111 337
224 3300049591 Ga0501075_0323246 Ga0501075_0323246_36_1088 337
225 3300049592 Ga0501076_0005984 Ga0501076_0005984_7614_8666 337
226 3300049741 Ga0501079_0287929 Ga0501079_0287929_39_1091 337
227 3300049742 Ga0501080_0370940 Ga0501080_0370940_129_1181 337
228 3300049743 Ga0501081_0049867 Ga0501081_0049867_173_1225 337
229 3300049744 Ga0501083_0082006 Ga0501083_0082006_731_1783 337
230 3300049822 Ga0501035_0110922 Ga0501035_0110922_1305_2357 337
231 3300049823 Ga0501044_0175511 Ga0501044_0175511_38_1090 337
232 3300049824 Ga0501045_0265670 Ga0501045_0265670_81_1133 337
233 3300053077 Ga0495601_0021259 Ga0495601_0021259_287_1426 337
234 3300053078 Ga0495612_0007394 Ga0495612_0007394_187_1326 337
235 3300053085 Ga0495619_0071697 Ga0495619_0071697_651_1835 337
236 3300054114 Ga0501084_0342081 Ga0501084_0342081_57_1109 337
237 3300060353 Ga0501082_0390346 Ga0501082_0390346_117_1169 337
238 3300061734 Ga0530510_0283200 Ga0530510_0283200_144_1196 337
239 3300003373 JGI25407J50210_10028821 JGI25407J50210_100288212 338
240 3300005457 Ga0070662_100235665 Ga0070662_1002356652 338
241 3300005545 Ga0070695_100272660 Ga0070695_1002726601 338
242 3300005563 Ga0068855_100511915 Ga0068855_1005119151 338
243 3300005719 Ga0068861_100149753 Ga0068861_1001497532 338
244 3300005981 Ga0081538_10004093 Ga0081538_1000409317 338
245 3300006844 Ga0075428_100301847 Ga0075428_1003018472 338
246 3300006844 Ga0075428_100530893 Ga0075428_1005308931 338
247 3300006846 Ga0075430_100092116 Ga0075430_1000921162 338
248 3300006847 Ga0075431_100241065 Ga0075431_1002410653 338
249 3300006880 Ga0075429_100157677 Ga0075429_1001576772 338
250 3300006880 Ga0075429_100290070 Ga0075429_1002900702 338
251 3300009147 Ga0114129_10835936 Ga0114129_108359361 338
252 3300013306 Ga0163162_10227799 Ga0163162_102277992 338
253 3300015262 Ga0182007_10051216 Ga0182007_100512161 338
254 3300017792 Ga0163161_10269795 Ga0163161_102697951 338
255 3300025933 Ga0207706_10035090 Ga0207706_100350905 338
256 3300025949 Ga0207667_10537699 Ga0207667_105376991 338
257 3300025961 Ga0207712_10361336 Ga0207712_103613361 338
258 3300025972 Ga0207668_10060168 Ga0207668_100601682 338
259 3300026118 Ga0207675_100246194 Ga0207675_1002461942 338
260 3300031548 Ga0307408_100096683 Ga0307408_1000966832 338
261 3300031548 Ga0307408_100442701 Ga0307408_1004427011 338
262 3300031824 Ga0307413_10118870 Ga0307413_101188702 338
263 3300031852 Ga0307410_10313941 Ga0307410_103139411 338
264 3300031901 Ga0307406_10228157 Ga0307406_102281572 338
265 3300031903 Ga0307407_10135107 Ga0307407_101351071 338
266 3300031995 Ga0307409_100102432 Ga0307409_1001024322 338
267 3300031995 Ga0307409_100546232 Ga0307409_1005462321 338
268 3300032002 Ga0307416_100102395 Ga0307416_1001023953 338
269 3300032002 Ga0307416_100322556 Ga0307416_1003225561 338
270 3300032002 Ga0307416_100364027 Ga0307416_1003640271 338
271 3300032004 Ga0307414_10271584 Ga0307414_102715841 338
272 3300032005 Ga0307411_10105159 Ga0307411_101051592 338
273 3300032126 Ga0307415_100191429 Ga0307415_1001914291 338
274 3300032126 Ga0307415_100301138 Ga0307415_1003011382 338
275 3300032126 Ga0307415_100345957 Ga0307415_1003459571 338
276 3300032126 Ga0307415_100376038 Ga0307415_1003760381 338
277 3300038443 Ga0395901_0006347 Ga0395901_0006347_6891_7946 338
278 3300042003 Ga0439443_011430 Ga0439443_011430_88_1143 338
279 3300042011 Ga0439454_005905 Ga0439454_005905_160_1215 338
280 3300042530 Ga0450916_007760 Ga0450916_007760_41_1096 338
281 3300042993 Ga0439440_0020344 Ga0439440_0020344_239_1294 338
282 3300050507 nmdc:mga05p37_334461_c1 nmdc:mga05p37_334461_c1_69_1124 338
283 3300050507 nmdc:mga05p37_47813_c1 nmdc:mga05p37_47813_c1_135_1190 338
284 3300050508 nmdc:mga09592_304467_c1 nmdc:mga09592_304467_c1_229_1284 338
285 3300050510 nmdc:mga06r32_438354_c1 nmdc:mga06r32_438354_c1_45_1100 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13551

HTH_29

Winged helix-turn helix

76

128

0.98

PF13384

HTH_23

Homeodomain-like domain

70

119

0.96

PF13518

HTH_28

Helix-turn-helix domain

75

128

0.94

PF13358

DDE_3

DDE superfamily endonuclease

218

365

0.93

PF13565

HTH_32

Homeodomain-like domain

102

177

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x6n-assembly2.cif.gz_F human foamy virus integrase - catalytic core. manganese-bound structure. 0.7992 197 325
3f2k-assembly2.cif.gz_B structure of the transposase domain of human histone-lysine n-methyltransferase setmar 0.7946 142 317
3k9k-assembly3.cif.gz_B transposase domain of metnase 0.7944 142 317
2x6n-assembly2.cif.gz_E human foamy virus integrase - catalytic core. manganese-bound structure. 0.7848 162 325
2x6s-assembly1.cif.gz_F human foamy virus integrase - catalytic core. magnesium-bound structure. 0.7831 197 325
ID Description Score Start End Superfamily
af_P19769_115_278_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8618 159 319 3.30.420.10
af_Q21972_79_144_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8517 23 70 1.10.10.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8261 157 321 3.30.420.10
af_O53337_182_339_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8117 158 294 3.30.420.10
3f2kB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7911 142 317 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A2S6YYS0-F1-model_v4 IS630 family transposase 0.968 205 330 GO:0003676
AF-A0A318WK13-F1-model_v4 deleted 0.9644 3 77
AF-T1AHN2-F1-model_v4 TISRso5 ISRSO5-transposase protein 0.9644 211 330 GO:0003676
AF-A0A1I6FJM5-F1-model_v4 DDE superfamily endonuclease 0.9641 205 330 GO:0003676
GO:0004519
AF-A0A2N0SPK6-F1-model_v4 DDE superfamily endonuclease 0.9613 212 331 GO:0003676
GO:0004519

Feature Viewer

pLDDT pTM Quality
81.19 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map