F386876

General Info

Members Datasets Scaffolds Average Seq Length
285 246 197 290

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10092200|Ga0265338_100922002
Length 291
Sequence MTEAAEYVPPAVWTWNKESGGRFANINRPIAGPTHDKELPVGNHPFQLYSLATPNGVKVTVMFEELLAAGHTGAEYDAWLIRIQGDQFGSGFVAVNPNSKIPALMDRSGPTPFRLFESGSILLHLADKFGAFIPKDPAGRAECLSWLFWQMGSAPYLGGGFGHFYAYAPFKIEYAIDRFAMETKRQLDVLDRRLAENEYLAGDEYTIADMAVWPWYGATAKGQTYGGGEFLSVHEYKNLIRWTDQIAERAAVKRGRMVNCAWGDPKHQLHERHDASDFELRTQDKLEPAAE

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
6 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
7 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
8 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
9 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
10 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
11 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
12 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
13 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
14 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
15 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
16 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
17 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
18 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
19 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
20 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
21 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
22 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
23 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
24 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
25 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
26 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
27 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
28 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
29 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
30 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
31 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
32 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
33 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
34 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
35 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
36 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
37 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
38 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
39 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
40 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
41 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
42 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
43 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
44 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
45 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
46 2919476304 Duganella sp. 3397 Isolate Unclassified
47 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
48 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
49 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
50 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
51 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
52 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
53 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
54 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
55 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
56 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
57 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
58 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
59 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
60 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
61 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
62 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
63 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
64 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
65 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
66 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
67 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
68 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
69 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
70 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
71 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
131 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
136 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
137 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
141 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
149 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
172 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
173 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
191 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
215 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
216 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
217 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
218 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
219 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
220 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
221 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
224 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
225 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
226 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
227 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
228 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
229 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
230 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
231 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
232 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
233 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
234 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
235 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
236 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
237 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
238 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
239 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
240 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
241 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
242 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
243 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
244 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
245 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere
246 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.12
Metatranscriptomes 0
Isolates 30.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.23
Nodule 22.11
Rhizoplane 2.11
Rhizosphere 52.63
Stem 0
Stem Tuber 0
Unclassified 11.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1001839 3300003354 Bacteria 10189
2 Ga0055536_1003906 3300003781 Bacteria 7819
3 Ga0055534_1005345 3300003784 Bacteria 3459
4 Ga0055530_10000270 3300003791 Bacteria 46941
5 Ga0055531_10000371 3300003794 Bacteria 43284
6 Ga0055531_10002670 3300003794 Bacteria 11763
7 Ga0070670_100002228 3300005331 Bacteria 15933
8 Ga0070670_100062561 3300005331 Bacteria 3195
9 Ga0070682_100088396 3300005337 Bacteria 2022
10 Ga0070669_100016213 3300005353 Bacteria 5314
11 Ga0070675_100140302 3300005354 Bacteria 2065
12 Ga0070663_100029260 3300005455 Bacteria 3762
13 Ga0070663_100062183 3300005455 Bacteria 2690
14 Ga0070663_100162059 3300005455 Bacteria 1722
15 Ga0070663_100524460 3300005455 Bacteria 987
16 Ga0070707_100185475 3300005468 Bacteria 2028
17 Ga0070679_100109232 3300005530 Bacteria 2752
18 Ga0070679_100643429 3300005530 Bacteria 1003
19 Ga0070697_100152728 3300005536 Bacteria 1947
20 Ga0068855_100000029 3300005563 Bacteria 171278
21 Ga0068855_100784788 3300005563 Bacteria 1013
22 Ga0070664_100009876 3300005564 Bacteria 7735
23 Ga0068859_100014870 3300005617 Bacteria 7816
24 Ga0068858_100006226 3300005842 Bacteria 11628
25 Ga0081455_10027273 3300005937 Bacteria 5235
26 Ga0070716_100074149 3300006173 Bacteria 2010
27 Ga0097620_100014869 3300006931 Bacteria 7816
28 Ga0079104_1014398 3300006946 Bacteria 2386
29 Ga0105244_10127899 3300009036 Bacteria 1227
30 Ga0105247_10267527 3300009101 Bacteria 1174
31 Ga0105243_10320576 3300009148 Bacteria 1412
32 Ga0105238_10203468 3300009551 Bacteria 1956
33 Ga0105246_10035750 3300011119 Bacteria 3322
34 Ga0157371_10084565 3300013102 Bacteria 2248
35 Ga0157369_10381456 3300013105 Bacteria 1463
36 Ga0163162_10021735 3300013306 Bacteria 6319
37 Ga0182006_1000008 3300015261 Bacteria 449652
38 Ga0182005_1000022 3300015265 Bacteria 266181
39 Ga0163161_10008039 3300017792 Bacteria 7298
40 Ga0214545_1022092 3300021324 Bacteria 4557
41 Ga0213872_10002411 3300021361 Bacteria 11028
42 Ga0213876_10011983 3300021384 Bacteria 4619
43 Ga0209148_1006525 3300025254 Bacteria 2521
44 Ga0209233_1000084 3300025261 Bacteria 335222
45 Ga0209675_1000076 3300025291 Bacteria 159428
46 Ga0209676_1000020 3300025292 Bacteria 617256
47 Ga0209676_1000085 3300025292 Bacteria 273425
48 Ga0209676_1001055 3300025292 Bacteria 31590
49 Ga0209025_1008554 3300025294 Bacteria 7344
50 Ga0209050_1000042 3300025298 Bacteria 402842
51 Ga0207426_1001289 3300025302 Bacteria 21656
52 Ga0209257_1000135 3300025304 Bacteria 205668
53 Ga0209257_1000482 3300025304 Bacteria 72375
54 Ga0207655_1095348 3300025728 Bacteria 1037
55 Ga0207671_10040450 3300025914 Bacteria 3451
56 Ga0207652_10042633 3300025921 Bacteria 3863
57 Ga0207646_10157898 3300025922 Bacteria 2046
58 Ga0207681_10088077 3300025923 Bacteria 2210
59 Ga0207650_10005240 3300025925 Bacteria 8839
60 Ga0207709_10138331 3300025935 Bacteria 1670
61 Ga0207704_10375352 3300025938 Bacteria 1115
62 Ga0207665_10271364 3300025939 Bacteria 1260
63 Ga0207691_10023206 3300025940 Bacteria 5842
64 Ga0207691_10103951 3300025940 Bacteria 2532
65 Ga0207689_10038890 3300025942 Bacteria 3938
66 Ga0207679_10482211 3300025945 Bacteria 1104
67 Ga0207667_10000035 3300025949 Bacteria 301056
68 Ga0207703_10018457 3300026035 Bacteria 5447
69 Ga0207639_10163334 3300026041 Bacteria 1879
70 Ga0207678_10023178 3300026067 Bacteria 5431
71 Ga0207678_10027281 3300026067 Bacteria 4980
72 Ga0207678_10099843 3300026067 Bacteria 2479
73 Ga0207702_10376496 3300026078 Bacteria 1364
74 Ga0207641_10004864 3300026088 Bacteria 11560
75 Ga0207674_10003716 3300026116 Bacteria 18636
76 Ga0207698_10138108 3300026142 Bacteria 2095
77 Ga0209281_1013576 3300027111 Bacteria 1753
78 Ga0209969_1000879 3300027360 Bacteria 4055
79 Ga0209981_1000672 3300027378 Bacteria 4320
80 Ga0209983_1003355 3300027665 Bacteria 3430
81 Ga0268266_10000275 3300028379 Bacteria 85106
82 Ga0265337_1003307 3300028556 Bacteria 7037
83 Ga0265326_10001217 3300028558 Bacteria 9204
84 Ga0265319_1001686 3300028563 Bacteria 12764
85 Ga0265334_10001564 3300028573 Bacteria 11023
86 Ga0265318_10012678 3300028577 Bacteria 3578
87 Ga0265323_10003591 3300028653 Bacteria 6810
88 Ga0265336_10000135 3300028666 Bacteria 52478
89 Ga0307515_10000150 3300028794 Bacteria 169644
90 Ga0265338_10000034 3300028800 Bacteria 244623
91 Ga0265338_10092200 3300028800 Bacteria 2499
92 Ga0265324_10001198 3300029957 Bacteria 15406
93 Ga0265327_10000419 3300031251 Bacteria 77672
94 Ga0265327_10012773 3300031251 Bacteria 5637
95 Ga0265316_10386812 3300031344 Bacteria 1009
96 Ga0307508_10042859 3300031616 Bacteria 4057
97 Ga0307508_10055198 3300031616 Bacteria 3520
98 Ga0316575_10028283 3300031665 Bacteria 2185
99 Ga0316579_10000302 3300031691 Bacteria 15221
100 Ga0265314_10129975 3300031711 Bacteria 1572
101 Ga0307516_10004401 3300031730 Bacteria 17410
102 Ga0307516_10303359 3300031730 Bacteria 1272
103 Ga0307406_10297790 3300031901 Bacteria 1238
104 Ga0307414_10207033 3300032004 Bacteria 1600
105 Ga0316583_10003057 3300032133 Bacteria 5874
106 Ga0373923_0059224 3300035111 Bacteria 1623
107 Ga0373953_0099811 3300035117 Bacteria 1221
108 Ga0373927_0015500 3300035695 Bacteria 5036
109 Ga0373933_0033903 3300035724 Bacteria 2973
110 Ga0373947_0262682 3300035725 Bacteria 1144
111 Ga0373937_0037314 3300036401 Bacteria 4428
112 Ga0316582_0010188 3300036647 Bacteria 5137
113 Ga0373925_0013015 3300037068 Bacteria 6025
114 Ga0395899_0026293 3300037312 Bacteria 4391
115 Ga0395900_0006719 3300037418 Bacteria 11940
116 Ga0395898_0010432 3300037466 Bacteria 9711
117 Ga0395905_0278252 3300037471 Bacteria 1559
118 Ga0316581_0031225 3300037588 Bacteria 1605
119 Ga0395901_0115648 3300038443 Bacteria 2817
120 Ga0436365_0429102 3300039437 Bacteria 1651
121 Ga0436365_0441617 3300039437 Bacteria 2724
122 Ga0436361_0360172 3300039447 Bacteria 47640
123 Ga0451841_0149809 3300041498 Bacteria 3610
124 Ga0439431_0038792 3300041997 Bacteria 1207
125 Ga0450904_000343 3300042139 Bacteria 9750
126 Ga0466969_0024570 3300044656 Bacteria 3100
127 Ga0466966_0035005 3300044684 Bacteria 3246
128 Ga0466970_0156114 3300044765 Bacteria 1261
129 Ga0466967_0171693 3300045976 Bacteria 2040
130 Ga0495638_0000414 3300046460 Bacteria 51945
131 Ga0495638_0000521 3300046460 Bacteria 45043
132 Ga0495638_0001260 3300046460 Bacteria 23696
133 Ga0495650_0002946 3300046471 Bacteria 12891
134 Ga0495650_0035573 3300046471 Bacteria 2191
135 Ga0495650_0052900 3300046471 Bacteria 1665
136 Ga0495605_0007521 3300046474 Bacteria 6178
137 Ga0495583_0000173 3300046506 Bacteria 109405
138 Ga0495583_0020876 3300046506 Bacteria 3379
139 Ga0495606_0000600 3300046507 Bacteria 57013
140 Ga0495610_0070974 3300046512 Bacteria 1625
141 Ga0495643_0081449 3300046522 Bacteria 1683
142 Ga0495643_0192484 3300046522 Bacteria 984
143 Ga0495654_0053148 3300046530 Bacteria 1970
144 Ga0495654_0056217 3300046530 Bacteria 1903
145 Ga0495668_0023398 3300046616 Bacteria 3524
146 Ga0495625_0000373 3300046660 Bacteria 68625
147 Ga0495625_0000492 3300046660 Bacteria 59211
148 Ga0495625_0002827 3300046660 Bacteria 18279
149 Ga0495625_0019290 3300046660 Bacteria 5294
150 Ga0495625_0030977 3300046660 Bacteria 3983
151 Ga0495657_0126223 3300046675 Bacteria 1607
152 Ga0495649_0000655 3300046694 Bacteria 28205
153 Ga0495589_0064242 3300046794 Bacteria 1800
154 Ga0495660_0113591 3300046810 Bacteria 1379
155 Ga0495672_0028456 3300047320 Bacteria 3536
156 Ga0495686_0056522 3300047472 Bacteria 2451
157 Ga0496102_0142931 3300048905 Bacteria 2244
158 Ga0496106_0045534 3300048909 Bacteria 3295
159 Ga0496109_0485347 3300048912 Bacteria 1166
160 Ga0496111_0039177 3300048914 Bacteria 3397
161 Ga0496114_0161153 3300048917 Bacteria 1951
162 Ga0496115_0000210 3300048918 Bacteria 54070
163 Ga0496121_0007540 3300048924 Bacteria 13117
164 Ga0496122_0032676 3300048925 Bacteria 4298
165 Ga0496126_0049262 3300048929 Bacteria 3847
166 Ga0501033_0106191 3300049570 Bacteria 2046
167 Ga0501034_0140799 3300049571 Bacteria 2392
168 Ga0501034_0537423 3300049571 Bacteria 1079
169 Ga0501046_0239413 3300049580 Bacteria 1339
170 Ga0501047_0009890 3300049581 Bacteria 9016
171 Ga0501047_0220609 3300049581 Bacteria 1752
172 Ga0501069_0026933 3300049585 Bacteria 3149
173 Ga0501070_0005785 3300049586 Bacteria 10550
174 Ga0501073_0153154 3300049589 Bacteria 1598
175 Ga0501080_0203052 3300049742 Bacteria 1819
176 Ga0501080_0300955 3300049742 Bacteria 1455
177 Ga0501035_0002538 3300049822 Bacteria 17848
178 Ga0501035_0036244 3300049822 Bacteria 4471
179 Ga0501035_0041781 3300049822 Bacteria 4139
180 Ga0501035_0155600 3300049822 Bacteria 1981
181 Ga0501044_0048698 3300049823 Bacteria 4376
182 Ga0501044_0067248 3300049823 Bacteria 3651
183 nmdc:mga07m45_25798_c1 3300050496 Bacteria 3226
184 Ga0500644_0016339 3300053088 Bacteria 2135
185 Ga0500557_000435 3300053105 Bacteria 5493
186 Ga0500569_031258 3300053109 Bacteria 1496
187 Ga0500592_003255 3300053116 Bacteria 2590
188 Ga0500594_0000846 3300053118 Bacteria 6540
189 Ga0500559_0000022 3300053136 Bacteria 128071
190 Ga0500559_0073480 3300053136 Bacteria 1543
191 Ga0500568_0005702 3300053139 Bacteria 6385
192 Ga0500604_0044149 3300053151 Bacteria 1356
193 Ga0500616_0000387 3300053153 Bacteria 61359
194 Ga0500622_0000498 3300053156 Bacteria 36624
195 Ga0500622_0001132 3300053156 Bacteria 22246
196 Ga0500627_0000343 3300053158 Bacteria 12606
197 Ga0500587_001710 3300053739 Bacteria 3119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0035005 Ga0466966_0035005_1912_2760 272
2 iso_pu_bacteria 2510065055 2510292483 273
3 3300031616 Ga0307508_10055198 Ga0307508_100551982 275
4 iso_pu_bacteria 2808606445 2809214673 275
5 iso_pu_bacteria 2919476304 2919477599 276
6 iso_pu_bacteria 2998344455 2998347174 276
7 3300025292 Ga0209676_1000020 Ga0209676_1000020209 279
8 3300005563 Ga0068855_100000029 Ga0068855_10000002992 280
9 3300006946 Ga0079104_1014398 Ga0079104_10143982 280
10 3300009551 Ga0105238_10203468 Ga0105238_102034683 280
11 3300015261 Ga0182006_1000008 Ga0182006_1000008119 280
12 3300015265 Ga0182005_1000022 Ga0182005_1000022143 280
13 3300025949 Ga0207667_10000035 Ga0207667_10000035131 280
14 3300027111 Ga0209281_1013576 Ga0209281_10135762 280
15 3300042139 Ga0450904_000343 Ga0450904_000343_3692_4546 280
16 iso_pu_bacteria 8019619141 8019619823 280
17 iso_pu_bacteria 8019678201 8019685516 280
18 3300009101 Ga0105247_10267527 Ga0105247_102675272 281
19 3300037471 Ga0395905_0278252 Ga0395905_0278252_533_1378 281
20 3300048924 Ga0496121_0007540 Ga0496121_0007540_8567_9415 282
21 3300048925 Ga0496122_0032676 Ga0496122_0032676_2108_2956 282
22 iso_pu_bacteria 8057160832 8057160976 282
23 iso_pu_bacteria 2841734538 2841738994 283
24 iso_pu_bacteria 2937836603 2937843052 283
25 iso_pu_bacteria 8004633249 8004637070 283
26 iso_pu_bacteria 8055617313 8055620592 283
27 3300005468 Ga0070707_100185475 Ga0070707_1001854752 284
28 3300006173 Ga0070716_100074149 Ga0070716_1000741492 284
29 3300025254 Ga0209148_1006525 Ga0209148_10065252 284
30 3300025922 Ga0207646_10157898 Ga0207646_101578982 284
31 3300025939 Ga0207665_10271364 Ga0207665_102713642 284
32 3300031251 Ga0265327_10000419 Ga0265327_1000041952 284
33 3300025914 Ga0207671_10040450 Ga0207671_100404504 285
34 3300028379 Ga0268266_10000275 Ga0268266_1000027541 285
35 iso_pu_bacteria 8057101203 8057102454 285
36 3300005337 Ga0070682_100088396 Ga0070682_1000883963 286
37 3300031251 Ga0265327_10012773 Ga0265327_100127735 286
38 iso_pu_bacteria 2844315083 2844320039 286
39 iso_pu_bacteria 2847930680 2847937334 286
40 iso_pu_bacteria 2879083081 2879086634 286
41 iso_pu_bacteria 2881665667 2881666590 286
42 iso_pu_bacteria 2903727486 2903730287 286
43 iso_pu_bacteria 2906602504 2906609864 286
44 iso_pu_bacteria 2906643746 2906643959 286
45 iso_pu_bacteria 2941531003 2941531221 286
46 iso_pu_bacteria 8055909800 8055911808 286
47 3300044656 Ga0466969_0024570 Ga0466969_0024570_1404_2270 287
48 iso_pu_bacteria 2508501009 2508541767 287
49 iso_pu_bacteria 2508501042 2508692689 287
50 iso_pu_bacteria 2513237094 2513642992 287
51 iso_pu_bacteria 2513237139 2513878652 287
52 iso_pu_bacteria 2513237161 2514009418 287
53 iso_pu_bacteria 2515154112 2515626088 287
54 iso_pu_bacteria 2615840698 2616551928 287
55 iso_pu_bacteria 2617270735 2617346809 287
56 iso_pu_bacteria 2643221563 2643835908 287
57 iso_pu_bacteria 2643221608 2644056833 287
58 iso_pu_bacteria 2802429603 2805922746 287
59 iso_pu_bacteria 2824600985 2824606524 287
60 iso_pu_bacteria 2824609381 2824613059 287
61 iso_pu_bacteria 2824653114 2824660546 287
62 iso_pu_bacteria 2824671348 2824674106 287
63 iso_pu_bacteria 2824687955 2824694393 287
64 iso_pu_bacteria 2824696289 2824703367 287
65 iso_pu_bacteria 2824773399 2824775114 287
66 iso_pu_bacteria 2838042994 2838046861 287
67 iso_pu_bacteria 2838122688 2838130466 287
68 iso_pu_bacteria 2841941048 2841948115 287
69 iso_pu_bacteria 2841949485 2841953490 287
70 iso_pu_bacteria 2841966195 2841972033 287
71 iso_pu_bacteria 2841974524 2841978219 287
72 iso_pu_bacteria 2841983080 2841990978 287
73 iso_pu_bacteria 2847939898 2847947755 287
74 iso_pu_bacteria 2852653556 2852655487 287
75 iso_pu_bacteria 2874590934 2874598764 287
76 iso_pu_bacteria 2874645413 2874652220 287
77 iso_pu_bacteria 2876771140 2876778803 287
78 iso_pu_bacteria 2876818435 2876824302 287
79 iso_pu_bacteria 2879074833 2879082596 287
80 iso_pu_bacteria 2879127579 2879131513 287
81 iso_pu_bacteria 2879142872 2879147959 287
82 iso_pu_bacteria 2888419890 2888425595 287
83 iso_pu_bacteria 2929199973 2929201861 287
84 iso_pu_bacteria 2935608549 2935609841 287
85 iso_pu_bacteria 2935769743 2935776986 287
86 iso_pu_bacteria 2935777560 2935783541 287
87 iso_pu_bacteria 2935785616 2935792813 287
88 iso_pu_bacteria 2935793552 2935800839 287
89 iso_pu_bacteria 2935819856 2935823002 287
90 iso_pu_bacteria 2935847175 2935848584 287
91 iso_pu_bacteria 2935908558 2935909609 287
92 iso_pu_bacteria 2935916978 2935917334 287
93 iso_pu_bacteria 2935926038 2935927090 287
94 iso_pu_bacteria 2935934488 2935937066 287
95 iso_pu_bacteria 2935942939 2935944631 287
96 iso_pu_bacteria 2935951376 2935953068 287
97 iso_pu_bacteria 2935967501 2935969908 287
98 iso_pu_bacteria 2935975950 2935976504 287
99 iso_pu_bacteria 2935984226 2935987042 287
100 iso_pu_bacteria 8016522445 8016528675 287
101 iso_pu_bacteria 8016548790 8016555048 287
102 iso_pu_bacteria 8016557553 8016563413 287
103 iso_pu_bacteria 8016566248 8016572183 287
104 iso_pu_bacteria 8016595262 8016601162 287
105 iso_pu_bacteria 8016603502 8016609281 287
106 iso_pu_bacteria 8016613128 8016615622 287
107 iso_pu_bacteria 8016622563 8016625601 287
108 iso_pu_bacteria 8019530166 8019533622 287
109 iso_pu_bacteria 8019538911 8019546042 287
110 iso_pu_bacteria 8019629233 8019633292 287
111 iso_pu_bacteria 8019638758 8019646609 287
112 iso_pu_bacteria 8019668869 8019670717 287
113 iso_pu_bacteria 8019687851 8019691082 287
114 iso_pu_bacteria 8055909800 8055910850 287
115 3300031616 Ga0307508_10042859 Ga0307508_100428594 288
116 3300041498 Ga0451841_0149809 Ga0451841_0149809_1325_2194 288
117 3300046460 Ga0495638_0001260 Ga0495638_0001260_18273_19142 288
118 3300046471 Ga0495650_0035573 Ga0495650_0035573_1072_1944 288
119 3300046660 Ga0495625_0002827 Ga0495625_0002827_2318_3187 288
120 3300048917 Ga0496114_0161153 Ga0496114_0161153_123_995 288
121 3300005331 Ga0070670_100002228 Ga0070670_10000222811 289
122 3300005563 Ga0068855_100784788 Ga0068855_1007847881 289
123 3300025925 Ga0207650_10005240 Ga0207650_100052406 289
124 3300026041 Ga0207639_10163334 Ga0207639_101633342 289
125 3300031344 Ga0265316_10386812 Ga0265316_103868121 289
126 3300037312 Ga0395899_0026293 Ga0395899_0026293_2581_3462 289
127 3300037418 Ga0395900_0006719 Ga0395900_0006719_2889_3770 289
128 3300037466 Ga0395898_0010432 Ga0395898_0010432_7648_8529 289
129 3300038443 Ga0395901_0115648 Ga0395901_0115648_626_1507 289
130 3300045976 Ga0466967_0171693 Ga0466967_0171693_146_1021 289
131 3300048929 Ga0496126_0049262 Ga0496126_0049262_2604_3473 289
132 3300053088 Ga0500644_0016339 Ga0500644_0016339_266_1135 289
133 3300053118 Ga0500594_0000846 Ga0500594_0000846_548_1417 289
134 3300053136 Ga0500559_0000022 Ga0500559_0000022_32531_33400 289
135 3300053156 Ga0500622_0000498 Ga0500622_0000498_28219_29088 289
136 3300053739 Ga0500587_001710 Ga0500587_001710_446_1315 289
137 3300009036 Ga0105244_10127899 Ga0105244_101278992 290
138 3300013306 Ga0163162_10021735 Ga0163162_100217355 290
139 3300017792 Ga0163161_10008039 Ga0163161_100080393 290
140 3300021324 Ga0214545_1022092 Ga0214545_10220924 290
141 3300025728 Ga0207655_1095348 Ga0207655_10953481 290
142 3300025940 Ga0207691_10103951 Ga0207691_101039513 290
143 3300028800 Ga0265338_10092200 Ga0265338_100922002 290
144 3300031711 Ga0265314_10129975 Ga0265314_101299752 290
145 3300031730 Ga0307516_10004401 Ga0307516_1000440113 290
146 3300039437 Ga0436365_0429102 Ga0436365_0429102_757_1629 290
147 3300046675 Ga0495657_0126223 Ga0495657_0126223_642_1514 290
148 3300048905 Ga0496102_0142931 Ga0496102_0142931_242_1114 290
149 3300048909 Ga0496106_0045534 Ga0496106_0045534_1785_2657 290
150 3300048914 Ga0496111_0039177 Ga0496111_0039177_2319_3191 290
151 3300049570 Ga0501033_0106191 Ga0501033_0106191_399_1277 290
152 3300049571 Ga0501034_0140799 Ga0501034_0140799_201_1076 290
153 3300049571 Ga0501034_0537423 Ga0501034_0537423_126_1004 290
154 3300049580 Ga0501046_0239413 Ga0501046_0239413_166_1041 290
155 3300049581 Ga0501047_0009890 Ga0501047_0009890_3287_4165 290
156 3300049581 Ga0501047_0220609 Ga0501047_0220609_166_1041 290
157 3300049585 Ga0501069_0026933 Ga0501069_0026933_2214_3092 290
158 3300049586 Ga0501070_0005785 Ga0501070_0005785_4216_5094 290
159 3300049589 Ga0501073_0153154 Ga0501073_0153154_652_1530 290
160 3300049742 Ga0501080_0203052 Ga0501080_0203052_83_961 290
161 3300049742 Ga0501080_0300955 Ga0501080_0300955_38_913 290
162 3300049822 Ga0501035_0002538 Ga0501035_0002538_5922_6794 290
163 3300049822 Ga0501035_0036244 Ga0501035_0036244_1605_2483 290
164 3300049822 Ga0501035_0041781 Ga0501035_0041781_223_1095 290
165 3300049822 Ga0501035_0155600 Ga0501035_0155600_198_1073 290
166 3300049823 Ga0501044_0048698 Ga0501044_0048698_1197_2072 290
167 3300049823 Ga0501044_0067248 Ga0501044_0067248_686_1564 290
168 3300053136 Ga0500559_0073480 Ga0500559_0073480_56_928 290
169 3300003354 JGI25160J50197_1001839 JGI25160J50197_10018396 291
170 3300003781 Ga0055536_1003906 Ga0055536_10039064 291
171 3300003784 Ga0055534_1005345 Ga0055534_10053453 291
172 3300003791 Ga0055530_10000270 Ga0055530_100002704 291
173 3300003794 Ga0055531_10000371 Ga0055531_100003715 291
174 3300003794 Ga0055531_10002670 Ga0055531_100026706 291
175 3300005331 Ga0070670_100062561 Ga0070670_1000625611 291
176 3300005353 Ga0070669_100016213 Ga0070669_1000162133 291
177 3300005354 Ga0070675_100140302 Ga0070675_1001403021 291
178 3300005455 Ga0070663_100029260 Ga0070663_1000292602 291
179 3300005455 Ga0070663_100062183 Ga0070663_1000621831 291
180 3300005455 Ga0070663_100162059 Ga0070663_1001620592 291
181 3300005455 Ga0070663_100524460 Ga0070663_1005244601 291
182 3300005530 Ga0070679_100109232 Ga0070679_1001092323 291
183 3300005530 Ga0070679_100643429 Ga0070679_1006434291 291
184 3300005536 Ga0070697_100152728 Ga0070697_1001527282 291
185 3300005564 Ga0070664_100009876 Ga0070664_1000098763 291
186 3300005617 Ga0068859_100014870 Ga0068859_1000148705 291
187 3300005842 Ga0068858_100006226 Ga0068858_10000622612 291
188 3300005937 Ga0081455_10027273 Ga0081455_100272733 291
189 3300006931 Ga0097620_100014869 Ga0097620_1000148695 291
190 3300009148 Ga0105243_10320576 Ga0105243_103205762 291
191 3300011119 Ga0105246_10035750 Ga0105246_100357502 291
192 3300013102 Ga0157371_10084565 Ga0157371_100845652 291
193 3300013105 Ga0157369_10381456 Ga0157369_103814561 291
194 3300021361 Ga0213872_10002411 Ga0213872_100024114 291
195 3300021384 Ga0213876_10011983 Ga0213876_100119831 291
196 3300025261 Ga0209233_1000084 Ga0209233_100008469 291
197 3300025291 Ga0209675_1000076 Ga0209675_1000076149 291
198 3300025292 Ga0209676_1000085 Ga0209676_100008543 291
199 3300025292 Ga0209676_1001055 Ga0209676_10010556 291
200 3300025294 Ga0209025_1008554 Ga0209025_10085543 291
201 3300025298 Ga0209050_1000042 Ga0209050_1000042208 291
202 3300025302 Ga0207426_1001289 Ga0207426_100128917 291
203 3300025304 Ga0209257_1000135 Ga0209257_1000135179 291
204 3300025304 Ga0209257_1000482 Ga0209257_100048242 291
205 3300025921 Ga0207652_10042633 Ga0207652_100426335 291
206 3300025923 Ga0207681_10088077 Ga0207681_100880773 291
207 3300025935 Ga0207709_10138331 Ga0207709_101383312 291
208 3300025938 Ga0207704_10375352 Ga0207704_103753521 291
209 3300025940 Ga0207691_10023206 Ga0207691_100232065 291
210 3300025942 Ga0207689_10038890 Ga0207689_100388903 291
211 3300025945 Ga0207679_10482211 Ga0207679_104822111 291
212 3300026035 Ga0207703_10018457 Ga0207703_100184572 291
213 3300026067 Ga0207678_10023178 Ga0207678_100231785 291
214 3300026067 Ga0207678_10027281 Ga0207678_100272813 291
215 3300026067 Ga0207678_10099843 Ga0207678_100998433 291
216 3300026078 Ga0207702_10376496 Ga0207702_103764962 291
217 3300026088 Ga0207641_10004864 Ga0207641_100048646 291
218 3300026116 Ga0207674_10003716 Ga0207674_1000371618 291
219 3300026142 Ga0207698_10138108 Ga0207698_101381081 291
220 3300027360 Ga0209969_1000879 Ga0209969_10008791 291
221 3300027378 Ga0209981_1000672 Ga0209981_10006725 291
222 3300027665 Ga0209983_1003355 Ga0209983_10033552 291
223 3300028556 Ga0265337_1003307 Ga0265337_10033076 291
224 3300028558 Ga0265326_10001217 Ga0265326_100012179 291
225 3300028563 Ga0265319_1001686 Ga0265319_10016868 291
226 3300028573 Ga0265334_10001564 Ga0265334_100015648 291
227 3300028577 Ga0265318_10012678 Ga0265318_100126784 291
228 3300028653 Ga0265323_10003591 Ga0265323_100035918 291
229 3300028666 Ga0265336_10000135 Ga0265336_100001357 291
230 3300028794 Ga0307515_10000150 Ga0307515_10000150132 291
231 3300028800 Ga0265338_10000034 Ga0265338_10000034199 291
232 3300029957 Ga0265324_10001198 Ga0265324_1000119812 291
233 3300031665 Ga0316575_10028283 Ga0316575_100282832 291
234 3300031691 Ga0316579_10000302 Ga0316579_1000030213 291
235 3300031730 Ga0307516_10303359 Ga0307516_103033592 291
236 3300031901 Ga0307406_10297790 Ga0307406_102977901 291
237 3300032004 Ga0307414_10207033 Ga0307414_102070332 291
238 3300032133 Ga0316583_10003057 Ga0316583_100030574 291
239 3300035111 Ga0373923_0059224 Ga0373923_0059224_396_1271 291
240 3300035117 Ga0373953_0099811 Ga0373953_0099811_31_909 291
241 3300035695 Ga0373927_0015500 Ga0373927_0015500_995_1870 291
242 3300035724 Ga0373933_0033903 Ga0373933_0033903_1594_2469 291
243 3300035725 Ga0373947_0262682 Ga0373947_0262682_165_1127 291
244 3300036401 Ga0373937_0037314 Ga0373937_0037314_146_1021 291
245 3300036647 Ga0316582_0010188 Ga0316582_0010188_93_974 291
246 3300037068 Ga0373925_0013015 Ga0373925_0013015_3921_4796 291
247 3300037588 Ga0316581_0031225 Ga0316581_0031225_476_1357 291
248 3300039437 Ga0436365_0441617 Ga0436365_0441617_1261_2160 291
249 3300039447 Ga0436361_0360172 Ga0436361_0360172_30621_31496 291
250 3300041997 Ga0439431_0038792 Ga0439431_0038792_209_1084 291
251 3300044765 Ga0466970_0156114 Ga0466970_0156114_88_984 291
252 3300046460 Ga0495638_0000414 Ga0495638_0000414_29911_30930 291
253 3300046460 Ga0495638_0000521 Ga0495638_0000521_5577_6452 291
254 3300046471 Ga0495650_0002946 Ga0495650_0002946_7082_7957 291
255 3300046471 Ga0495650_0052900 Ga0495650_0052900_189_1070 291
256 3300046474 Ga0495605_0007521 Ga0495605_0007521_3388_4263 291
257 3300046506 Ga0495583_0000173 Ga0495583_0000173_9689_10564 291
258 3300046506 Ga0495583_0020876 Ga0495583_0020876_1539_2414 291
259 3300046507 Ga0495606_0000600 Ga0495606_0000600_49015_49890 291
260 3300046512 Ga0495610_0070974 Ga0495610_0070974_112_987 291
261 3300046522 Ga0495643_0081449 Ga0495643_0081449_755_1636 291
262 3300046522 Ga0495643_0192484 Ga0495643_0192484_28_903 291
263 3300046530 Ga0495654_0053148 Ga0495654_0053148_819_1694 291
264 3300046530 Ga0495654_0056217 Ga0495654_0056217_155_1039 291
265 3300046616 Ga0495668_0023398 Ga0495668_0023398_594_1469 291
266 3300046660 Ga0495625_0000373 Ga0495625_0000373_43535_44410 291
267 3300046660 Ga0495625_0000492 Ga0495625_0000492_32717_33622 291
268 3300046660 Ga0495625_0019290 Ga0495625_0019290_2257_3132 291
269 3300046660 Ga0495625_0030977 Ga0495625_0030977_2126_3001 291
270 3300046694 Ga0495649_0000655 Ga0495649_0000655_13289_14164 291
271 3300046794 Ga0495589_0064242 Ga0495589_0064242_13_888 291
272 3300046810 Ga0495660_0113591 Ga0495660_0113591_455_1330 291
273 3300047320 Ga0495672_0028456 Ga0495672_0028456_2407_3282 291
274 3300047472 Ga0495686_0056522 Ga0495686_0056522_816_1754 291
275 3300048912 Ga0496109_0485347 Ga0496109_0485347_181_1062 291
276 3300048918 Ga0496115_0000210 Ga0496115_0000210_16031_16924 291
277 3300050496 nmdc:mga07m45_25798_c1 nmdc:mga07m45_25798_c1_1773_2648 291
278 3300053105 Ga0500557_000435 Ga0500557_000435_654_1529 291
279 3300053109 Ga0500569_031258 Ga0500569_031258_590_1465 291
280 3300053116 Ga0500592_003255 Ga0500592_003255_1636_2520 291
281 3300053139 Ga0500568_0005702 Ga0500568_0005702_128_1003 291
282 3300053151 Ga0500604_0044149 Ga0500604_0044149_440_1315 291
283 3300053153 Ga0500616_0000387 Ga0500616_0000387_22764_23639 291
284 3300053156 Ga0500622_0001132 Ga0500622_0001132_7007_7891 291
285 3300053158 Ga0500627_0000343 Ga0500627_0000343_7201_8085 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

173

245

0.85

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

161

250

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mzw-assembly1.cif.gz_B crystal structure of nu-class glutathione transferase yghu from streptococcus sanguinis sk36, complex with glutathione disulfide, target efi-507286 0.983 6 257
3c8e-assembly1.cif.gz_B crystal structure analysis of yghu from e. coli 0.9823 7 287
4pua-assembly1.cif.gz_A-2 crystal structure of glutathione transferase yghu from streptococcus pneumoniae atcc 700669, complexed with glutathione, target efi-507284 0.9814 6 257
3c8e-assembly1.cif.gz_B crystal structure analysis of yghu from e. coli 0.972 7 287
5uuo-assembly1.cif.gz_B crystal structure of saro_2595 from novosphingobium aromaticivorans 0.962 7 287
ID Description Score Start End Superfamily
af_Q46845_139_253_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 1.003 141 254 1.20.1050.10
4puaA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9957 134 250 1.20.1050.10
af_Q46845_42_135_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9948 43 136 3.40.30.10
4mzwA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9931 134 256 1.20.1050.10
3c8eB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9913 133 287 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A6D1AJF6-F1-model_v4 Glutathione-dependent disulfide-bond oxidoreductase 1.002 43 119
AF-A0A0F9EDB1-F1-model_v4 GST C-terminal domain-containing protein 1 192 287
AF-A0A1I4D489-F1-model_v4 GST-like protein 0.9994 182 290
AF-A0A3M3ZQM2-F1-model_v4 GST C-terminal domain-containing protein 0.9993 114 215
AF-A0A6L7CMQ1-F1-model_v4 Glutathione-dependent disulfide-bond oxidoreductase 0.9981 99 288

Feature Viewer

pLDDT pTM Quality
94.93 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map