F386640

General Info

Members Datasets Scaffolds Average Seq Length
285 195 570 176

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100693096|Ga0070713_1006930962
Length 211
Sequence MVFVLQREPREGLSQGRRELYHSGMSILKVAHMGHPVLRARARAVDPADIKSARIQQLIDDMFETMKEYNGVGLAAPQVHESLRLFVAGFAPRPGRDEDEXXDDTRVPLMTLINPEITPIGTTIEEDWEGCLSIPEIRGRVPRPREIEVKAYDRRGRRISIHARGFTARVIQHETDHLDGVLFMDRMKSLETLTYIPEFNRYWGSRDVPEE

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
74 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
125 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
126 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
129 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
130 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
131 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
132 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
169 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
189 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
192 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.19
Metatranscriptomes 2.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.14
Nodule 0
Rhizoplane 3.86
Rhizosphere 78.95
Stem 0
Stem Tuber 0
Unclassified 8.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100693096 3300005436 Bacteria 972
2 Ga0058859_11458664 3300004798 Unclassified 765
3 Ga0058859_11573273 3300004798 Bacteria 1878
4 Ga0058860_11496949 3300004801 Bacteria 2175
5 Ga0065712_10017065 3300005290 Bacteria 1907
6 Ga0065712_10180867 3300005290 Bacteria 1193
7 Ga0065715_10593092 3300005293 Bacteria 712
8 Ga0065707_10017363 3300005295 Bacteria 1367
9 Ga0070683_100204596 3300005329 Unclassified 1875
10 Ga0070670_100150921 3300005331 Bacteria 2011
11 Ga0070677_10060013 3300005333 Bacteria 1566
12 Ga0068869_100382609 3300005334 Bacteria 1154
13 Ga0070689_100480439 3300005340 Bacteria 1061
14 Ga0070687_100300059 3300005343 Bacteria 1019
15 Ga0070669_100359507 3300005353 Bacteria 1183
16 Ga0070675_100105794 3300005354 Bacteria 2374
17 Ga0070671_100493415 3300005355 Bacteria 1053
18 Ga0070659_100086753 3300005366 Bacteria 2505
19 Ga0070713_100004862 3300005436 Bacteria 9108
20 Ga0070694_100872865 3300005444 Bacteria 741
21 Ga0070663_100342486 3300005455 Bacteria 1208
22 Ga0070706_100175601 3300005467 Bacteria 2000
23 Ga0070706_101093902 3300005467 Bacteria 734
24 Ga0070707_100191377 3300005468 Bacteria 1995
25 Ga0070699_100526365 3300005518 Bacteria 1075
26 Ga0070684_100059307 3300005535 Bacteria 3345
27 Ga0068853_100476686 3300005539 Bacteria 1176
28 Ga0070672_100276996 3300005543 Bacteria 1417
29 Ga0070696_100405884 3300005546 Bacteria 1067
30 Ga0068855_100114846 3300005563 Bacteria 3087
31 Ga0068855_100659412 3300005563 Bacteria 1123
32 Ga0070664_100088708 3300005564 Bacteria 2674
33 Ga0068856_100412129 3300005614 Unclassified 1371
34 Ga0068856_100439005 3300005614 Bacteria 1326
35 Ga0070702_100684732 3300005615 Bacteria 779
36 Ga0068852_100890411 3300005616 Bacteria 907
37 Ga0068859_100093176 3300005617 Bacteria 3064
38 Ga0068864_100430511 3300005618 Bacteria 1259
39 Ga0068861_100030733 3300005719 Bacteria 3939
40 Ga0068861_100352214 3300005719 Bacteria 1292
41 Ga0068861_100757725 3300005719 Bacteria 907
42 Ga0068851_10108181 3300005834 Bacteria 1482
43 Ga0068870_10045983 3300005840 Bacteria 2288
44 Ga0081455_10002588 3300005937 Bacteria 21449
45 Ga0081455_10689855 3300005937 Unclassified 652
46 Ga0081538_10003065 3300005981 Bacteria 15911
47 Ga0081539_10004665 3300005985 Bacteria 14895
48 Ga0075365_10013726 3300006038 Bacteria 4858
49 Ga0075368_10008660 3300006042 Bacteria 3633
50 Ga0075368_10214620 3300006042 Bacteria 816
51 Ga0075363_100012773 3300006048 Bacteria 4053
52 Ga0075364_10014784 3300006051 Bacteria 4828
53 Ga0075364_10026358 3300006051 Bacteria 3708
54 Ga0075364_10508579 3300006051 Bacteria 823
55 Ga0075362_10237158 3300006177 Bacteria 895
56 Ga0075367_10036630 3300006178 Bacteria 2846
57 Ga0075367_10042628 3300006178 Bacteria 2656
58 Ga0075367_10101133 3300006178 Bacteria 1762
59 Ga0075367_10153408 3300006178 Bacteria 1430
60 Ga0075369_10054014 3300006186 Bacteria 1744
61 Ga0075366_10007773 3300006195 Bacteria 5935
62 Ga0075366_10034322 3300006195 Bacteria 2987
63 Ga0097621_100121935 3300006237 Bacteria 2211
64 Ga0075370_10006888 3300006353 Bacteria 5751
65 Ga0075370_10058576 3300006353 Bacteria 2191
66 Ga0075370_10083696 3300006353 Bacteria 1835
67 Ga0068871_100455170 3300006358 Bacteria 1148
68 Ga0075428_100019869 3300006844 Bacteria 7436
69 Ga0075428_100167800 3300006844 Bacteria 2381
70 Ga0075428_100817463 3300006844 Bacteria 990
71 Ga0075430_100003996 3300006846 Bacteria 12435
72 Ga0075430_100053975 3300006846 Bacteria 3382
73 Ga0075431_100155923 3300006847 Bacteria 2349
74 Ga0075431_100381931 3300006847 Bacteria 1412
75 Ga0075433_10781588 3300006852 Bacteria 835
76 Ga0075434_100013432 3300006871 Bacteria 7794
77 Ga0075434_100059253 3300006871 Bacteria 3806
78 Ga0075434_100167688 3300006871 Bacteria 2216
79 Ga0075434_100389421 3300006871 Bacteria 1415
80 Ga0075429_100004082 3300006880 Bacteria 12517
81 Ga0075429_100047285 3300006880 Bacteria 3743
82 Ga0097620_100093175 3300006931 Bacteria 3064
83 Ga0075435_100005178 3300007076 Bacteria 9069
84 Ga0105240_10200104 3300009093 Bacteria 2342
85 Ga0105240_10238450 3300009093 Bacteria 2110
86 Ga0111539_10154739 3300009094 Bacteria 2683
87 Ga0111539_11718394 3300009094 Bacteria 728
88 Ga0114129_10098816 3300009147 Bacteria 4040
89 Ga0114129_11547391 3300009147 Bacteria 813
90 Ga0105241_11101924 3300009174 Bacteria 748
91 Ga0105248_10156362 3300009177 Bacteria 2573
92 Ga0105248_10492193 3300009177 Bacteria 1382
93 Ga0105238_10174228 3300009551 Bacteria 2128
94 Ga0105238_10188523 3300009551 Bacteria 2039
95 Ga0105238_11035868 3300009551 Bacteria 842
96 Ga0105249_10639059 3300009553 Bacteria 1121
97 Ga0105249_11000091 3300009553 Bacteria 905
98 Ga0157378_11143163 3300013297 Bacteria 817
99 Ga0157375_10262882 3300013308 Bacteria 1887
100 Ga0157380_10531882 3300014326 Bacteria 1149
101 Ga0157380_10556219 3300014326 Bacteria 1126
102 Ga0157380_11531812 3300014326 Unclassified 721
103 Ga0157379_10016390 3300014968 Bacteria 6519
104 Ga0157376_10055346 3300014969 Bacteria 3310
105 Ga0157376_10258427 3300014969 Bacteria 1630
106 Ga0163161_10168472 3300017792 Bacteria 1673
107 Ga0197907_10709136 3300020069 Bacteria 1233
108 Ga0206356_10621951 3300020070 Unclassified 1115
109 Ga0206355_1456102 3300020076 Unclassified 1468
110 Ga0206350_10248204 3300020080 Bacteria 4416
111 Ga0224712_10000892 3300022467 Bacteria 6406
112 Ga0207656_10066084 3300025321 Bacteria 1597
113 Ga0207643_10027404 3300025908 Bacteria 3159
114 Ga0207684_10034013 3300025910 Bacteria 4334
115 Ga0207695_10174203 3300025913 Bacteria 2075
116 Ga0207695_10260163 3300025913 Bacteria 1633
117 Ga0207662_10697980 3300025918 Bacteria 711
118 Ga0207649_10038541 3300025920 Bacteria 2894
119 Ga0207646_10115846 3300025922 Bacteria 2407
120 Ga0207681_11294493 3300025923 Bacteria 612
121 Ga0207650_10008008 3300025925 Bacteria 7201
122 Ga0207650_10057177 3300025925 Bacteria 2900
123 Ga0207700_10006959 3300025928 Bacteria 6880
124 Ga0207700_10219543 3300025928 Bacteria 1611
125 Ga0207644_10083208 3300025931 Bacteria 2369
126 Ga0207644_10757672 3300025931 Unclassified 811
127 Ga0207706_10132078 3300025933 Bacteria 2196
128 Ga0207706_11139600 3300025933 Bacteria 650
129 Ga0207686_10307092 3300025934 Bacteria 1180
130 Ga0207669_10026464 3300025937 Bacteria 3156
131 Ga0207669_10328532 3300025937 Bacteria 1173
132 Ga0207691_10036536 3300025940 Bacteria 4552
133 Ga0207689_10120928 3300025942 Bacteria 2154
134 Ga0207661_10031293 3300025944 Bacteria 4108
135 Ga0207679_10490658 3300025945 Bacteria 1095
136 Ga0207667_10265838 3300025949 Unclassified 1754
137 Ga0207651_11110194 3300025960 Bacteria 709
138 Ga0207658_10453282 3300025986 Bacteria 1136
139 Ga0207677_10336405 3300026023 Bacteria 1260
140 Ga0207703_10265474 3300026035 Bacteria 1553
141 Ga0207639_10654808 3300026041 Unclassified 972
142 Ga0207678_10161919 3300026067 Bacteria 1911
143 Ga0207708_11219348 3300026075 Bacteria 658
144 Ga0207702_10372823 3300026078 Unclassified 1371
145 Ga0207702_10392075 3300026078 Bacteria 1337
146 Ga0207641_10592993 3300026088 Bacteria 1084
147 Ga0207676_10189106 3300026095 Bacteria 1810
148 Ga0207676_11421867 3300026095 Bacteria 690
149 Ga0207675_100034458 3300026118 Bacteria 4721
150 Ga0207675_100317856 3300026118 Bacteria 1520
151 Ga0268265_10186064 3300028380 Bacteria 1789
152 Ga0268265_10486109 3300028380 Bacteria 1161
153 Ga0268264_10301678 3300028381 Bacteria 1508
154 Ga0268264_10477751 3300028381 Bacteria 1212
155 Ga0307408_100280995 3300031548 Bacteria 1386
156 Ga0316576_10752826 3300031727 Bacteria 703
157 Ga0307410_10340708 3300031852 Bacteria 1195
158 Ga0307407_10210860 3300031903 Bacteria 1308
159 Ga0307409_100623617 3300031995 Bacteria 1069
160 Ga0307416_100932786 3300032002 Bacteria 969
161 Ga0307411_10293783 3300032005 Bacteria 1300
162 Ga0373931_0343537 3300035691 Unclassified 933
163 Ga0373935_0171383 3300035692 Bacteria 1485
164 Ga0373933_0404099 3300035724 Unclassified 891
165 Ga0373937_0016058 3300036401 Bacteria 6641
166 Ga0373937_0914142 3300036401 Bacteria 826
167 Ga0395905_0839811 3300037471 Bacteria 821
168 Ga0436360_0039197 3300039438 Bacteria 828
169 Ga0436361_0842863 3300039447 Bacteria 1655
170 Ga0451791_1787958 3300041451 Bacteria 857
171 Ga0451793_1864061 3300041452 Bacteria 1422
172 Ga0451797_0351337 3300041453 Bacteria 1609
173 Ga0451798_0425496 3300041458 Bacteria 843
174 Ga0451802_1342468 3300041460 Bacteria 1212
175 Ga0451807_0175556 3300041486 Bacteria 1977
176 Ga0439431_0021306 3300041997 Bacteria 1555
177 Ga0439446_0009943 3300042156 Bacteria 2554
178 Ga0439434_0069904 3300042435 Bacteria 1104
179 Ga0439444_0028593 3300042437 Unclassified 1033
180 Ga0450918_034363 3300042531 Bacteria 900
181 Ga0451577_0481854 3300042876 Bacteria 1126
182 Ga0453684_0027015 3300044712 Bacteria 8257
183 Ga0453684_0396324 3300044712 Bacteria 1547
184 Ga0495638_0020097 3300046460 Bacteria 4413
185 Ga0495638_0023489 3300046460 Bacteria 4032
186 Ga0495651_0359473 3300046462 Unclassified 960
187 Ga0495635_0094786 3300046663 Bacteria 2041
188 Ga0495623_0477461 3300046679 Bacteria 661
189 Ga0495658_0236362 3300046683 Bacteria 1147
190 Ga0495604_0095200 3300047317 Bacteria 2200
191 Ga0495684_0058605 3300047471 Bacteria 2933
192 Ga0496102_0163573 3300048905 Bacteria 2094
193 Ga0496104_0232407 3300048907 Bacteria 1756
194 Ga0496105_0330037 3300048908 Bacteria 1221
195 Ga0496106_0143111 3300048909 Unclassified 1882
196 Ga0496111_0563509 3300048914 Bacteria 836
197 Ga0501031_0121108 3300049568 Bacteria 1709
198 Ga0501036_0393812 3300049572 Bacteria 1156
199 Ga0501037_0795533 3300049573 Bacteria 625
200 Ga0501038_0102340 3300049574 Bacteria 2384
201 Ga0501038_0432555 3300049574 Bacteria 1014
202 Ga0501039_0181282 3300049575 Bacteria 1656
203 Ga0501039_0295259 3300049575 Bacteria 1274
204 Ga0501040_0211432 3300049576 Bacteria 1379
205 Ga0501041_0048496 3300049577 Bacteria 2587
206 Ga0501042_0036209 3300049578 Bacteria 3501
207 Ga0501042_0129250 3300049578 Bacteria 1820
208 Ga0501042_0333723 3300049578 Unclassified 1096
209 Ga0501042_0583627 3300049578 Bacteria 813
210 Ga0501043_0161802 3300049579 Bacteria 1749
211 Ga0501047_0125686 3300049581 Bacteria 2445
212 Ga0501048_0063279 3300049582 Bacteria 2617
213 Ga0501048_0436069 3300049582 Bacteria 938
214 Ga0501068_0066725 3300049584 Bacteria 2192
215 Ga0501071_0006491 3300049587 Bacteria 7591
216 Ga0501072_0265697 3300049588 Bacteria 1365
217 Ga0501072_0439794 3300049588 Bacteria 1033
218 Ga0501072_0581638 3300049588 Bacteria 883
219 Ga0501074_0109842 3300049590 Bacteria 1973
220 Ga0501075_0077282 3300049591 Bacteria 2519
221 Ga0501075_0136756 3300049591 Bacteria 1867
222 Ga0501076_0153370 3300049592 Bacteria 1874
223 Ga0501076_0535066 3300049592 Bacteria 966
224 Ga0501077_0065399 3300049593 Bacteria 2306
225 Ga0501079_0409644 3300049741 Bacteria 1064
226 Ga0501080_0308279 3300049742 Unclassified 1435
227 Ga0501080_0631633 3300049742 Bacteria 949
228 Ga0501035_0629529 3300049822 Bacteria 872
229 Ga0501035_0819595 3300049822 Unclassified 742
230 nmdc:mga03683_329116_c1 3300050489 Bacteria 720
231 nmdc:mga03n38_68438_c1 3300050490 Bacteria 1637
232 nmdc:mga00v17_139670_c1 3300050491 Bacteria 1553
233 nmdc:mga00v17_315370_c1 3300050491 Bacteria 1016
234 nmdc:mga00v17_5020_c1 3300050491 Bacteria 6948
235 nmdc:mga00v17_54038_c1 3300050491 Bacteria 2449
236 nmdc:mga0yw44_148501_c1 3300050492 Bacteria 1528
237 nmdc:mga0yw44_152469_c1 3300050492 Bacteria 1508
238 nmdc:mga0k408_187299_c1 3300050493 Bacteria 1234
239 nmdc:mga0k408_26761_c1 3300050493 Bacteria 3272
240 nmdc:mga0k408_39327_c1 3300050493 Bacteria 2717
241 nmdc:mga0k408_90412_c1 3300050493 Bacteria 1798
242 nmdc:mga06z11_115420_c1 3300050494 Bacteria 1492
243 nmdc:mga06z11_116125_c1 3300050494 Bacteria 1488
244 nmdc:mga06z11_243613_c1 3300050494 Bacteria 1057
245 nmdc:mga06z11_501825_c1 3300050494 Bacteria 735
246 nmdc:mga06z11_71435_c1 3300050494 Bacteria 1838
247 nmdc:mga04h51_296691_c1 3300050495 Bacteria 658
248 nmdc:mga07m45_189487_c1 3300050496 Bacteria 1196
249 nmdc:mga07m45_41219_c1 3300050496 Bacteria 2585
250 nmdc:mga07m45_51165_c1 3300050496 Bacteria 2329
251 nmdc:mga05p37_186206_c1 3300050507 Bacteria 2524
252 nmdc:mga05p37_322855_c1 3300050507 Bacteria 1827
253 nmdc:mga05p37_656445_c1 3300050507 Unclassified 1173
254 nmdc:mga09592_72335_c1 3300050508 Bacteria 2928
255 nmdc:mga09592_91432_c1 3300050508 Bacteria 2601
256 nmdc:mga0qj67_1042_c1 3300050509 Bacteria 19184
257 nmdc:mga0qj67_134282_c1 3300050509 Bacteria 2005
258 nmdc:mga06r32_190626_c1 3300050510 Bacteria 2038
259 nmdc:mga06r32_4711_c1 3300050510 Bacteria 12263
260 nmdc:mga08y16_517485_c1 3300050511 Bacteria 1210
261 nmdc:mga0n895_15179_c1 3300050512 Bacteria 7018
262 nmdc:mga0rr50_1189519_c1 3300050513 Unclassified 648
263 nmdc:mga0rr50_518991_c1 3300050513 Bacteria 1013
264 nmdc:mga08x19_589515_c1 3300050514 Bacteria 787
265 nmdc:mga0a205_160398_c1 3300050515 Bacteria 2146
266 nmdc:mga0a205_601565_c1 3300050515 Bacteria 953
267 nmdc:mga0sz30_224978_c1 3300050516 Bacteria 834
268 nmdc:mga0sz30_42773_c1 3300050516 Bacteria 1906
269 Ga0495601_0722160 3300053077 Unclassified 635
270 Ga0495619_0164537 3300053085 Bacteria 1533
271 Ga0500555_000105 3300053103 Bacteria 40073
272 Ga0500628_032209 3300053129 Bacteria 1145
273 Ga0500616_0000272 3300053153 Bacteria 77108
274 Ga0500645_000492 3300053730 Bacteria 26660
275 Ga0500599_001168 3300053736 Bacteria 2978
276 Ga0501084_0054482 3300054114 Bacteria 3346
277 Ga0501084_0428196 3300054114 Bacteria 1119
278 Ga0501082_0048980 3300060353 Bacteria 3643
279 Ga0501082_0203434 3300060353 Bacteria 1723
280 Ga0501082_0249997 3300060353 Bacteria 1543
281 Ga0501082_0827708 3300060353 Unclassified 810
282 Ga0501082_1325634 3300060353 Bacteria 629
283 Ga0530510_0001830 3300061734 Bacteria 14520
284 Ga0530510_0046032 3300061734 Bacteria 3152
285 Ga0530510_0258776 3300061734 Bacteria 1297
286 Ga0070713_100693096
287 Ga0058859_11458664
288 Ga0058859_11573273
289 Ga0058860_11496949
290 Ga0065712_10017065
291 Ga0065712_10180867
292 Ga0065715_10593092
293 Ga0065707_10017363
294 Ga0070683_100204596
295 Ga0070670_100150921
296 Ga0070677_10060013
297 Ga0068869_100382609
298 Ga0070689_100480439
299 Ga0070687_100300059
300 Ga0070669_100359507
301 Ga0070675_100105794
302 Ga0070671_100493415
303 Ga0070659_100086753
304 Ga0070713_100004862
305 Ga0070694_100872865
306 Ga0070663_100342486
307 Ga0070706_100175601
308 Ga0070706_101093902
309 Ga0070707_100191377
310 Ga0070699_100526365
311 Ga0070684_100059307
312 Ga0068853_100476686
313 Ga0070672_100276996
314 Ga0070696_100405884
315 Ga0068855_100114846
316 Ga0068855_100659412
317 Ga0070664_100088708
318 Ga0068856_100412129
319 Ga0068856_100439005
320 Ga0070702_100684732
321 Ga0068852_100890411
322 Ga0068859_100093176
323 Ga0068864_100430511
324 Ga0068861_100030733
325 Ga0068861_100352214
326 Ga0068861_100757725
327 Ga0068851_10108181
328 Ga0068870_10045983
329 Ga0081455_10002588
330 Ga0081455_10689855
331 Ga0081538_10003065
332 Ga0081539_10004665
333 Ga0075365_10013726
334 Ga0075368_10008660
335 Ga0075368_10214620
336 Ga0075363_100012773
337 Ga0075364_10014784
338 Ga0075364_10026358
339 Ga0075364_10508579
340 Ga0075362_10237158
341 Ga0075367_10036630
342 Ga0075367_10042628
343 Ga0075367_10101133
344 Ga0075367_10153408
345 Ga0075369_10054014
346 Ga0075366_10007773
347 Ga0075366_10034322
348 Ga0097621_100121935
349 Ga0075370_10006888
350 Ga0075370_10058576
351 Ga0075370_10083696
352 Ga0068871_100455170
353 Ga0075428_100019869
354 Ga0075428_100167800
355 Ga0075428_100817463
356 Ga0075430_100003996
357 Ga0075430_100053975
358 Ga0075431_100155923
359 Ga0075431_100381931
360 Ga0075433_10781588
361 Ga0075434_100013432
362 Ga0075434_100059253
363 Ga0075434_100167688
364 Ga0075434_100389421
365 Ga0075429_100004082
366 Ga0075429_100047285
367 Ga0097620_100093175
368 Ga0075435_100005178
369 Ga0105240_10200104
370 Ga0105240_10238450
371 Ga0111539_10154739
372 Ga0111539_11718394
373 Ga0114129_10098816
374 Ga0114129_11547391
375 Ga0105241_11101924
376 Ga0105248_10156362
377 Ga0105248_10492193
378 Ga0105238_10174228
379 Ga0105238_10188523
380 Ga0105238_11035868
381 Ga0105249_10639059
382 Ga0105249_11000091
383 Ga0157378_11143163
384 Ga0157375_10262882
385 Ga0157380_10531882
386 Ga0157380_10556219
387 Ga0157380_11531812
388 Ga0157379_10016390
389 Ga0157376_10055346
390 Ga0157376_10258427
391 Ga0163161_10168472
392 Ga0197907_10709136
393 Ga0206356_10621951
394 Ga0206355_1456102
395 Ga0206350_10248204
396 Ga0224712_10000892
397 Ga0207656_10066084
398 Ga0207643_10027404
399 Ga0207684_10034013
400 Ga0207695_10174203
401 Ga0207695_10260163
402 Ga0207662_10697980
403 Ga0207649_10038541
404 Ga0207646_10115846
405 Ga0207681_11294493
406 Ga0207650_10008008
407 Ga0207650_10057177
408 Ga0207700_10006959
409 Ga0207700_10219543
410 Ga0207644_10083208
411 Ga0207644_10757672
412 Ga0207706_10132078
413 Ga0207706_11139600
414 Ga0207686_10307092
415 Ga0207669_10026464
416 Ga0207669_10328532
417 Ga0207691_10036536
418 Ga0207689_10120928
419 Ga0207661_10031293
420 Ga0207679_10490658
421 Ga0207667_10265838
422 Ga0207651_11110194
423 Ga0207658_10453282
424 Ga0207677_10336405
425 Ga0207703_10265474
426 Ga0207639_10654808
427 Ga0207678_10161919
428 Ga0207708_11219348
429 Ga0207702_10372823
430 Ga0207702_10392075
431 Ga0207641_10592993
432 Ga0207676_10189106
433 Ga0207676_11421867
434 Ga0207675_100034458
435 Ga0207675_100317856
436 Ga0268265_10186064
437 Ga0268265_10486109
438 Ga0268264_10301678
439 Ga0268264_10477751
440 Ga0307408_100280995
441 Ga0316576_10752826
442 Ga0307410_10340708
443 Ga0307407_10210860
444 Ga0307409_100623617
445 Ga0307416_100932786
446 Ga0307411_10293783
447 Ga0373931_0343537
448 Ga0373935_0171383
449 Ga0373933_0404099
450 Ga0373937_0016058
451 Ga0373937_0914142
452 Ga0395905_0839811
453 Ga0436360_0039197
454 Ga0436361_0842863
455 Ga0451791_1787958
456 Ga0451793_1864061
457 Ga0451797_0351337
458 Ga0451798_0425496
459 Ga0451802_1342468
460 Ga0451807_0175556
461 Ga0439431_0021306
462 Ga0439446_0009943
463 Ga0439434_0069904
464 Ga0439444_0028593
465 Ga0450918_034363
466 Ga0451577_0481854
467 Ga0453684_0027015
468 Ga0453684_0396324
469 Ga0495638_0020097
470 Ga0495638_0023489
471 Ga0495651_0359473
472 Ga0495635_0094786
473 Ga0495623_0477461
474 Ga0495658_0236362
475 Ga0495604_0095200
476 Ga0495684_0058605
477 Ga0496102_0163573
478 Ga0496104_0232407
479 Ga0496105_0330037
480 Ga0496106_0143111
481 Ga0496111_0563509
482 Ga0501031_0121108
483 Ga0501036_0393812
484 Ga0501037_0795533
485 Ga0501038_0102340
486 Ga0501038_0432555
487 Ga0501039_0181282
488 Ga0501039_0295259
489 Ga0501040_0211432
490 Ga0501041_0048496
491 Ga0501042_0036209
492 Ga0501042_0129250
493 Ga0501042_0333723
494 Ga0501042_0583627
495 Ga0501043_0161802
496 Ga0501047_0125686
497 Ga0501048_0063279
498 Ga0501048_0436069
499 Ga0501068_0066725
500 Ga0501071_0006491
501 Ga0501072_0265697
502 Ga0501072_0439794
503 Ga0501072_0581638
504 Ga0501074_0109842
505 Ga0501075_0077282
506 Ga0501075_0136756
507 Ga0501076_0153370
508 Ga0501076_0535066
509 Ga0501077_0065399
510 Ga0501079_0409644
511 Ga0501080_0308279
512 Ga0501080_0631633
513 Ga0501035_0629529
514 Ga0501035_0819595
515 nmdc:mga03683_329116_c1
516 nmdc:mga03n38_68438_c1
517 nmdc:mga00v17_139670_c1
518 nmdc:mga00v17_315370_c1
519 nmdc:mga00v17_5020_c1
520 nmdc:mga00v17_54038_c1
521 nmdc:mga0yw44_148501_c1
522 nmdc:mga0yw44_152469_c1
523 nmdc:mga0k408_187299_c1
524 nmdc:mga0k408_26761_c1
525 nmdc:mga0k408_39327_c1
526 nmdc:mga0k408_90412_c1
527 nmdc:mga06z11_115420_c1
528 nmdc:mga06z11_116125_c1
529 nmdc:mga06z11_243613_c1
530 nmdc:mga06z11_501825_c1
531 nmdc:mga06z11_71435_c1
532 nmdc:mga04h51_296691_c1
533 nmdc:mga07m45_189487_c1
534 nmdc:mga07m45_41219_c1
535 nmdc:mga07m45_51165_c1
536 nmdc:mga05p37_186206_c1
537 nmdc:mga05p37_322855_c1
538 nmdc:mga05p37_656445_c1
539 nmdc:mga09592_72335_c1
540 nmdc:mga09592_91432_c1
541 nmdc:mga0qj67_1042_c1
542 nmdc:mga0qj67_134282_c1
543 nmdc:mga06r32_190626_c1
544 nmdc:mga06r32_4711_c1
545 nmdc:mga08y16_517485_c1
546 nmdc:mga0n895_15179_c1
547 nmdc:mga0rr50_1189519_c1
548 nmdc:mga0rr50_518991_c1
549 nmdc:mga08x19_589515_c1
550 nmdc:mga0a205_160398_c1
551 nmdc:mga0a205_601565_c1
552 nmdc:mga0sz30_224978_c1
553 nmdc:mga0sz30_42773_c1
554 Ga0495601_0722160
555 Ga0495619_0164537
556 Ga0500555_000105
557 Ga0500628_032209
558 Ga0500616_0000272
559 Ga0500645_000492
560 Ga0500599_001168
561 Ga0501084_0054482
562 Ga0501084_0428196
563 Ga0501082_0048980
564 Ga0501082_0203434
565 Ga0501082_0249997
566 Ga0501082_0827708
567 Ga0501082_1325634
568 Ga0530510_0001830
569 Ga0530510_0046032
570 Ga0530510_0258776

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

27

193

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vcp-assembly1.cif.gz_C crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.9867 2 168
5vcp-assembly1.cif.gz_A crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.9839 2 168
5vcp-assembly2.cif.gz_B crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.9833 2 168
6jfn-assembly2.cif.gz_B k4u bound crystal structure of class i type b peptide deformylase from pseudomonas aeruginosa 0.9823 2 168
5cwx-assembly1.cif.gz_A structure of xoo1075, a peptide deformylase from xanthomonas oryzae pv oryzae, in complex with fragment 134 0.9815 1 168
ID Description Score Start End Superfamily
5vcpA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9839 2 168 3.90.45.10
1rn5A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.965 1 168 3.90.45.10
5vcpA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9596 2 168 3.90.45.10
4je6A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9356 1 168 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9289 3 152 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A2V6X0S7-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9918 2 174 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A432I411-F1-model_v4 Peptide deformylase (EC 3.5.1.88) 0.9822 2 157 GO:0042586
GO:0043686
AF-A0A534XKG8-F1-model_v4 Peptide deformylase 0.9788 77 172 GO:0042586
GO:0043686
AF-A0A2V7YZL7-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9775 1 172 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A359ILU6-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9739 1 176 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Map