F386458

General Info

Members Datasets Scaffolds Average Seq Length
284 259 157 71

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_515822_c1|nmdc:mga06r32_515822_c1_150_410
Length 86
Sequence MMYAQYMQAPTKEVRVSKWIRQTHRWLSIIFTATVIANFVAMALGEPPAWVVYSPLPPLFLMLVTGLYMFVLPYAATWCSARSAGA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
6 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
7 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
8 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
9 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
10 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
11 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
12 2643221584 Caulobacter sp. Root656 Isolate Unclassified
13 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
14 2643221651 Afipia sp. Root123D2 Isolate Unclassified
15 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
16 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
17 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
18 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
19 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
20 2818991467 Bosea vestrisii 3192 Isolate Unclassified
21 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
22 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
23 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
24 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
25 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
26 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
27 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
28 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
29 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
30 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
31 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
32 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
33 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
34 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
35 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
36 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
37 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
38 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
39 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
40 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
41 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
42 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
43 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
44 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
45 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
46 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
47 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
48 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
49 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
50 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
51 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
52 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
53 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
54 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
55 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
56 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
57 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
58 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
59 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
60 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
61 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
62 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
63 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
64 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
65 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
66 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
67 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
68 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
69 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
70 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
71 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
72 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
73 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
74 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
75 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
76 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
77 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
78 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
79 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
80 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
81 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
82 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
83 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
84 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
85 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
86 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
87 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
88 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
89 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
90 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
91 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
92 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
93 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
94 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
95 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
96 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
97 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
98 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
99 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
100 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
101 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
102 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
103 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
104 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
105 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
106 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
107 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
108 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
109 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
110 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
111 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
112 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
113 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
114 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
115 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
116 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
117 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
118 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
119 3004167301 Mesorhizobium loti 582 Isolate Unclassified
120 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
121 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
122 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
123 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
124 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
125 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
126 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
127 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
128 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
129 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
130 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
131 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
132 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
133 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
134 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
135 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
136 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
137 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
138 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
139 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
140 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
141 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
142 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
143 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
144 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
145 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
146 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
147 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
148 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
149 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
150 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
151 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
152 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
153 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
154 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
155 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
156 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
157 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
158 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
159 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
160 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
161 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
162 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
163 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
164 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
165 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
166 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
167 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
168 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
169 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
170 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
171 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
172 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
173 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
174 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
175 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
176 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
177 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
178 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
181 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
183 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
208 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
209 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
210 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
252 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
255 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
258 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
259 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.93
Metatranscriptomes 0.35
Isolates 44.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.49
Nodule 38.38
Rhizoplane 3.17
Rhizosphere 34.86
Stem 0
Stem Tuber 0
Unclassified 8.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10120985 3300001979 Bacteria 656
2 JGI25151J46595_10047140 3300003187 Bacteria 1502
3 Ga0055542_1000845 3300003762 Bacteria 21558
4 Ga0055529_1017818 3300003763 Bacteria 889
5 Ga0055524_1008537 3300003775 Bacteria 4248
6 Ga0065165_1003955 3300005262 Bacteria 9722
7 Ga0070658_11017137 3300005327 Bacteria 721
8 Ga0070666_10526987 3300005335 Bacteria 858
9 Ga0070660_100220471 3300005339 Bacteria 1541
10 Ga0070661_100167319 3300005344 Bacteria 1668
11 Ga0070674_101002888 3300005356 Bacteria 733
12 Ga0070673_101355029 3300005364 Bacteria 669
13 Ga0070659_100779373 3300005366 Bacteria 831
14 Ga0070713_101061634 3300005436 Bacteria 782
15 Ga0070663_100069211 3300005455 Bacteria 2563
16 Ga0068867_100912665 3300005459 Bacteria 791
17 Ga0068853_100290340 3300005539 Bacteria 1509
18 Ga0068855_100830033 3300005563 Bacteria 981
19 Ga0070664_100146364 3300005564 Bacteria 2084
20 Ga0068854_100912153 3300005578 Bacteria 773
21 Ga0068856_100345350 3300005614 Bacteria 1507
22 Ga0068852_100173888 3300005616 Bacteria 2021
23 Ga0068852_101207663 3300005616 Bacteria 777
24 Ga0068852_102012439 3300005616 Bacteria 600
25 Ga0068851_10166511 3300005834 Bacteria 1214
26 Ga0081455_10544793 3300005937 Bacteria 769
27 Ga0081538_10104964 3300005981 Bacteria 1408
28 Ga0081540_1004321 3300005983 Bacteria 10890
29 Ga0075365_10005213 3300006038 Bacteria 6990
30 Ga0075365_10042492 3300006038 Bacteria 2972
31 Ga0075368_10257161 3300006042 Bacteria 747
32 Ga0075368_10570391 3300006042 Bacteria 510
33 Ga0075363_100010411 3300006048 Bacteria 4417
34 Ga0075363_100230092 3300006048 Bacteria 1064
35 Ga0075362_10031739 3300006177 Bacteria 2288
36 Ga0075367_10024130 3300006178 Bacteria 3429
37 Ga0075367_10527129 3300006178 Bacteria 750
38 Ga0075367_10762127 3300006178 Bacteria 616
39 Ga0075369_10056777 3300006186 Bacteria 1702
40 Ga0075369_10405885 3300006186 Bacteria 642
41 Ga0075366_10056543 3300006195 Bacteria 2330
42 Ga0075370_10009733 3300006353 Bacteria 5004
43 Ga0075370_10447624 3300006353 Bacteria 777
44 Ga0075430_100000037 3300006846 Bacteria 68528
45 Ga0099795_10202120 3300007788 Bacteria 838
46 Ga0099795_10489338 3300007788 Bacteria 572
47 Ga0105240_10218911 3300009093 Bacteria 2219
48 Ga0105240_10575565 3300009093 Bacteria 1243
49 Ga0105240_11466509 3300009093 Bacteria 716
50 Ga0105247_10618799 3300009101 Bacteria 805
51 Ga0114129_10052326 3300009147 Bacteria 5731
52 Ga0105241_10125598 3300009174 Bacteria 2071
53 Ga0105248_12497688 3300009177 Bacteria 589
54 Ga0105237_10356716 3300009545 Bacteria 1466
55 Ga0105237_12212671 3300009545 Bacteria 559
56 Ga0105238_12156113 3300009551 Bacteria 592
57 Ga0105238_12357690 3300009551 Bacteria 567
58 Ga0099796_10200188 3300010159 Bacteria 810
59 Ga0105239_12040391 3300010375 Bacteria 666
60 Ga0157347_1069066 3300012502 Bacteria 519
61 Ga0157370_10043752 3300013104 Bacteria 4308
62 Ga0157369_10302055 3300013105 Bacteria 1665
63 Ga0157375_12199234 3300013308 Bacteria 657
64 Ga0157376_13049611 3300014969 Bacteria 507
65 Ga0182005_1068805 3300015265 Bacteria 971
66 Ga0214543_1000022 3300021327 Bacteria 241930
67 Ga0224572_1009351 3300024225 Bacteria 1827
68 Ga0209677_127552 3300025253 Bacteria 598
69 Ga0209148_1000037 3300025254 Bacteria 494767
70 Ga0209233_1025545 3300025261 Bacteria 1459
71 Ga0209455_1000036 3300025272 Bacteria 473309
72 Ga0209025_1000903 3300025294 Bacteria 46017
73 Ga0209256_1001224 3300025299 Bacteria 28617
74 Ga0207680_10801326 3300025903 Bacteria 675
75 Ga0207647_10080604 3300025904 Bacteria 1952
76 Ga0207654_10234772 3300025911 Bacteria 1223
77 Ga0207695_10809677 3300025913 Bacteria 817
78 Ga0207695_10960086 3300025913 Bacteria 734
79 Ga0207657_10088767 3300025919 Bacteria 2583
80 Ga0207694_10234470 3300025924 Bacteria 1499
81 Ga0207694_10971079 3300025924 Bacteria 719
82 Ga0207700_11180882 3300025928 Bacteria 683
83 Ga0207711_11195809 3300025941 Bacteria 702
84 Ga0207667_10468184 3300025949 Bacteria 1280
85 Ga0207677_11124208 3300026023 Bacteria 717
86 Ga0207648_10920684 3300026089 Bacteria 817
87 Ga0207683_10055636 3300026121 Bacteria 3469
88 Ga0207698_10190119 3300026142 Bacteria 1828
89 Ga0207698_10759694 3300026142 Bacteria 969
90 Ga0268266_10106918 3300028379 Bacteria 2474
91 Ga0268264_11429684 3300028381 Bacteria 702
92 Ga0265760_10024858 3300031090 Bacteria 1747
93 Ga0265325_10341089 3300031241 Bacteria 663
94 Ga0265316_11182399 3300031344 Bacteria 529
95 Ga0307513_10670913 3300031456 Bacteria 743
96 Ga0307416_100162964 3300032002 Bacteria 2064
97 Ga0307416_102373728 3300032002 Bacteria 630
98 Ga0307414_10315059 3300032004 Bacteria 1329
99 Ga0373927_0287455 3300035695 Bacteria 1082
100 Ga0373947_1087669 3300035725 Bacteria 545
101 Ga0451787_811282 3300041441 Bacteria 565
102 Ga0451845_0675397 3300041501 Bacteria 712
103 Ga0451849_1433195 3300041505 Bacteria 758
104 Ga0451851_0404538 3300041507 Bacteria 758
105 Ga0495668_0013068 3300046616 Bacteria 4913
106 Ga0495625_0030200 3300046660 Bacteria 4046
107 Ga0495660_0198852 3300046810 Bacteria 958
108 Ga0496101_0761822 3300048904 Bacteria 764
109 Ga0496102_0549235 3300048905 Bacteria 1078
110 Ga0496109_0327979 3300048912 Bacteria 1445
111 Ga0496111_1128668 3300048914 Bacteria 558
112 Ga0496112_0044655 3300048915 Bacteria 4343
113 Ga0496113_1365922 3300048916 Bacteria 549
114 Ga0496114_0543584 3300048917 Bacteria 1027
115 Ga0496119_0030961 3300048922 Bacteria 3597
116 Ga0496125_0169501 3300048928 Bacteria 1470
117 Ga0501031_0170807 3300049568 Bacteria 1421
118 Ga0501032_0002091 3300049569 Bacteria 15738
119 Ga0501033_0000569 3300049570 Bacteria 34403
120 Ga0501036_0851915 3300049572 Bacteria 749
121 Ga0501037_0000147 3300049573 Bacteria 65415
122 Ga0501038_1042080 3300049574 Bacteria 599
123 Ga0501043_0000041 3300049579 Bacteria 116876
124 Ga0501046_0462350 3300049580 Bacteria 912
125 Ga0501047_0165666 3300049581 Bacteria 2081
126 Ga0501068_0017015 3300049584 Bacteria 4201
127 Ga0501069_0000018 3300049585 Bacteria 133550
128 Ga0501070_0000222 3300049586 Bacteria 54032
129 Ga0501071_0009818 3300049587 Bacteria 6390
130 Ga0501074_0000001 3300049590 Bacteria 123588
131 Ga0501080_0000753 3300049742 Bacteria 26231
132 Ga0501083_0000079 3300049744 Bacteria 64984
133 Ga0501035_0000061 3300049822 Bacteria 131658
134 Ga0501044_0000003 3300049823 Bacteria 345647
135 Ga0501044_0323194 3300049823 Bacteria 1467
136 nmdc:mga03n38_103927_c1 3300050490 Bacteria 1374
137 nmdc:mga03n38_118768_c1 3300050490 Bacteria 1297
138 nmdc:mga00v17_61418_c1 3300050491 Bacteria 2310
139 nmdc:mga00v17_83222_c1 3300050491 Bacteria 2001
140 nmdc:mga0yw44_348196_c1 3300050492 Bacteria 997
141 nmdc:mga0yw44_3835_c1 3300050492 Bacteria 6755
142 nmdc:mga0yw44_728835_c1 3300050492 Bacteria 673
143 nmdc:mga0k408_866304_c1 3300050493 Bacteria 525
144 nmdc:mga0k408_89499_c1 3300050493 Bacteria 1808
145 nmdc:mga06z11_722370_c1 3300050494 Bacteria 607
146 nmdc:mga07m45_14798_c1 3300050496 Bacteria 4165
147 nmdc:mga05p37_124971_c1 3300050507 Bacteria 3159
148 nmdc:mga0qj67_316684_c1 3300050509 Bacteria 1263
149 nmdc:mga06r32_515822_c1 3300050510 Bacteria 1171
150 Ga0500651_0540163 3300053093 Bacteria 639
151 Ga0500617_265934 3300053124 Bacteria 567
152 Ga0500642_0225230 3300053130 Bacteria 868
153 Ga0500616_0003319 3300053153 Bacteria 12406
154 Ga0500616_0193111 3300053153 Bacteria 907
155 Ga0500620_131227 3300053155 Bacteria 877
156 Ga0500645_030452 3300053730 Bacteria 1623
157 Ga0501082_0086454 3300060353 Bacteria 2705

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_101061634 Ga0070713_1010616342 68
2 3300005455 Ga0070663_100069211 Ga0070663_1000692113 68
3 3300005564 Ga0070664_100146364 Ga0070664_1001463645 68
4 3300005616 Ga0068852_102012439 Ga0068852_1020124392 68
5 3300005834 Ga0068851_10166511 Ga0068851_101665113 68
6 3300006042 Ga0075368_10257161 Ga0075368_102571612 68
7 3300006178 Ga0075367_10527129 Ga0075367_105271292 68
8 3300006353 Ga0075370_10447624 Ga0075370_104476242 68
9 3300007788 Ga0099795_10202120 Ga0099795_102021201 68
10 iso_pu_bacteria 2838074704 2838079765 68
11 iso_pu_bacteria 2844009547 2844014030 68
12 3300005981 Ga0081538_10104964 Ga0081538_101049643 69
13 3300005983 Ga0081540_1004321 Ga0081540_10043212 69
14 3300006186 Ga0075369_10405885 Ga0075369_104058852 69
15 3300007788 Ga0099795_10489338 Ga0099795_104893381 69
16 3300009147 Ga0114129_10052326 Ga0114129_100523263 69
17 3300010159 Ga0099796_10200188 Ga0099796_102001882 69
18 3300026121 Ga0207683_10055636 Ga0207683_100556365 69
19 3300035695 Ga0373927_0287455 Ga0373927_0287455_33_281 69
20 3300035725 Ga0373947_1087669 Ga0373947_1087669_261_509 69
21 3300048905 Ga0496102_0549235 Ga0496102_0549235_345_554 69
22 3300049568 Ga0501031_0170807 Ga0501031_0170807_339_548 69
23 3300049569 Ga0501032_0002091 Ga0501032_0002091_1036_1245 69
24 3300049570 Ga0501033_0000569 Ga0501033_0000569_30446_30655 69
25 3300049572 Ga0501036_0851915 Ga0501036_0851915_249_458 69
26 3300049573 Ga0501037_0000147 Ga0501037_0000147_45479_45688 69
27 3300049574 Ga0501038_1042080 Ga0501038_1042080_292_501 69
28 3300049579 Ga0501043_0000041 Ga0501043_0000041_71670_71879 69
29 3300049584 Ga0501068_0017015 Ga0501068_0017015_3279_3488 69
30 3300049585 Ga0501069_0000018 Ga0501069_0000018_57173_57382 69
31 3300049586 Ga0501070_0000222 Ga0501070_0000222_34996_35205 69
32 3300049587 Ga0501071_0009818 Ga0501071_0009818_5775_5984 69
33 3300049590 Ga0501074_0000001 Ga0501074_0000001_102339_102548 69
34 3300049742 Ga0501080_0000753 Ga0501080_0000753_11884_12093 69
35 3300049744 Ga0501083_0000079 Ga0501083_0000079_38710_38919 69
36 3300049822 Ga0501035_0000061 Ga0501035_0000061_20363_20572 69
37 3300049823 Ga0501044_0000003 Ga0501044_0000003_274213_274422 69
38 3300050507 nmdc:mga05p37_124971_c1 nmdc:mga05p37_124971_c1_485_733 69
39 3300050509 nmdc:mga0qj67_316684_c1 nmdc:mga0qj67_316684_c1_181_426 69
40 3300053730 Ga0500645_030452 Ga0500645_030452_1338_1553 69
41 3300060353 Ga0501082_0086454 Ga0501082_0086454_1207_1416 69
42 iso_pu_bacteria 2503198000 2503201120 69
43 iso_pu_bacteria 2508501123 2509118769 69
44 iso_pu_bacteria 2509276019 2509376701 69
45 iso_pu_bacteria 2509276022 2509395883 69
46 iso_pu_bacteria 2512047086 2512528814 69
47 iso_pu_bacteria 2513237146 2513926146 69
48 iso_pu_bacteria 2515154107 2515612044 69
49 iso_pu_bacteria 2558860100 2558863936 69
50 iso_pu_bacteria 2588253730 2588517865 69
51 iso_pu_bacteria 2599185170 2599417622 69
52 iso_pu_bacteria 2643221552 2643779084 69
53 iso_pu_bacteria 2643221584 2643927651 69
54 iso_pu_bacteria 2643221614 2644085164 69
55 iso_pu_bacteria 2643221651 2644288901 69
56 iso_pu_bacteria 2643221661 2644342716 69
57 iso_pu_bacteria 2643221666 2644366016 69
58 iso_pu_bacteria 2756170246 2756675973 69
59 iso_pu_bacteria 2767802442 2770194823 69
60 iso_pu_bacteria 2791355123 2792749532 69
61 iso_pu_bacteria 2818991467 2819719800 69
62 iso_pu_bacteria 2838035591 2838038165 69
63 iso_pu_bacteria 2838661181 2838667150 69
64 iso_pu_bacteria 2844002411 2844007135 69
65 iso_pu_bacteria 2850079185 2850081702 69
66 iso_pu_bacteria 2856320880 2856326912 69
67 iso_pu_bacteria 2856349417 2856352212 69
68 iso_pu_bacteria 2856356410 2856362230 69
69 iso_pu_bacteria 2869169390 2869175453 69
70 iso_pu_bacteria 2869234852 2869237992 69
71 iso_pu_bacteria 2869278585 2869283539 69
72 iso_pu_bacteria 2871435913 2871439926 69
73 iso_pu_bacteria 2871451962 2871452234 69
74 iso_pu_bacteria 2871466892 2871468376 69
75 iso_pu_bacteria 2871488783 2871488954 69
76 iso_pu_bacteria 2874109183 2874116183 69
77 iso_pu_bacteria 2874116593 2874120300 69
78 iso_pu_bacteria 2874123672 2874126306 69
79 iso_pu_bacteria 2874139085 2874143772 69
80 iso_pu_bacteria 2874168670 2874174515 69
81 iso_pu_bacteria 2876386047 2876392445 69
82 iso_pu_bacteria 2876392853 2876397836 69
83 iso_pu_bacteria 2878730984 2878738291 69
84 iso_pu_bacteria 2878738818 2878739034 69
85 iso_pu_bacteria 2878753008 2878753716 69
86 iso_pu_bacteria 2878760144 2878760650 69
87 iso_pu_bacteria 2878767105 2878767725 69
88 iso_pu_bacteria 2881147464 2881149717 69
89 iso_pu_bacteria 2881155292 2881156538 69
90 iso_pu_bacteria 2881161766 2881166597 69
91 iso_pu_bacteria 2881845957 2881846529 69
92 iso_pu_bacteria 2881853255 2881853339 69
93 iso_pu_bacteria 2881861095 2881867176 69
94 iso_pu_bacteria 2882632389 2882636554 69
95 iso_pu_bacteria 2882912400 2882919636 69
96 iso_pu_bacteria 2885312484 2885313921 69
97 iso_pu_bacteria 2885318864 2885324174 69
98 iso_pu_bacteria 2885342637 2885345569 69
99 iso_pu_bacteria 2885350715 2885357430 69
100 iso_pu_bacteria 2888337043 2888338980 69
101 iso_pu_bacteria 2903492973 2903495613 69
102 iso_pu_bacteria 2903513507 2903515141 69
103 iso_pu_bacteria 2903540706 2903541216 69
104 iso_pu_bacteria 2904659560 2904664487 69
105 iso_pu_bacteria 2906378014 2906385395 69
106 iso_pu_bacteria 2906401398 2906401810 69
107 iso_pu_bacteria 2924710171 2924718025 69
108 iso_pu_bacteria 2924741084 2924741945 69
109 iso_pu_bacteria 2924762789 2924764349 69
110 iso_pu_bacteria 2924776078 2924776396 69
111 iso_pu_bacteria 2924784321 2924789932 69
112 iso_pu_bacteria 2936996657 2937001523 69
113 iso_pu_bacteria 2937822353 2937828466 69
114 iso_pu_bacteria 2937848649 2937854121 69
115 iso_pu_bacteria 2937861824 2937867275 69
116 iso_pu_bacteria 2937972304 2937979747 69
117 iso_pu_bacteria 2937994558 2937995072 69
118 iso_pu_bacteria 2957443900 2957445244 69
119 iso_pu_bacteria 2958034702 2958040051 69
120 iso_pu_bacteria 2958041894 2958054395 69
121 iso_pu_bacteria 2958108152 2958110827 69
122 iso_pu_bacteria 2958144490 2958147670 69
123 iso_pu_bacteria 2958165035 2958165663 69
124 iso_pu_bacteria 2960617483 2960621863 69
125 iso_pu_bacteria 2960660292 2960661965 69
126 iso_pu_bacteria 2961114664 2961119486 69
127 iso_pu_bacteria 2961163497 2961164122 69
128 iso_pu_bacteria 2961170736 2961170904 69
129 iso_pu_bacteria 2961183825 2961184604 69
130 iso_pu_bacteria 2965018300 2965018812 69
131 iso_pu_bacteria 2967996073 2968003483 69
132 iso_pu_bacteria 2968003550 2968004250 69
133 iso_pu_bacteria 2968016561 2968018894 69
134 iso_pu_bacteria 2968091066 2968091212 69
135 iso_pu_bacteria 2968110612 2968115741 69
136 iso_pu_bacteria 2968171901 2968172525 69
137 iso_pu_bacteria 2970469710 2970470933 69
138 iso_pu_bacteria 2970503327 2970503494 69
139 iso_pu_bacteria 2970510686 2970517704 69
140 iso_pu_bacteria 2970532167 2970533010 69
141 iso_pu_bacteria 2970554993 2970555503 69
142 iso_pu_bacteria 2970593180 2970598036 69
143 iso_pu_bacteria 2970627176 2970633613 69
144 iso_pu_bacteria 2977523885 2977526656 69
145 iso_pu_bacteria 2977821940 2977822931 69
146 iso_pu_bacteria 2977828996 2977832607 69
147 iso_pu_bacteria 2977851361 2977857096 69
148 iso_pu_bacteria 2977898635 2977903302 69
149 iso_pu_bacteria 2977907340 2977912946 69
150 iso_pu_bacteria 2977922695 2977927465 69
151 iso_pu_bacteria 2979764755 2979770988 69
152 iso_pu_bacteria 2979772303 2979773764 69
153 iso_pu_bacteria 2979808191 2979815723 69
154 iso_pu_bacteria 2987659509 2987660130 69
155 iso_pu_bacteria 2987666974 2987672805 69
156 iso_pu_bacteria 2996348954 2996356531 69
157 iso_pu_bacteria 2996386984 2996389929 69
158 iso_pu_bacteria 3004167301 3004169211 69
159 iso_pu_bacteria 3004188549 3004189178 69
160 iso_pu_bacteria 3004232784 3004237589 69
161 iso_pu_bacteria 3004248173 3004253345 69
162 iso_pu_bacteria 3004275668 3004282834 69
163 iso_pu_bacteria 3004289098 3004294246 69
164 iso_pu_bacteria 8004312739 8004318483 69
165 iso_pu_bacteria 8004374579 8004375287 69
166 iso_pu_bacteria 8004727605 8004731927 69
167 3300006048 Ga0075363_100230092 Ga0075363_1002300922 70
168 3300006177 Ga0075362_10031739 Ga0075362_100317394 70
169 3300006178 Ga0075367_10762127 Ga0075367_107621272 70
170 3300025928 Ga0207700_11180882 Ga0207700_111808822 70
171 3300028381 Ga0268264_11429684 Ga0268264_114296842 70
172 3300050491 nmdc:mga00v17_83222_c1 nmdc:mga00v17_83222_c1_1460_1684 70
173 3300050492 nmdc:mga0yw44_348196_c1 nmdc:mga0yw44_348196_c1_396_620 70
174 3300053124 Ga0500617_265934 Ga0500617_265934_31_270 70
175 3300003775 Ga0055524_1008537 Ga0055524_10085372 71
176 3300005262 Ga0065165_1003955 Ga0065165_10039551 71
177 3300006048 Ga0075363_100010411 Ga0075363_1000104111 71
178 3300006178 Ga0075367_10024130 Ga0075367_100241304 71
179 3300006195 Ga0075366_10056543 Ga0075366_100565435 71
180 3300025299 Ga0209256_1001224 Ga0209256_100122417 71
181 3300031456 Ga0307513_10670913 Ga0307513_106709132 71
182 3300049581 Ga0501047_0165666 Ga0501047_0165666_908_1123 71
183 3300049823 Ga0501044_0323194 Ga0501044_0323194_1238_1453 71
184 3300050490 nmdc:mga03n38_103927_c1 nmdc:mga03n38_103927_c1_112_327 71
185 3300050493 nmdc:mga0k408_89499_c1 nmdc:mga0k408_89499_c1_495_710 71
186 3300005356 Ga0070674_101002888 Ga0070674_1010028882 72
187 3300005364 Ga0070673_101355029 Ga0070673_1013550292 72
188 3300005459 Ga0068867_100912665 Ga0068867_1009126652 72
189 3300005616 Ga0068852_101207663 Ga0068852_1012076632 72
190 3300006038 Ga0075365_10042492 Ga0075365_100424926 72
191 3300006846 Ga0075430_100000037 Ga0075430_10000003747 72
192 3300013308 Ga0157375_12199234 Ga0157375_121992342 72
193 3300024225 Ga0224572_1009351 Ga0224572_10093512 72
194 3300026023 Ga0207677_11124208 Ga0207677_111242082 72
195 3300026089 Ga0207648_10920684 Ga0207648_109206841 72
196 3300026142 Ga0207698_10759694 Ga0207698_107596942 72
197 3300031090 Ga0265760_10024858 Ga0265760_100248581 72
198 3300046660 Ga0495625_0030200 Ga0495625_0030200_1351_1575 72
199 3300050492 nmdc:mga0yw44_728835_c1 nmdc:mga0yw44_728835_c1_201_446 72
200 3300050494 nmdc:mga06z11_722370_c1 nmdc:mga06z11_722370_c1_273_518 72
201 3300001979 JGI24740J21852_10120985 JGI24740J21852_101209852 73
202 3300003187 JGI25151J46595_10047140 JGI25151J46595_100471403 73
203 3300003762 Ga0055542_1000845 Ga0055542_100084519 73
204 3300003763 Ga0055529_1017818 Ga0055529_10178182 73
205 3300005327 Ga0070658_11017137 Ga0070658_110171372 73
206 3300005335 Ga0070666_10526987 Ga0070666_105269871 73
207 3300005339 Ga0070660_100220471 Ga0070660_1002204713 73
208 3300005344 Ga0070661_100167319 Ga0070661_1001673193 73
209 3300005366 Ga0070659_100779373 Ga0070659_1007793732 73
210 3300005539 Ga0068853_100290340 Ga0068853_1002903402 73
211 3300005563 Ga0068855_100830033 Ga0068855_1008300332 73
212 3300005578 Ga0068854_100912153 Ga0068854_1009121532 73
213 3300005614 Ga0068856_100345350 Ga0068856_1003453503 73
214 3300005616 Ga0068852_100173888 Ga0068852_1001738883 73
215 3300005937 Ga0081455_10544793 Ga0081455_105447932 73
216 3300006038 Ga0075365_10005213 Ga0075365_100052134 73
217 3300006042 Ga0075368_10570391 Ga0075368_105703912 73
218 3300006186 Ga0075369_10056777 Ga0075369_100567772 73
219 3300006353 Ga0075370_10009733 Ga0075370_100097334 73
220 3300009093 Ga0105240_10218911 Ga0105240_102189113 73
221 3300009093 Ga0105240_10575565 Ga0105240_105755653 73
222 3300009093 Ga0105240_11466509 Ga0105240_114665092 73
223 3300009101 Ga0105247_10618799 Ga0105247_106187992 73
224 3300009174 Ga0105241_10125598 Ga0105241_101255984 73
225 3300009177 Ga0105248_12497688 Ga0105248_124976882 73
226 3300009545 Ga0105237_10356716 Ga0105237_103567161 73
227 3300009545 Ga0105237_12212671 Ga0105237_122126712 73
228 3300009551 Ga0105238_12156113 Ga0105238_121561132 73
229 3300009551 Ga0105238_12357690 Ga0105238_123576902 73
230 3300010375 Ga0105239_12040391 Ga0105239_120403912 73
231 3300012502 Ga0157347_1069066 Ga0157347_10690662 73
232 3300013104 Ga0157370_10043752 Ga0157370_100437523 73
233 3300013105 Ga0157369_10302055 Ga0157369_103020553 73
234 3300014969 Ga0157376_13049611 Ga0157376_130496112 73
235 3300015265 Ga0182005_1068805 Ga0182005_10688052 73
236 3300021327 Ga0214543_1000022 Ga0214543_1000022125 73
237 3300025253 Ga0209677_127552 Ga0209677_1275522 73
238 3300025254 Ga0209148_1000037 Ga0209148_1000037111 73
239 3300025261 Ga0209233_1025545 Ga0209233_10255452 73
240 3300025272 Ga0209455_1000036 Ga0209455_100003688 73
241 3300025294 Ga0209025_1000903 Ga0209025_100090318 73
242 3300025903 Ga0207680_10801326 Ga0207680_108013262 73
243 3300025904 Ga0207647_10080604 Ga0207647_100806043 73
244 3300025911 Ga0207654_10234772 Ga0207654_102347722 73
245 3300025913 Ga0207695_10809677 Ga0207695_108096772 73
246 3300025913 Ga0207695_10960086 Ga0207695_109600862 73
247 3300025919 Ga0207657_10088767 Ga0207657_100887674 73
248 3300025924 Ga0207694_10234470 Ga0207694_102344702 73
249 3300025924 Ga0207694_10971079 Ga0207694_109710791 73
250 3300025941 Ga0207711_11195809 Ga0207711_111958092 73
251 3300025949 Ga0207667_10468184 Ga0207667_104681842 73
252 3300026142 Ga0207698_10190119 Ga0207698_101901193 73
253 3300028379 Ga0268266_10106918 Ga0268266_101069183 73
254 3300031241 Ga0265325_10341089 Ga0265325_103410892 73
255 3300031344 Ga0265316_11182399 Ga0265316_111823992 73
256 3300032002 Ga0307416_100162964 Ga0307416_1001629642 73
257 3300032002 Ga0307416_102373728 Ga0307416_1023737281 73
258 3300032004 Ga0307414_10315059 Ga0307414_103150592 73
259 3300041441 Ga0451787_811282 Ga0451787_811282_189_410 73
260 3300041501 Ga0451845_0675397 Ga0451845_0675397_303_524 73
261 3300041505 Ga0451849_1433195 Ga0451849_1433195_284_505 73
262 3300041507 Ga0451851_0404538 Ga0451851_0404538_243_464 73
263 3300046616 Ga0495668_0013068 Ga0495668_0013068_1010_1231 73
264 3300046810 Ga0495660_0198852 Ga0495660_0198852_354_575 73
265 3300048904 Ga0496101_0761822 Ga0496101_0761822_511_732 73
266 3300048912 Ga0496109_0327979 Ga0496109_0327979_1164_1385 73
267 3300048914 Ga0496111_1128668 Ga0496111_1128668_67_288 73
268 3300048915 Ga0496112_0044655 Ga0496112_0044655_2851_3072 73
269 3300048916 Ga0496113_1365922 Ga0496113_1365922_31_252 73
270 3300048917 Ga0496114_0543584 Ga0496114_0543584_277_498 73
271 3300048922 Ga0496119_0030961 Ga0496119_0030961_2337_2558 73
272 3300048928 Ga0496125_0169501 Ga0496125_0169501_1034_1255 73
273 3300049580 Ga0501046_0462350 Ga0501046_0462350_89_310 73
274 3300050490 nmdc:mga03n38_118768_c1 nmdc:mga03n38_118768_c1_678_899 73
275 3300050491 nmdc:mga00v17_61418_c1 nmdc:mga00v17_61418_c1_336_557 73
276 3300050492 nmdc:mga0yw44_3835_c1 nmdc:mga0yw44_3835_c1_2154_2375 73
277 3300050493 nmdc:mga0k408_866304_c1 nmdc:mga0k408_866304_c1_269_490 73
278 3300050496 nmdc:mga07m45_14798_c1 nmdc:mga07m45_14798_c1_2213_2434 73
279 3300050510 nmdc:mga06r32_515822_c1 nmdc:mga06r32_515822_c1_150_410 73
280 3300053093 Ga0500651_0540163 Ga0500651_0540163_205_429 73
281 3300053130 Ga0500642_0225230 Ga0500642_0225230_596_820 73
282 3300053153 Ga0500616_0003319 Ga0500616_0003319_10136_10363 73
283 3300053153 Ga0500616_0193111 Ga0500616_0193111_85_306 73
284 3300053155 Ga0500620_131227 Ga0500620_131227_108_332 73

Feature Viewer

pLDDT pTM Quality
70.3 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map