F386329

General Info

Members Datasets Scaffolds Average Seq Length
284 171 568 253

Family's Representative Sequence

Representative Sequence 3300042007|Ga0439449_0116001|Ga0439449_0116001_108_902
Length 257
Sequence MLGTDTLLVSDDARVRVVTISRPKALNALNPEVIAGLSQVLDATAAAARAGQVRALVLTGAGEKSFVAGADIAAMADMSEGTAREFARAGHGVGEALAGLPIPTIAAVNGFALGGGCELALADTAKFGQPELGLGIIPGAGGTQRLPRLIGMGRAKHLILTGDLIDAKQALEIGLVTAVAPPGQLQIRARELAKKVLRQGPLAARLAKIALNASARVDLDSGLMIETLAQAICYASEDKIEGTAAFLEKRKPKFTGR

Samples

Sample ID Description Type Environment
1 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
125 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
126 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
127 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
128 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.28
Nodule 0
Rhizoplane 1.06
Rhizosphere 93.31
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439449_0116001 3300042007 Bacteria 993
2 Ga0065712_10012831 3300005290 Bacteria 2194
3 Ga0065715_10019884 3300005293 Bacteria 1693
4 Ga0065715_10118392 3300005293 Bacteria 2305
5 Ga0065707_10271578 3300005295 Bacteria 1053
6 Ga0070676_10031791 3300005328 Bacteria 3019
7 Ga0070676_10035372 3300005328 Bacteria 2872
8 Ga0070676_10068949 3300005328 Bacteria 2119
9 Ga0070690_100024813 3300005330 Bacteria 3690
10 Ga0070690_100288252 3300005330 Bacteria 1173
11 Ga0070670_100070176 3300005331 Bacteria 3008
12 Ga0068869_100109075 3300005334 Bacteria 2103
13 Ga0070682_100220652 3300005337 Bacteria 1349
14 Ga0070682_100296434 3300005337 Bacteria 1185
15 Ga0068868_100093968 3300005338 Bacteria 2418
16 Ga0068868_100334667 3300005338 Bacteria 1293
17 Ga0068868_100361935 3300005338 Bacteria 1245
18 Ga0070689_100128087 3300005340 Bacteria 2033
19 Ga0070691_10131867 3300005341 Bacteria 1267
20 Ga0070687_100022824 3300005343 Bacteria 2965
21 Ga0070687_100086072 3300005343 Bacteria 1727
22 Ga0070668_100127679 3300005347 Bacteria 2038
23 Ga0070668_100349967 3300005347 Bacteria 1250
24 Ga0070671_100039407 3300005355 Bacteria 3922
25 Ga0070671_100239334 3300005355 Bacteria 1541
26 Ga0070674_100049223 3300005356 Bacteria 2897
27 Ga0070674_100131551 3300005356 Bacteria 1866
28 Ga0070673_100001103 3300005364 Bacteria 15474
29 Ga0070673_100011199 3300005364 Bacteria 6115
30 Ga0070673_100211724 3300005364 Bacteria 1674
31 Ga0070673_100218705 3300005364 Bacteria 1648
32 Ga0070688_100209891 3300005365 Bacteria 1367
33 Ga0070688_100303265 3300005365 Bacteria 1155
34 Ga0070659_100094870 3300005366 Bacteria 2396
35 Ga0070659_100189100 3300005366 Bacteria 1691
36 Ga0070700_100037943 3300005441 Bacteria 2933
37 Ga0070700_100085928 3300005441 Bacteria 2042
38 Ga0070663_100300295 3300005455 Bacteria 1285
39 Ga0070663_100303269 3300005455 Bacteria 1279
40 Ga0070678_100022287 3300005456 Bacteria 4194
41 Ga0070678_100541735 3300005456 Bacteria 1032
42 Ga0070662_100000325 3300005457 Bacteria 28539
43 Ga0070662_100493028 3300005457 Bacteria 1021
44 Ga0070681_10127311 3300005458 Bacteria 2480
45 Ga0068867_100017429 3300005459 Bacteria 5103
46 Ga0068867_100026844 3300005459 Bacteria 4137
47 Ga0070684_100085068 3300005535 Bacteria 2804
48 Ga0070684_100930039 3300005535 Bacteria 815
49 Ga0070672_100067248 3300005543 Bacteria 2839
50 Ga0070672_100366085 3300005543 Bacteria 1231
51 Ga0070686_100006339 3300005544 Bacteria 6565
52 Ga0070693_100009967 3300005547 Bacteria 4741
53 Ga0070693_100270507 3300005547 Bacteria 1134
54 Ga0070704_100084492 3300005549 Bacteria 2347
55 Ga0070704_100350141 3300005549 Bacteria 1247
56 Ga0068857_100486698 3300005577 Bacteria 1157
57 Ga0068854_100073526 3300005578 Bacteria 2505
58 Ga0070702_100157416 3300005615 Bacteria 1464
59 Ga0068859_100297035 3300005617 Bacteria 1708
60 Ga0068859_100310758 3300005617 Bacteria 1670
61 Ga0068864_100453378 3300005618 Bacteria 1227
62 Ga0068864_100683851 3300005618 Bacteria 1001
63 Ga0068866_10000212 3300005718 Bacteria 27530
64 Ga0068861_100034127 3300005719 Bacteria 3760
65 Ga0068861_100778623 3300005719 Bacteria 896
66 Ga0068863_100153030 3300005841 Bacteria 2207
67 Ga0068858_100028826 3300005842 Bacteria 5154
68 Ga0068858_100075274 3300005842 Bacteria 3135
69 Ga0068858_100167382 3300005842 Bacteria 2071
70 Ga0068860_100021913 3300005843 Bacteria 6181
71 Ga0068860_100375637 3300005843 Bacteria 1402
72 Ga0068862_100219742 3300005844 Bacteria 1720
73 Ga0068862_100646720 3300005844 Bacteria 1019
74 Ga0075365_10000429 3300006038 Bacteria 15576
75 Ga0075368_10041642 3300006042 Bacteria 1805
76 Ga0075364_10000947 3300006051 Bacteria 15319
77 Ga0075364_10024364 3300006051 Bacteria 3842
78 Ga0075362_10019687 3300006177 Bacteria 2810
79 Ga0075367_10033942 3300006178 Bacteria 2944
80 Ga0075366_10012914 3300006195 Bacteria 4747
81 Ga0075366_10037622 3300006195 Bacteria 2858
82 Ga0075370_10017085 3300006353 Bacteria 3916
83 Ga0075428_100252817 3300006844 Bacteria 1899
84 Ga0075430_100052081 3300006846 Bacteria 3447
85 Ga0075430_100126973 3300006846 Bacteria 2126
86 Ga0075430_100188908 3300006846 Bacteria 1712
87 Ga0075431_100062309 3300006847 Bacteria 3848
88 Ga0075431_100519233 3300006847 Bacteria 1181
89 Ga0075433_10131320 3300006852 Bacteria 2225
90 Ga0075429_100317039 3300006880 Bacteria 1364
91 Ga0075429_100328916 3300006880 Bacteria 1337
92 Ga0075436_100361451 3300006914 Bacteria 1047
93 Ga0097620_100297022 3300006931 Bacteria 1708
94 Ga0097620_100310757 3300006931 Bacteria 1670
95 Ga0075435_100096278 3300007076 Bacteria 2448
96 Ga0105240_10222998 3300009093 Bacteria 2195
97 Ga0111539_10344957 3300009094 Bacteria 1733
98 Ga0111539_10910126 3300009094 Bacteria 1023
99 Ga0114129_10019034 3300009147 Bacteria 9780
100 Ga0114129_10039523 3300009147 Bacteria 6652
101 Ga0114129_10077296 3300009147 Bacteria 4630
102 Ga0114129_10837348 3300009147 Bacteria 1171
103 Ga0114129_11398387 3300009147 Unclassified 863
104 Ga0105243_10043308 3300009148 Bacteria 3528
105 Ga0105243_10095079 3300009148 Bacteria 2462
106 Ga0105241_10309536 3300009174 Bacteria 1358
107 Ga0105242_10000445 3300009176 Bacteria 32941
108 Ga0105248_10006200 3300009177 Bacteria 13108
109 Ga0105249_10139923 3300009553 Bacteria 2320
110 Ga0105249_10743672 3300009553 Bacteria 1043
111 Ga0105239_10619819 3300010375 Bacteria 1235
112 Ga0157378_10036407 3300013297 Bacteria 4355
113 Ga0163162_10402970 3300013306 Bacteria 1500
114 Ga0157372_10243397 3300013307 Bacteria 2087
115 Ga0157375_10126928 3300013308 Bacteria 2667
116 Ga0157375_10303478 3300013308 Bacteria 1760
117 Ga0163163_10103497 3300014325 Bacteria 2872
118 Ga0157379_10051419 3300014968 Bacteria 3681
119 Ga0157376_10535968 3300014969 Bacteria 1156
120 Ga0163161_10044436 3300017792 Bacteria 3199
121 Ga0207645_10002734 3300025907 Bacteria 13735
122 Ga0207645_10003326 3300025907 Bacteria 12263
123 Ga0207645_10006244 3300025907 Bacteria 8562
124 Ga0207643_10144019 3300025908 Bacteria 1425
125 Ga0207707_10087575 3300025912 Bacteria 2720
126 Ga0207695_10470870 3300025913 Bacteria 1139
127 Ga0207662_10001183 3300025918 Bacteria 12407
128 Ga0207652_10403515 3300025921 Bacteria 1233
129 Ga0207681_10017861 3300025923 Bacteria 4460
130 Ga0207681_10255954 3300025923 Bacteria 1369
131 Ga0207681_10321290 3300025923 Bacteria 1231
132 Ga0207650_10142534 3300025925 Bacteria 1885
133 Ga0207644_10121142 3300025931 Bacteria 1991
134 Ga0207644_10513903 3300025931 Bacteria 989
135 Ga0207690_10023506 3300025932 Bacteria 3847
136 Ga0207690_10151978 3300025932 Bacteria 1717
137 Ga0207706_10001947 3300025933 Bacteria 20264
138 Ga0207706_10110380 3300025933 Bacteria 2420
139 Ga0207686_10604907 3300025934 Bacteria 863
140 Ga0207709_10072964 3300025935 Bacteria 2185
141 Ga0207709_10639899 3300025935 Bacteria 846
142 Ga0207670_10027158 3300025936 Bacteria 3616
143 Ga0207670_10202036 3300025936 Bacteria 1510
144 Ga0207669_10050909 3300025937 Bacteria 2479
145 Ga0207669_10196216 3300025937 Bacteria 1461
146 Ga0207691_10042782 3300025940 Bacteria 4174
147 Ga0207691_10063921 3300025940 Bacteria 3336
148 Ga0207691_10082121 3300025940 Bacteria 2896
149 Ga0207691_10216002 3300025940 Bacteria 1664
150 Ga0207711_10023963 3300025941 Bacteria 5108
151 Ga0207711_10515103 3300025941 Bacteria 1115
152 Ga0207689_10005015 3300025942 Bacteria 11926
153 Ga0207661_10114345 3300025944 Bacteria 2288
154 Ga0207661_10182487 3300025944 Bacteria 1834
155 Ga0207661_10522727 3300025944 Bacteria 1085
156 Ga0207651_10046607 3300025960 Bacteria 2916
157 Ga0207651_10052345 3300025960 Bacteria 2783
158 Ga0207651_10260067 3300025960 Bacteria 1424
159 Ga0207712_10510704 3300025961 Bacteria 1028
160 Ga0207668_10047375 3300025972 Bacteria 2943
161 Ga0207640_10051744 3300025981 Bacteria 2672
162 Ga0207658_10067295 3300025986 Bacteria 2698
163 Ga0207677_10440459 3300026023 Bacteria 1114
164 Ga0207703_10073042 3300026035 Bacteria 2836
165 Ga0207703_10510721 3300026035 Bacteria 1129
166 Ga0207678_10198019 3300026067 Bacteria 1717
167 Ga0207708_10006807 3300026075 Bacteria 8454
168 Ga0207708_10024257 3300026075 Bacteria 4586
169 Ga0207708_10127555 3300026075 Bacteria 1987
170 Ga0207641_10222798 3300026088 Bacteria 1750
171 Ga0207648_10000030 3300026089 Bacteria 129654
172 Ga0207676_10058370 3300026095 Bacteria 3044
173 Ga0207674_10041837 3300026116 Bacteria 4736
174 Ga0207675_100019078 3300026118 Bacteria 6401
175 Ga0207675_100309226 3300026118 Bacteria 1541
176 Ga0207683_10010241 3300026121 Bacteria 7994
177 Ga0207698_10305041 3300026142 Bacteria 1484
178 Ga0268265_10138054 3300028380 Bacteria 2037
179 Ga0268265_10603711 3300028380 Bacteria 1049
180 Ga0268265_10628901 3300028380 Bacteria 1029
181 Ga0268264_10246536 3300028381 Bacteria 1657
182 Ga0307408_100504669 3300031548 Bacteria 1059
183 Ga0307405_10029067 3300031731 Bacteria 3227
184 Ga0307413_10291381 3300031824 Bacteria 1233
185 Ga0307413_10481845 3300031824 Bacteria 992
186 Ga0307410_10065465 3300031852 Bacteria 2500
187 Ga0307412_10238122 3300031911 Bacteria 1406
188 Ga0307409_100033389 3300031995 Bacteria 3744
189 Ga0307409_100310942 3300031995 Bacteria 1470
190 Ga0307416_100060191 3300032002 Bacteria 3091
191 Ga0307416_100249533 3300032002 Bacteria 1726
192 Ga0307416_100425418 3300032002 Bacteria 1373
193 Ga0307414_10252874 3300032004 Bacteria 1466
194 Ga0307411_10038177 3300032005 Bacteria 3027
195 Ga0307411_10139169 3300032005 Bacteria 1787
196 Ga0307411_10364955 3300032005 Bacteria 1182
197 Ga0307415_100065300 3300032126 Bacteria 2535
198 Ga0307415_100161482 3300032126 Bacteria 1737
199 Ga0307415_100456776 3300032126 Bacteria 1106
200 Ga0373947_0192266 3300035725 Bacteria 1332
201 Ga0439453_0006199 3300041408 Bacteria 1852
202 Ga0451853_1197380 3300041512 Bacteria 1002
203 Ga0439431_0004645 3300041997 Bacteria 3019
204 Ga0439433_0021386 3300041999 Bacteria 1447
205 Ga0439446_0018794 3300042156 Bacteria 1940
206 Ga0439434_0100702 3300042435 Bacteria 931
207 Ga0439435_0020412 3300042436 Bacteria 1709
208 Ga0451576_0733450 3300045051 Bacteria 1038
209 Ga0495603_0184705 3300046455 Bacteria 1206
210 Ga0495608_0044499 3300046511 Bacteria 2963
211 Ga0495658_0167080 3300046683 Bacteria 1360
212 Ga0496104_0218960 3300048907 Bacteria 1816
213 Ga0496112_0078948 3300048915 Bacteria 3255
214 Ga0496112_0439212 3300048915 Bacteria 1243
215 Ga0501031_0224184 3300049568 Bacteria 1224
216 Ga0501036_0026559 3300049572 Bacteria 4889
217 Ga0501036_0096945 3300049572 Bacteria 2493
218 Ga0501036_0106357 3300049572 Bacteria 2373
219 Ga0501036_0547062 3300049572 Bacteria 962
220 Ga0501039_0364610 3300049575 Bacteria 1135
221 Ga0501040_0015421 3300049576 Bacteria 5053
222 Ga0501041_0015038 3300049577 Bacteria 4597
223 Ga0501042_0056313 3300049578 Bacteria 2806
224 Ga0501047_0037125 3300049581 Bacteria 4711
225 Ga0501069_0239189 3300049585 Bacteria 1058
226 Ga0501071_0116184 3300049587 Bacteria 1980
227 Ga0501071_0180972 3300049587 Bacteria 1579
228 Ga0501071_0331850 3300049587 Bacteria 1156
229 Ga0501072_0107314 3300049588 Bacteria 2221
230 Ga0501072_0173295 3300049588 Bacteria 1722
231 Ga0501072_0194355 3300049588 Bacteria 1618
232 Ga0501072_0302312 3300049588 Bacteria 1272
233 Ga0501074_0146479 3300049590 Bacteria 1689
234 Ga0501075_0007424 3300049591 Bacteria 7603
235 Ga0501075_0102830 3300049591 Bacteria 2170
236 Ga0501076_0003921 3300049592 Bacteria 10493
237 Ga0501076_0016046 3300049592 Bacteria 5670
238 Ga0501076_0083658 3300049592 Bacteria 2563
239 Ga0501076_0138458 3300049592 Bacteria 1977
240 Ga0501079_0098834 3300049741 Bacteria 2262
241 Ga0501080_0094471 3300049742 Bacteria 2777
242 Ga0501080_0145732 3300049742 Bacteria 2189
243 Ga0501080_0273389 3300049742 Bacteria 1537
244 Ga0501080_0293092 3300049742 Bacteria 1477
245 Ga0501080_0725019 3300049742 Bacteria 876
246 Ga0501081_0160990 3300049743 Bacteria 1617
247 Ga0501081_0292824 3300049743 Bacteria 1193
248 Ga0501083_0273825 3300049744 Bacteria 1098
249 Ga0501035_0135110 3300049822 Bacteria 2148
250 nmdc:mga03683_15596_c1 3300050489 Bacteria 2838
251 nmdc:mga00v17_1673_c1 3300050491 Bacteria 11537
252 nmdc:mga0yw44_9584_c1 3300050492 Bacteria 4908
253 nmdc:mga0k408_13637_c1 3300050493 Bacteria 4462
254 nmdc:mga0k408_8832_c1 3300050493 Bacteria 5422
255 nmdc:mga06z11_60794_c1 3300050494 Bacteria 1968
256 nmdc:mga05p37_6916_c1 3300050507 Bacteria 13371
257 nmdc:mga05p37_731331_c1 3300050507 Bacteria 1094
258 nmdc:mga09592_104512_c1 3300050508 Bacteria 2427
259 nmdc:mga09592_81733_c1 3300050508 Bacteria 2753
260 nmdc:mga0qj67_10207_c1 3300050509 Bacteria 7011
261 nmdc:mga0qj67_138887_c1 3300050509 Bacteria 1970
262 nmdc:mga0qj67_20299_c1 3300050509 Bacteria 5085
263 nmdc:mga06r32_13872_c1 3300050510 Bacteria 7311
264 nmdc:mga06r32_150735_c1 3300050510 Bacteria 2304
265 nmdc:mga06r32_63753_c1 3300050510 Bacteria 3553
266 nmdc:mga06r32_778939_c1 3300050510 Bacteria 918
267 nmdc:mga0n895_229509_c1 3300050512 Bacteria 1884
268 nmdc:mga0n895_428310_c1 3300050512 Bacteria 1337
269 nmdc:mga0n895_681460_c1 3300050512 Bacteria 1025
270 nmdc:mga08x19_259396_c1 3300050514 Bacteria 1201
271 nmdc:mga0a205_209200_c1 3300050515 Bacteria 1839
272 nmdc:mga0a205_409984_c1 3300050515 Bacteria 1218
273 nmdc:mga0a205_423667_c1 3300050515 Bacteria 1193
274 Ga0495601_0109549 3300053077 Bacteria 1788
275 Ga0501084_0192193 3300054114 Bacteria 1722
276 Ga0590071_003929 3300059421 Bacteria 3637
277 Ga0590071_007707 3300059421 Bacteria 2545
278 Ga0590074_004716 3300059423 Bacteria 2251
279 Ga0590077_000183 3300059426 Bacteria 17882
280 Ga0501082_0154883 3300060353 Bacteria 1991
281 Ga0501082_0428097 3300060353 Bacteria 1156
282 Ga0501082_0568611 3300060353 Bacteria 992
283 Ga0530510_0015181 3300061734 Bacteria 5439
284 Ga0530510_0249500 3300061734 Bacteria 1323
285 Ga0439449_0116001
286 Ga0065712_10012831
287 Ga0065715_10019884
288 Ga0065715_10118392
289 Ga0065707_10271578
290 Ga0070676_10031791
291 Ga0070676_10035372
292 Ga0070676_10068949
293 Ga0070690_100024813
294 Ga0070690_100288252
295 Ga0070670_100070176
296 Ga0068869_100109075
297 Ga0070682_100220652
298 Ga0070682_100296434
299 Ga0068868_100093968
300 Ga0068868_100334667
301 Ga0068868_100361935
302 Ga0070689_100128087
303 Ga0070691_10131867
304 Ga0070687_100022824
305 Ga0070687_100086072
306 Ga0070668_100127679
307 Ga0070668_100349967
308 Ga0070671_100039407
309 Ga0070671_100239334
310 Ga0070674_100049223
311 Ga0070674_100131551
312 Ga0070673_100001103
313 Ga0070673_100011199
314 Ga0070673_100211724
315 Ga0070673_100218705
316 Ga0070688_100209891
317 Ga0070688_100303265
318 Ga0070659_100094870
319 Ga0070659_100189100
320 Ga0070700_100037943
321 Ga0070700_100085928
322 Ga0070663_100300295
323 Ga0070663_100303269
324 Ga0070678_100022287
325 Ga0070678_100541735
326 Ga0070662_100000325
327 Ga0070662_100493028
328 Ga0070681_10127311
329 Ga0068867_100017429
330 Ga0068867_100026844
331 Ga0070684_100085068
332 Ga0070684_100930039
333 Ga0070672_100067248
334 Ga0070672_100366085
335 Ga0070686_100006339
336 Ga0070693_100009967
337 Ga0070693_100270507
338 Ga0070704_100084492
339 Ga0070704_100350141
340 Ga0068857_100486698
341 Ga0068854_100073526
342 Ga0070702_100157416
343 Ga0068859_100297035
344 Ga0068859_100310758
345 Ga0068864_100453378
346 Ga0068864_100683851
347 Ga0068866_10000212
348 Ga0068861_100034127
349 Ga0068861_100778623
350 Ga0068863_100153030
351 Ga0068858_100028826
352 Ga0068858_100075274
353 Ga0068858_100167382
354 Ga0068860_100021913
355 Ga0068860_100375637
356 Ga0068862_100219742
357 Ga0068862_100646720
358 Ga0075365_10000429
359 Ga0075368_10041642
360 Ga0075364_10000947
361 Ga0075364_10024364
362 Ga0075362_10019687
363 Ga0075367_10033942
364 Ga0075366_10012914
365 Ga0075366_10037622
366 Ga0075370_10017085
367 Ga0075428_100252817
368 Ga0075430_100052081
369 Ga0075430_100126973
370 Ga0075430_100188908
371 Ga0075431_100062309
372 Ga0075431_100519233
373 Ga0075433_10131320
374 Ga0075429_100317039
375 Ga0075429_100328916
376 Ga0075436_100361451
377 Ga0097620_100297022
378 Ga0097620_100310757
379 Ga0075435_100096278
380 Ga0105240_10222998
381 Ga0111539_10344957
382 Ga0111539_10910126
383 Ga0114129_10019034
384 Ga0114129_10039523
385 Ga0114129_10077296
386 Ga0114129_10837348
387 Ga0114129_11398387
388 Ga0105243_10043308
389 Ga0105243_10095079
390 Ga0105241_10309536
391 Ga0105242_10000445
392 Ga0105248_10006200
393 Ga0105249_10139923
394 Ga0105249_10743672
395 Ga0105239_10619819
396 Ga0157378_10036407
397 Ga0163162_10402970
398 Ga0157372_10243397
399 Ga0157375_10126928
400 Ga0157375_10303478
401 Ga0163163_10103497
402 Ga0157379_10051419
403 Ga0157376_10535968
404 Ga0163161_10044436
405 Ga0207645_10002734
406 Ga0207645_10003326
407 Ga0207645_10006244
408 Ga0207643_10144019
409 Ga0207707_10087575
410 Ga0207695_10470870
411 Ga0207662_10001183
412 Ga0207652_10403515
413 Ga0207681_10017861
414 Ga0207681_10255954
415 Ga0207681_10321290
416 Ga0207650_10142534
417 Ga0207644_10121142
418 Ga0207644_10513903
419 Ga0207690_10023506
420 Ga0207690_10151978
421 Ga0207706_10001947
422 Ga0207706_10110380
423 Ga0207686_10604907
424 Ga0207709_10072964
425 Ga0207709_10639899
426 Ga0207670_10027158
427 Ga0207670_10202036
428 Ga0207669_10050909
429 Ga0207669_10196216
430 Ga0207691_10042782
431 Ga0207691_10063921
432 Ga0207691_10082121
433 Ga0207691_10216002
434 Ga0207711_10023963
435 Ga0207711_10515103
436 Ga0207689_10005015
437 Ga0207661_10114345
438 Ga0207661_10182487
439 Ga0207661_10522727
440 Ga0207651_10046607
441 Ga0207651_10052345
442 Ga0207651_10260067
443 Ga0207712_10510704
444 Ga0207668_10047375
445 Ga0207640_10051744
446 Ga0207658_10067295
447 Ga0207677_10440459
448 Ga0207703_10073042
449 Ga0207703_10510721
450 Ga0207678_10198019
451 Ga0207708_10006807
452 Ga0207708_10024257
453 Ga0207708_10127555
454 Ga0207641_10222798
455 Ga0207648_10000030
456 Ga0207676_10058370
457 Ga0207674_10041837
458 Ga0207675_100019078
459 Ga0207675_100309226
460 Ga0207683_10010241
461 Ga0207698_10305041
462 Ga0268265_10138054
463 Ga0268265_10603711
464 Ga0268265_10628901
465 Ga0268264_10246536
466 Ga0307408_100504669
467 Ga0307405_10029067
468 Ga0307413_10291381
469 Ga0307413_10481845
470 Ga0307410_10065465
471 Ga0307412_10238122
472 Ga0307409_100033389
473 Ga0307409_100310942
474 Ga0307416_100060191
475 Ga0307416_100249533
476 Ga0307416_100425418
477 Ga0307414_10252874
478 Ga0307411_10038177
479 Ga0307411_10139169
480 Ga0307411_10364955
481 Ga0307415_100065300
482 Ga0307415_100161482
483 Ga0307415_100456776
484 Ga0373947_0192266
485 Ga0439453_0006199
486 Ga0451853_1197380
487 Ga0439431_0004645
488 Ga0439433_0021386
489 Ga0439446_0018794
490 Ga0439434_0100702
491 Ga0439435_0020412
492 Ga0451576_0733450
493 Ga0495603_0184705
494 Ga0495608_0044499
495 Ga0495658_0167080
496 Ga0496104_0218960
497 Ga0496112_0078948
498 Ga0496112_0439212
499 Ga0501031_0224184
500 Ga0501036_0026559
501 Ga0501036_0096945
502 Ga0501036_0106357
503 Ga0501036_0547062
504 Ga0501039_0364610
505 Ga0501040_0015421
506 Ga0501041_0015038
507 Ga0501042_0056313
508 Ga0501047_0037125
509 Ga0501069_0239189
510 Ga0501071_0116184
511 Ga0501071_0180972
512 Ga0501071_0331850
513 Ga0501072_0107314
514 Ga0501072_0173295
515 Ga0501072_0194355
516 Ga0501072_0302312
517 Ga0501074_0146479
518 Ga0501075_0007424
519 Ga0501075_0102830
520 Ga0501076_0003921
521 Ga0501076_0016046
522 Ga0501076_0083658
523 Ga0501076_0138458
524 Ga0501079_0098834
525 Ga0501080_0094471
526 Ga0501080_0145732
527 Ga0501080_0273389
528 Ga0501080_0293092
529 Ga0501080_0725019
530 Ga0501081_0160990
531 Ga0501081_0292824
532 Ga0501083_0273825
533 Ga0501035_0135110
534 nmdc:mga03683_15596_c1
535 nmdc:mga00v17_1673_c1
536 nmdc:mga0yw44_9584_c1
537 nmdc:mga0k408_13637_c1
538 nmdc:mga0k408_8832_c1
539 nmdc:mga06z11_60794_c1
540 nmdc:mga05p37_6916_c1
541 nmdc:mga05p37_731331_c1
542 nmdc:mga09592_104512_c1
543 nmdc:mga09592_81733_c1
544 nmdc:mga0qj67_10207_c1
545 nmdc:mga0qj67_138887_c1
546 nmdc:mga0qj67_20299_c1
547 nmdc:mga06r32_13872_c1
548 nmdc:mga06r32_150735_c1
549 nmdc:mga06r32_63753_c1
550 nmdc:mga06r32_778939_c1
551 nmdc:mga0n895_229509_c1
552 nmdc:mga0n895_428310_c1
553 nmdc:mga0n895_681460_c1
554 nmdc:mga08x19_259396_c1
555 nmdc:mga0a205_209200_c1
556 nmdc:mga0a205_409984_c1
557 nmdc:mga0a205_423667_c1
558 Ga0495601_0109549
559 Ga0501084_0192193
560 Ga0590071_003929
561 Ga0590071_007707
562 Ga0590074_004716
563 Ga0590077_000183
564 Ga0501082_0154883
565 Ga0501082_0428097
566 Ga0501082_0568611
567 Ga0530510_0015181
568 Ga0530510_0249500

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

10

257

0.95

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

15

251

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kqf-assembly1.cif.gz_B 1.8 angstrom resolution crystal structure of enoyl-coa hydratase from bacillus anthracis. 0.9597 7 260
4fjw-assembly1.cif.gz_D crystal structure of the apo form of the e131q mtb crotonase 0.9493 4 258
3h81-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis 0.9465 4 260
4jfc-assembly1.cif.gz_A crystal structure of a enoyl-coa hydratase from polaromonas sp. js666 0.9448 8 258
2zqq-assembly1.cif.gz_C crystal structure of human auh (3-methylglutaconyl-coa hydratase) mixed with (auuu)24a rna 0.9447 6 260
ID Description Score Start End Superfamily
3rsiB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; 0.9715 98 200 3.90.226.20
2zqqB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9701 203 260 1.10.12.10
2zqqE02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9701 203 260 1.10.12.10
2zqqA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9663 203 260 1.10.12.10
2zqrB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9629 203 260 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A2E6NJH7-F1-model_v4 Crotonase 0.9719 4 260 GO:0006635
GO:0016836
AF-A0A416GKA1-F1-model_v4 deleted 0.9712 4 260
AF-A0A7X8U7N3-F1-model_v4 Short-chain-enoyl-CoA hydratase (EC 4.2.1.150) 0.9703 4 260 GO:0006635
GO:0016836
AF-A0A6J4QZD2-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9701 4 260 GO:0004300
GO:0006635
AF-A0A845LHR8-F1-model_v4 Crotonase 0.9678 4 260 GO:0006635
GO:0016836

Map