F386281

General Info

Members Datasets Scaffolds Average Seq Length
284 155 568 308

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10015727|Ga0307414_100157272
Length 303
Sequence MKRSTFIHSSVLAGLSMAAAPLSFAKSQTKQTKSFNLNYAPHDGMFASHGGKSFLDQISYMHSQGFNAIEDNGMLQRPVAEQEQIGNLLKKLNMEMGVFVVDAGDNWKVSLTSGKKEFKDRFADACRRSVETAKRVNAKWATVVPGFFDRSLPLDIQTSHVIDALRIGAEIFEPHGLVMVLEPLSDTPELFMRYSDQTYMLCKAVNSPSCKILYDIYHMQRNEGNIIKNIDLCWDEIAYIQIGDNPGRKEPGTGELNYQNIFKHIHSKGFKGILGMEHGNSKGGKEGELLLLKSYREADAFLP

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
126 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
127 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
140 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
141 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
144 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
145 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
148 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
152 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
153 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0
Rhizoplane 0.35
Rhizosphere 96.13
Stem 0
Stem Tuber 0
Unclassified 12.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10015727 3300032004 Unclassified 4576
2 JGI24751J29686_10002372 3300002459 Bacteria 3803
3 rootL2_10017961 3300003322 Bacteria 4643
4 Ga0065714_10120108 3300005288 Bacteria 1358
5 Ga0065704_10103059 3300005289 Bacteria 2184
6 Ga0065712_10005278 3300005290 Bacteria 3268
7 Ga0065712_10005838 3300005290 Unclassified 2760
8 Ga0065712_10072945 3300005290 Bacteria 4557
9 Ga0065712_10083054 3300005290 Bacteria 2865
10 Ga0065715_10005044 3300005293 Bacteria 5099
11 Ga0065715_10008838 3300005293 Unclassified 2978
12 Ga0065707_10124250 3300005295 Bacteria 2048
13 Ga0070658_10184379 3300005327 Unclassified 1757
14 Ga0070676_10022315 3300005328 Bacteria 3549
15 Ga0070676_10058687 3300005328 Unclassified 2281
16 Ga0070676_10163336 3300005328 Bacteria 1435
17 Ga0070683_100010782 3300005329 Bacteria 7865
18 Ga0070670_100007921 3300005331 Bacteria 9040
19 Ga0070670_100033109 3300005331 Unclassified 4452
20 Ga0070670_100162343 3300005331 Unclassified 1936
21 Ga0070677_10154255 3300005333 Bacteria 1072
22 Ga0068869_100057228 3300005334 Bacteria 2845
23 Ga0068869_100132105 3300005334 Bacteria 1920
24 Ga0068869_100160214 3300005334 Bacteria 1751
25 Ga0070680_100061517 3300005336 Bacteria 3074
26 Ga0068868_100176865 3300005338 Unclassified 1769
27 Ga0070689_100016172 3300005340 Bacteria 5456
28 Ga0070689_100043050 3300005340 Bacteria 3468
29 Ga0070689_100158330 3300005340 Bacteria 1829
30 Ga0070661_100234813 3300005344 Bacteria 1410
31 Ga0070668_100015061 3300005347 Bacteria 5776
32 Ga0070669_100019686 3300005353 Bacteria 4821
33 Ga0070669_100024912 3300005353 Bacteria 4294
34 Ga0070669_100034239 3300005353 Unclassified 3677
35 Ga0070675_100030148 3300005354 Bacteria 4377
36 Ga0070675_100037185 3300005354 Bacteria 3964
37 Ga0070675_100133072 3300005354 Bacteria 2121
38 Ga0070671_100080801 3300005355 Bacteria 2718
39 Ga0070671_100342219 3300005355 Unclassified 1276
40 Ga0070674_100048085 3300005356 Bacteria 2926
41 Ga0070674_100075747 3300005356 Bacteria 2391
42 Ga0070674_100289533 3300005356 Bacteria 1301
43 Ga0070673_100000916 3300005364 Bacteria 16669
44 Ga0070673_100014416 3300005364 Bacteria 5505
45 Ga0070673_100033392 3300005364 Bacteria 3885
46 Ga0070673_100065883 3300005364 Bacteria 2891
47 Ga0070688_100006351 3300005365 Bacteria 6315
48 Ga0070688_100016590 3300005365 Bacteria 4214
49 Ga0070667_100016965 3300005367 Bacteria 6028
50 Ga0070701_10011822 3300005438 Bacteria 3920
51 Ga0070701_10135325 3300005438 Bacteria 1404
52 Ga0070700_100024867 3300005441 Bacteria 3521
53 Ga0070700_100042041 3300005441 Bacteria 2805
54 Ga0070678_100223426 3300005456 Bacteria 1566
55 Ga0070662_100016867 3300005457 Bacteria 4909
56 Ga0068867_100116626 3300005459 Bacteria 2058
57 Ga0068867_100144107 3300005459 Unclassified 1865
58 Ga0068867_100178494 3300005459 Bacteria 1687
59 Ga0068867_100308822 3300005459 Unclassified 1306
60 Ga0070685_10021873 3300005466 Bacteria 3479
61 Ga0070685_10118911 3300005466 Bacteria 1638
62 Ga0070698_100001837 3300005471 Bacteria 23656
63 Ga0070698_100019228 3300005471 Bacteria 7176
64 Ga0070699_100247701 3300005518 Bacteria 1591
65 Ga0070684_100231475 3300005535 Unclassified 1687
66 Ga0068855_100001621 3300005563 Bacteria 28227
67 Ga0070664_100020475 3300005564 Bacteria 5447
68 Ga0070664_100276637 3300005564 Bacteria 1513
69 Ga0068857_100059155 3300005577 Bacteria 3403
70 Ga0068857_100110993 3300005577 Unclassified 2465
71 Ga0068854_100056039 3300005578 Bacteria 2840
72 Ga0068854_100233053 3300005578 Unclassified 1462
73 Ga0068856_100358693 3300005614 Bacteria 1476
74 Ga0070702_100019598 3300005615 Bacteria 3532
75 Ga0068852_100116025 3300005616 Bacteria 2442
76 Ga0068859_100051734 3300005617 Bacteria 4129
77 Ga0068859_100075543 3300005617 Bacteria 3410
78 Ga0068859_100450684 3300005617 Bacteria 1383
79 Ga0068859_100534849 3300005617 Bacteria 1267
80 Ga0068864_100331453 3300005618 Unclassified 1432
81 Ga0068866_10212516 3300005718 Bacteria 1162
82 Ga0068861_100011935 3300005719 Bacteria 6050
83 Ga0068861_100414432 3300005719 Bacteria 1199
84 Ga0068870_10007219 3300005840 Bacteria 4947
85 Ga0068863_100034029 3300005841 Bacteria 4854
86 Ga0068863_100106133 3300005841 Bacteria 2672
87 Ga0068863_100609737 3300005841 Bacteria 1081
88 Ga0068860_100006734 3300005843 Bacteria 11526
89 Ga0068860_100453222 3300005843 Bacteria 1276
90 Ga0068862_100001074 3300005844 Bacteria 26203
91 Ga0068862_100011517 3300005844 Bacteria 7300
92 Ga0068862_100069787 3300005844 Unclassified 3033
93 Ga0081539_10088879 3300005985 Bacteria 1601
94 Ga0070716_100291865 3300006173 Bacteria 1130
95 Ga0075366_10020862 3300006195 Bacteria 3806
96 Ga0097621_100000129 3300006237 Bacteria 44253
97 Ga0097621_100002717 3300006237 Bacteria 12108
98 Ga0097621_100007374 3300006237 Bacteria 7867
99 Ga0097621_100021268 3300006237 Bacteria 5014
100 Ga0097621_100485117 3300006237 Bacteria 1118
101 Ga0068871_100000075 3300006358 Bacteria 55346
102 Ga0068871_100044670 3300006358 Bacteria 3564
103 Ga0068871_100151836 3300006358 Bacteria 1976
104 Ga0075428_100020317 3300006844 Bacteria 7355
105 Ga0075431_100013305 3300006847 Bacteria 8315
106 Ga0075429_100005468 3300006880 Bacteria 10941
107 Ga0068865_100117208 3300006881 Unclassified 1974
108 Ga0068865_100130808 3300006881 Unclassified 1880
109 Ga0097620_100051734 3300006931 Bacteria 4129
110 Ga0097620_100075538 3300006931 Bacteria 3410
111 Ga0097620_100450663 3300006931 Bacteria 1383
112 Ga0097620_100534876 3300006931 Bacteria 1267
113 Ga0105240_10002447 3300009093 Bacteria 29855
114 Ga0105240_10473925 3300009093 Bacteria 1396
115 Ga0111539_10010436 3300009094 Bacteria 11690
116 Ga0111539_10637430 3300009094 Bacteria 1241
117 Ga0114129_10391213 3300009147 Unclassified 1834
118 Ga0105241_10004589 3300009174 Bacteria 10219
119 Ga0105242_10027868 3300009176 Bacteria 4491
120 Ga0105242_10069357 3300009176 Unclassified 2920
121 Ga0105242_10146929 3300009176 Bacteria 2052
122 Ga0105242_10163560 3300009176 Bacteria 1950
123 Ga0105237_10368212 3300009545 Bacteria 1442
124 Ga0105249_10005961 3300009553 Bacteria 10562
125 Ga0105249_10012047 3300009553 Bacteria 7613
126 Ga0105249_10136923 3300009553 Bacteria 2344
127 Ga0105249_10141408 3300009553 Bacteria 2308
128 Ga0105249_10520675 3300009553 Bacteria 1236
129 Ga0105239_10001283 3300010375 Bacteria 33928
130 Ga0105239_10025042 3300010375 Bacteria 6574
131 Ga0157373_10040155 3300013100 Unclassified 3349
132 Ga0157371_10018967 3300013102 Bacteria 5078
133 Ga0157370_10012272 3300013104 Bacteria 8893
134 Ga0157370_10213265 3300013104 Bacteria 1789
135 Ga0157369_10008855 3300013105 Bacteria 11526
136 Ga0157369_10241011 3300013105 Bacteria 1889
137 Ga0157374_10236504 3300013296 Bacteria 1795
138 Ga0157378_10025401 3300013297 Bacteria 5217
139 Ga0157378_10203711 3300013297 Bacteria 1872
140 Ga0163162_10001415 3300013306 Bacteria 22313
141 Ga0163162_10015535 3300013306 Bacteria 7440
142 Ga0163162_10036836 3300013306 Bacteria 4879
143 Ga0163162_10085129 3300013306 Bacteria 3238
144 Ga0163162_10197805 3300013306 Unclassified 2139
145 Ga0163162_10213540 3300013306 Bacteria 2059
146 Ga0157372_10208106 3300013307 Bacteria 2267
147 Ga0157372_10302715 3300013307 Bacteria 1860
148 Ga0157375_10000327 3300013308 Bacteria 42691
149 Ga0157375_10095245 3300013308 Bacteria 3047
150 Ga0157375_10105951 3300013308 Bacteria 2903
151 Ga0157375_10416478 3300013308 Unclassified 1510
152 Ga0163163_10000191 3300014325 Bacteria 63102
153 Ga0163163_10169345 3300014325 Bacteria 2230
154 Ga0163163_10327840 3300014325 Bacteria 1585
155 Ga0157380_10004620 3300014326 Bacteria 9565
156 Ga0157380_10034081 3300014326 Bacteria 3926
157 Ga0157380_10065716 3300014326 Bacteria 2916
158 Ga0157380_10159530 3300014326 Bacteria 1959
159 Ga0157377_10003874 3300014745 Bacteria 6816
160 Ga0157377_10006092 3300014745 Bacteria 5724
161 Ga0157377_10016352 3300014745 Unclassified 3815
162 Ga0157379_10082238 3300014968 Unclassified 2886
163 Ga0157379_10135890 3300014968 Bacteria 2215
164 Ga0157379_10230954 3300014968 Bacteria 1677
165 Ga0157376_10000413 3300014969 Bacteria 27856
166 Ga0157376_10041030 3300014969 Bacteria 3786
167 Ga0157376_10072504 3300014969 Bacteria 2929
168 Ga0157376_10471729 3300014969 Bacteria 1228
169 Ga0163161_10001316 3300017792 Bacteria 18501
170 Ga0163161_10327668 3300017792 Bacteria 1212
171 Ga0207688_10031812 3300025901 Bacteria 2914
172 Ga0207645_10129787 3300025907 Unclassified 1640
173 Ga0207645_10366161 3300025907 Bacteria 966
174 Ga0207643_10003177 3300025908 Bacteria 8848
175 Ga0207643_10005655 3300025908 Bacteria 6685
176 Ga0207643_10075098 3300025908 Bacteria 1950
177 Ga0207705_10146153 3300025909 Unclassified 1769
178 Ga0207705_10260214 3300025909 Bacteria 1325
179 Ga0207654_10112877 3300025911 Bacteria 1694
180 Ga0207707_10356939 3300025912 Bacteria 1259
181 Ga0207695_10000245 3300025913 Bacteria 141090
182 Ga0207695_10434301 3300025913 Bacteria 1197
183 Ga0207671_10251350 3300025914 Bacteria 1390
184 Ga0207662_10041703 3300025918 Bacteria 2703
185 Ga0207662_10042418 3300025918 Bacteria 2682
186 Ga0207662_10093297 3300025918 Bacteria 1855
187 Ga0207649_10328438 3300025920 Bacteria 1126
188 Ga0207646_10322521 3300025922 Bacteria 1396
189 Ga0207681_10086221 3300025923 Unclassified 2230
190 Ga0207681_10304354 3300025923 Bacteria 1262
191 Ga0207650_10053895 3300025925 Bacteria 2982
192 Ga0207650_10161526 3300025925 Bacteria 1775
193 Ga0207659_10067481 3300025926 Bacteria 2598
194 Ga0207644_10053691 3300025931 Bacteria 2901
195 Ga0207644_10122352 3300025931 Bacteria 1982
196 Ga0207644_10272570 3300025931 Bacteria 1356
197 Ga0207706_10004505 3300025933 Bacteria 13082
198 Ga0207686_10006408 3300025934 Bacteria 6334
199 Ga0207670_10000852 3300025936 Bacteria 16014
200 Ga0207670_10007289 3300025936 Bacteria 6159
201 Ga0207670_10166505 3300025936 Bacteria 1649
202 Ga0207669_10011461 3300025937 Bacteria 4316
203 Ga0207704_10123659 3300025938 Unclassified 1776
204 Ga0207691_10004166 3300025940 Bacteria 14052
205 Ga0207691_10026375 3300025940 Bacteria 5453
206 Ga0207689_10025080 3300025942 Bacteria 4998
207 Ga0207689_10116469 3300025942 Bacteria 2197
208 Ga0207661_10007241 3300025944 Bacteria 7889
209 Ga0207679_10038818 3300025945 Bacteria 3396
210 Ga0207667_10001378 3300025949 Bacteria 30467
211 Ga0207667_10002997 3300025949 Bacteria 20966
212 Ga0207667_10342688 3300025949 Bacteria 1525
213 Ga0207651_10001828 3300025960 Bacteria 9919
214 Ga0207651_10056782 3300025960 Unclassified 2696
215 Ga0207651_10172344 3300025960 Bacteria 1708
216 Ga0207651_10419951 3300025960 Bacteria 1141
217 Ga0207712_10002408 3300025961 Bacteria 12099
218 Ga0207712_10011056 3300025961 Bacteria 5746
219 Ga0207658_10011316 3300025986 Bacteria 6074
220 Ga0207658_10178468 3300025986 Bacteria 1756
221 Ga0207708_10168002 3300026075 Bacteria 1736
222 Ga0207708_10204286 3300026075 Bacteria 1577
223 Ga0207702_10146015 3300026078 Bacteria 2146
224 Ga0207702_10194600 3300026078 Bacteria 1876
225 Ga0207641_10000422 3300026088 Bacteria 49394
226 Ga0207641_10025182 3300026088 Bacteria 4906
227 Ga0207641_10268410 3300026088 Bacteria 1600
228 Ga0207641_10290729 3300026088 Bacteria 1540
229 Ga0207648_10185300 3300026089 Bacteria 1843
230 Ga0207648_10411018 3300026089 Unclassified 1227
231 Ga0207676_10056916 3300026095 Bacteria 3077
232 Ga0207676_10208452 3300026095 Unclassified 1732
233 Ga0207676_10736879 3300026095 Unclassified 957
234 Ga0207674_10009721 3300026116 Bacteria 10961
235 Ga0207674_10020871 3300026116 Bacteria 7068
236 Ga0207674_10033000 3300026116 Bacteria 5425
237 Ga0207675_100047513 3300026118 Bacteria 4007
238 Ga0207675_100124728 3300026118 Unclassified 2439
239 Ga0207683_10127236 3300026121 Bacteria 2290
240 Ga0207683_10276035 3300026121 Bacteria 1536
241 Ga0207683_10513362 3300026121 Bacteria 1107
242 Ga0207698_10020229 3300026142 Bacteria 4576
243 Ga0207698_10046433 3300026142 Bacteria 3280
244 Ga0268265_10152766 3300028380 Bacteria 1949
245 Ga0268264_10213043 3300028381 Bacteria 1774
246 Ga0307515_10001698 3300028794 Bacteria 49084
247 Ga0436365_1373625 3300039437 Bacteria 10587
248 Ga0439441_006271 3300042001 Unclassified 1880
249 Ga0439457_000368 3300042014 Bacteria 12639
250 Ga0439462_0017792 3300042015 Bacteria 1842
251 Ga0451577_0154379 3300042876 Bacteria 2066
252 Ga0466966_0041034 3300044684 Bacteria 2975
253 Ga0453684_0105622 3300044712 Bacteria 3434
254 Ga0453684_0177101 3300044712 Bacteria 2507
255 Ga0466957_0002398 3300044842 Bacteria 10057
256 Ga0466957_0005971 3300044842 Bacteria 6869
257 Ga0466959_0000076 3300045049 Bacteria 62314
258 Ga0495668_0001431 3300046616 Bacteria 23109
259 Ga0496104_0007359 3300048907 Bacteria 9723
260 Ga0501033_0037430 3300049570 Bacteria 3632
261 Ga0501034_0005007 3300049571 Bacteria 14572
262 Ga0501036_0015894 3300049572 Bacteria 6286
263 Ga0501043_0024212 3300049579 Bacteria 4763
264 Ga0501217_048042 3300049661 Bacteria 1107
265 Ga0501221_039917 3300049704 Bacteria 1019
266 Ga0501225_0000229 3300049705 Bacteria 17619
267 Ga0501080_0106393 3300049742 Bacteria 2600
268 Ga0501241_007774 3300049758 Bacteria 1964
269 Ga0501263_007320 3300049760 Bacteria 1295
270 Ga0501266_001887 3300049763 Bacteria 2633
271 Ga0501044_0006455 3300049823 Bacteria 12954
272 Ga0501044_0007280 3300049823 Bacteria 12161
273 Ga0501044_0012362 3300049823 Bacteria 9240
274 Ga0501044_0094771 3300049823 Bacteria 3009
275 Ga0501284_00006 3300050005 Bacteria 153628
276 nmdc:mga0k408_143295_c1 3300050493 Bacteria 1422
277 nmdc:mga09592_93118_c1 3300050508 Bacteria 2577
278 nmdc:mga0qj67_255301_c1 3300050509 Bacteria 1422
279 nmdc:mga0qj67_56661_c1 3300050509 Bacteria 3107
280 Ga0500644_0034849 3300053088 Bacteria 1627
281 Ga0500642_0089961 3300053130 Bacteria 1418
282 Ga0500658_0033546 3300053134 Bacteria 2020
283 Ga0500616_0029766 3300053153 Bacteria 3003
284 2738725936 2738541278 Bacteria 9755573
285 Ga0307414_10015727
286 JGI24751J29686_10002372
287 rootL2_10017961
288 Ga0065714_10120108
289 Ga0065704_10103059
290 Ga0065712_10005278
291 Ga0065712_10005838
292 Ga0065712_10072945
293 Ga0065712_10083054
294 Ga0065715_10005044
295 Ga0065715_10008838
296 Ga0065707_10124250
297 Ga0070658_10184379
298 Ga0070676_10022315
299 Ga0070676_10058687
300 Ga0070676_10163336
301 Ga0070683_100010782
302 Ga0070670_100007921
303 Ga0070670_100033109
304 Ga0070670_100162343
305 Ga0070677_10154255
306 Ga0068869_100057228
307 Ga0068869_100132105
308 Ga0068869_100160214
309 Ga0070680_100061517
310 Ga0068868_100176865
311 Ga0070689_100016172
312 Ga0070689_100043050
313 Ga0070689_100158330
314 Ga0070661_100234813
315 Ga0070668_100015061
316 Ga0070669_100019686
317 Ga0070669_100024912
318 Ga0070669_100034239
319 Ga0070675_100030148
320 Ga0070675_100037185
321 Ga0070675_100133072
322 Ga0070671_100080801
323 Ga0070671_100342219
324 Ga0070674_100048085
325 Ga0070674_100075747
326 Ga0070674_100289533
327 Ga0070673_100000916
328 Ga0070673_100014416
329 Ga0070673_100033392
330 Ga0070673_100065883
331 Ga0070688_100006351
332 Ga0070688_100016590
333 Ga0070667_100016965
334 Ga0070701_10011822
335 Ga0070701_10135325
336 Ga0070700_100024867
337 Ga0070700_100042041
338 Ga0070678_100223426
339 Ga0070662_100016867
340 Ga0068867_100116626
341 Ga0068867_100144107
342 Ga0068867_100178494
343 Ga0068867_100308822
344 Ga0070685_10021873
345 Ga0070685_10118911
346 Ga0070698_100001837
347 Ga0070698_100019228
348 Ga0070699_100247701
349 Ga0070684_100231475
350 Ga0068855_100001621
351 Ga0070664_100020475
352 Ga0070664_100276637
353 Ga0068857_100059155
354 Ga0068857_100110993
355 Ga0068854_100056039
356 Ga0068854_100233053
357 Ga0068856_100358693
358 Ga0070702_100019598
359 Ga0068852_100116025
360 Ga0068859_100051734
361 Ga0068859_100075543
362 Ga0068859_100450684
363 Ga0068859_100534849
364 Ga0068864_100331453
365 Ga0068866_10212516
366 Ga0068861_100011935
367 Ga0068861_100414432
368 Ga0068870_10007219
369 Ga0068863_100034029
370 Ga0068863_100106133
371 Ga0068863_100609737
372 Ga0068860_100006734
373 Ga0068860_100453222
374 Ga0068862_100001074
375 Ga0068862_100011517
376 Ga0068862_100069787
377 Ga0081539_10088879
378 Ga0070716_100291865
379 Ga0075366_10020862
380 Ga0097621_100000129
381 Ga0097621_100002717
382 Ga0097621_100007374
383 Ga0097621_100021268
384 Ga0097621_100485117
385 Ga0068871_100000075
386 Ga0068871_100044670
387 Ga0068871_100151836
388 Ga0075428_100020317
389 Ga0075431_100013305
390 Ga0075429_100005468
391 Ga0068865_100117208
392 Ga0068865_100130808
393 Ga0097620_100051734
394 Ga0097620_100075538
395 Ga0097620_100450663
396 Ga0097620_100534876
397 Ga0105240_10002447
398 Ga0105240_10473925
399 Ga0111539_10010436
400 Ga0111539_10637430
401 Ga0114129_10391213
402 Ga0105241_10004589
403 Ga0105242_10027868
404 Ga0105242_10069357
405 Ga0105242_10146929
406 Ga0105242_10163560
407 Ga0105237_10368212
408 Ga0105249_10005961
409 Ga0105249_10012047
410 Ga0105249_10136923
411 Ga0105249_10141408
412 Ga0105249_10520675
413 Ga0105239_10001283
414 Ga0105239_10025042
415 Ga0157373_10040155
416 Ga0157371_10018967
417 Ga0157370_10012272
418 Ga0157370_10213265
419 Ga0157369_10008855
420 Ga0157369_10241011
421 Ga0157374_10236504
422 Ga0157378_10025401
423 Ga0157378_10203711
424 Ga0163162_10001415
425 Ga0163162_10015535
426 Ga0163162_10036836
427 Ga0163162_10085129
428 Ga0163162_10197805
429 Ga0163162_10213540
430 Ga0157372_10208106
431 Ga0157372_10302715
432 Ga0157375_10000327
433 Ga0157375_10095245
434 Ga0157375_10105951
435 Ga0157375_10416478
436 Ga0163163_10000191
437 Ga0163163_10169345
438 Ga0163163_10327840
439 Ga0157380_10004620
440 Ga0157380_10034081
441 Ga0157380_10065716
442 Ga0157380_10159530
443 Ga0157377_10003874
444 Ga0157377_10006092
445 Ga0157377_10016352
446 Ga0157379_10082238
447 Ga0157379_10135890
448 Ga0157379_10230954
449 Ga0157376_10000413
450 Ga0157376_10041030
451 Ga0157376_10072504
452 Ga0157376_10471729
453 Ga0163161_10001316
454 Ga0163161_10327668
455 Ga0207688_10031812
456 Ga0207645_10129787
457 Ga0207645_10366161
458 Ga0207643_10003177
459 Ga0207643_10005655
460 Ga0207643_10075098
461 Ga0207705_10146153
462 Ga0207705_10260214
463 Ga0207654_10112877
464 Ga0207707_10356939
465 Ga0207695_10000245
466 Ga0207695_10434301
467 Ga0207671_10251350
468 Ga0207662_10041703
469 Ga0207662_10042418
470 Ga0207662_10093297
471 Ga0207649_10328438
472 Ga0207646_10322521
473 Ga0207681_10086221
474 Ga0207681_10304354
475 Ga0207650_10053895
476 Ga0207650_10161526
477 Ga0207659_10067481
478 Ga0207644_10053691
479 Ga0207644_10122352
480 Ga0207644_10272570
481 Ga0207706_10004505
482 Ga0207686_10006408
483 Ga0207670_10000852
484 Ga0207670_10007289
485 Ga0207670_10166505
486 Ga0207669_10011461
487 Ga0207704_10123659
488 Ga0207691_10004166
489 Ga0207691_10026375
490 Ga0207689_10025080
491 Ga0207689_10116469
492 Ga0207661_10007241
493 Ga0207679_10038818
494 Ga0207667_10001378
495 Ga0207667_10002997
496 Ga0207667_10342688
497 Ga0207651_10001828
498 Ga0207651_10056782
499 Ga0207651_10172344
500 Ga0207651_10419951
501 Ga0207712_10002408
502 Ga0207712_10011056
503 Ga0207658_10011316
504 Ga0207658_10178468
505 Ga0207708_10168002
506 Ga0207708_10204286
507 Ga0207702_10146015
508 Ga0207702_10194600
509 Ga0207641_10000422
510 Ga0207641_10025182
511 Ga0207641_10268410
512 Ga0207641_10290729
513 Ga0207648_10185300
514 Ga0207648_10411018
515 Ga0207676_10056916
516 Ga0207676_10208452
517 Ga0207676_10736879
518 Ga0207674_10009721
519 Ga0207674_10020871
520 Ga0207674_10033000
521 Ga0207675_100047513
522 Ga0207675_100124728
523 Ga0207683_10127236
524 Ga0207683_10276035
525 Ga0207683_10513362
526 Ga0207698_10020229
527 Ga0207698_10046433
528 Ga0268265_10152766
529 Ga0268264_10213043
530 Ga0307515_10001698
531 Ga0436365_1373625
532 Ga0439441_006271
533 Ga0439457_000368
534 Ga0439462_0017792
535 Ga0451577_0154379
536 Ga0466966_0041034
537 Ga0453684_0105622
538 Ga0453684_0177101
539 Ga0466957_0002398
540 Ga0466957_0005971
541 Ga0466959_0000076
542 Ga0495668_0001431
543 Ga0496104_0007359
544 Ga0501033_0037430
545 Ga0501034_0005007
546 Ga0501036_0015894
547 Ga0501043_0024212
548 Ga0501217_048042
549 Ga0501221_039917
550 Ga0501225_0000229
551 Ga0501080_0106393
552 Ga0501241_007774
553 Ga0501263_007320
554 Ga0501266_001887
555 Ga0501044_0006455
556 Ga0501044_0007280
557 Ga0501044_0012362
558 Ga0501044_0094771
559 Ga0501284_00006
560 nmdc:mga0k408_143295_c1
561 nmdc:mga09592_93118_c1
562 nmdc:mga0qj67_255301_c1
563 nmdc:mga0qj67_56661_c1
564 Ga0500644_0034849
565 Ga0500642_0089961
566 Ga0500658_0033546
567 Ga0500616_0029766
568 2738725936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

58

297

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.8716 40 300
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.8622 40 300
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.8611 40 301
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.8519 40 301
6wn6-assembly1.cif.gz_A crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form 0.8233 40 297
ID Description Score Start End Superfamily
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8677 40 300 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8631 42 301 3.20.20.150
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8616 40 300 3.20.20.150
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8527 40 300 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8507 42 301 3.20.20.150
ID Description Score Start End GO Terms
AF-X1QKY0-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9689 128 305 GO:0016853
AF-A0A2N3HHV5-F1-model_v4 Xylose isomerase 0.9595 36 305 GO:0016853
AF-A0A7V6D0W6-F1-model_v4 Xylose isomerase 0.9571 121 306 GO:0016853
AF-X1J4B2-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.952 88 305 GO:0016853
AF-X1J4B2-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9436 88 305 GO:0016853

Map