F386159

General Info

Members Datasets Scaffolds Average Seq Length
284 189 568 125

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_11538168|Ga0111539_115381681
Length 150
Sequence VARRQDDSGRADDLGGAASQRPEAQLHLSRRERQIMDVVYRLGRVSAAEVTAQLPDPPSYSAVRALLRILEDKGHLRHTEEAGTGKYVYSPVRPRDHAGKSALQRVVQTFFDNSAEKAVAALLDLADRELSEAELERLAKLIEQARNEGR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
127 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
128 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
129 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
130 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
156 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
157 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
158 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
159 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
160 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
161 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
162 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
163 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
164 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
165 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
166 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
167 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
172 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.06
Rhizosphere 98.94
Stem 0
Stem Tuber 0
Unclassified 20.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_11538168 3300009094 Bacteria 772
2 MBSR1b_contig_1236219 2162886012 Bacteria 1082
3 Ga0065715_10251610 3300005293 Bacteria 1165
4 Ga0065707_10023087 3300005295 Bacteria 1669
5 Ga0070683_100073807 3300005329 Bacteria 3185
6 Ga0070683_100264737 3300005329 Unclassified 1635
7 Ga0070690_100388653 3300005330 Bacteria 1022
8 Ga0070690_100511363 3300005330 Unclassified 900
9 Ga0068869_100716818 3300005334 Bacteria 854
10 Ga0070680_100000415 3300005336 Bacteria 29079
11 Ga0070689_100000666 3300005340 Bacteria 20781
12 Ga0070689_100001844 3300005340 Bacteria 13658
13 Ga0070689_100985478 3300005340 Unclassified 749
14 Ga0070687_100021031 3300005343 Bacteria 3060
15 Ga0070692_10077608 3300005345 Unclassified 1782
16 Ga0070675_101119146 3300005354 Bacteria 724
17 Ga0070673_100299441 3300005364 Bacteria 1415
18 Ga0070688_100000967 3300005365 Bacteria 14383
19 Ga0070688_100006207 3300005365 Bacteria 6365
20 Ga0070688_100215014 3300005365 Bacteria 1352
21 Ga0070709_10974346 3300005434 Bacteria 674
22 Ga0070714_100009775 3300005435 Bacteria 7559
23 Ga0070714_100051021 3300005435 Bacteria 3527
24 Ga0070713_100023843 3300005436 Bacteria 4756
25 Ga0070701_10315848 3300005438 Bacteria 965
26 Ga0070705_100695909 3300005440 Bacteria 798
27 Ga0070705_100796101 3300005440 Bacteria 752
28 Ga0070700_100151451 3300005441 Bacteria 1587
29 Ga0070700_100467363 3300005441 Bacteria 963
30 Ga0070700_101848887 3300005441 Bacteria 521
31 Ga0070694_100602539 3300005444 Bacteria 885
32 Ga0070708_100001640 3300005445 Bacteria 17145
33 Ga0070708_100007796 3300005445 Bacteria 8580
34 Ga0070708_100727968 3300005445 Unclassified 933
35 Ga0070708_101866861 3300005445 Bacteria 557
36 Ga0070663_100845354 3300005455 Unclassified 787
37 Ga0070662_100028184 3300005457 Bacteria 3906
38 Ga0070681_10001210 3300005458 Bacteria 22454
39 Ga0070681_10014764 3300005458 Bacteria 7766
40 Ga0070685_10022174 3300005466 Bacteria 3458
41 Ga0070706_100029466 3300005467 Bacteria 5057
42 Ga0070706_101339174 3300005467 Bacteria 656
43 Ga0070707_100297693 3300005468 Bacteria 1568
44 Ga0070707_100457130 3300005468 Bacteria 1237
45 Ga0070707_100617848 3300005468 Unclassified 1046
46 Ga0070707_100704342 3300005468 Bacteria 973
47 Ga0070698_100473549 3300005471 Bacteria 1189
48 Ga0070699_100025814 3300005518 Bacteria 5064
49 Ga0070679_100000429 3300005530 Bacteria 35685
50 Ga0070679_100038298 3300005530 Bacteria 4766
51 Ga0070684_100016594 3300005535 Bacteria 6022
52 Ga0070684_100503314 3300005535 Bacteria 1122
53 Ga0070697_100789556 3300005536 Bacteria 840
54 Ga0070672_101450829 3300005543 Unclassified 614
55 Ga0070686_100486845 3300005544 Bacteria 955
56 Ga0070695_100961478 3300005545 Unclassified 693
57 Ga0070695_101431388 3300005545 Bacteria 574
58 Ga0070695_101575034 3300005545 Unclassified 548
59 Ga0070696_101240906 3300005546 Bacteria 631
60 Ga0070696_101324221 3300005546 Bacteria 612
61 Ga0070696_101514417 3300005546 Bacteria 574
62 Ga0070704_100111750 3300005549 Bacteria 2080
63 Ga0070704_100321576 3300005549 Bacteria 1296
64 Ga0070704_100584197 3300005549 Bacteria 980
65 Ga0070704_100666033 3300005549 Unclassified 920
66 Ga0068855_101085844 3300005563 Unclassified 837
67 Ga0070664_101588817 3300005564 Bacteria 619
68 Ga0068857_100673111 3300005577 Bacteria 982
69 Ga0068857_100856223 3300005577 Bacteria 870
70 Ga0068856_100082901 3300005614 Bacteria 3183
71 Ga0068859_100130575 3300005617 Bacteria 2583
72 Ga0068859_100781219 3300005617 Bacteria 1043
73 Ga0068864_100262326 3300005618 Bacteria 1607
74 Ga0068861_100116201 3300005719 Bacteria 2151
75 Ga0068863_101384011 3300005841 Unclassified 711
76 Ga0068858_100615570 3300005842 Bacteria 1054
77 Ga0068862_100216651 3300005844 Bacteria 1732
78 Ga0068862_100730378 3300005844 Unclassified 962
79 Ga0081455_10868504 3300005937 Bacteria 562
80 Ga0070717_10113782 3300006028 Bacteria 2311
81 Ga0097621_100562266 3300006237 Unclassified 1039
82 Ga0075428_100021200 3300006844 Bacteria 7196
83 Ga0075430_100042912 3300006846 Bacteria 3824
84 Ga0075431_100216418 3300006847 Unclassified 1955
85 Ga0075431_100326358 3300006847 Bacteria 1547
86 Ga0075433_10020193 3300006852 Archaea 5565
87 Ga0075433_10040364 3300006852 Bacteria 4039
88 Ga0075433_10477549 3300006852 Bacteria 1098
89 Ga0075434_100001099 3300006871 Bacteria 22171
90 Ga0075434_100139906 3300006871 Bacteria 2440
91 Ga0075434_100223034 3300006871 Bacteria 1905
92 Ga0075429_100004530 3300006880 Bacteria 11948
93 Ga0075429_100932432 3300006880 Unclassified 760
94 Ga0075436_100440446 3300006914 Bacteria 948
95 Ga0097620_100130583 3300006931 Bacteria 2583
96 Ga0097620_100781152 3300006931 Bacteria 1043
97 Ga0075435_100044701 3300007076 Bacteria 3548
98 Ga0105240_11645600 3300009093 Unclassified 671
99 Ga0111539_10084299 3300009094 Bacteria 3737
100 Ga0111539_10226960 3300009094 Bacteria 2175
101 Ga0111539_10457017 3300009094 Unclassified 1487
102 Ga0114129_10027363 3300009147 Bacteria 8074
103 Ga0114129_10430482 3300009147 Bacteria 1734
104 Ga0114129_11294562 3300009147 Bacteria 904
105 Ga0105243_11172783 3300009148 Unclassified 780
106 Ga0105241_11040248 3300009174 Bacteria 768
107 Ga0105248_10097915 3300009177 Bacteria 3305
108 Ga0105237_11248612 3300009545 Bacteria 749
109 Ga0105249_10924858 3300009553 Bacteria 939
110 Ga0105239_10970414 3300010375 Unclassified 977
111 Ga0157370_10335952 3300013104 Bacteria 1393
112 Ga0157370_10751704 3300013104 Bacteria 888
113 Ga0157369_10190949 3300013105 Bacteria 2152
114 Ga0157369_10287986 3300013105 Bacteria 1710
115 Ga0157369_10524084 3300013105 Unclassified 1226
116 Ga0157369_12011230 3300013105 Unclassified 586
117 Ga0157378_10223808 3300013297 Bacteria 1790
118 Ga0163162_10559275 3300013306 Bacteria 1272
119 Ga0163162_10760194 3300013306 Bacteria 1088
120 Ga0157372_10606506 3300013307 Bacteria 1276
121 Ga0163163_12183104 3300014325 Bacteria 613
122 Ga0157379_10313842 3300014968 Bacteria 1430
123 Ga0207699_11016193 3300025906 Bacteria 613
124 Ga0207645_10198209 3300025907 Bacteria 1320
125 Ga0207684_10021555 3300025910 Bacteria 5502
126 Ga0207684_10201073 3300025910 Bacteria 1719
127 Ga0207684_11602330 3300025910 Bacteria 527
128 Ga0207707_10002002 3300025912 Bacteria 18504
129 Ga0207671_10992216 3300025914 Unclassified 662
130 Ga0207662_10009512 3300025918 Bacteria 5353
131 Ga0207652_10005112 3300025921 Bacteria 10648
132 Ga0207652_10029300 3300025921 Bacteria 4602
133 Ga0207646_10259069 3300025922 Bacteria 1572
134 Ga0207646_10337227 3300025922 Unclassified 1362
135 Ga0207646_10400926 3300025922 Bacteria 1239
136 Ga0207646_10605721 3300025922 Unclassified 983
137 Ga0207650_11041127 3300025925 Bacteria 696
138 Ga0207664_10016004 3300025929 Bacteria 5462
139 Ga0207706_10054295 3300025933 Bacteria 3536
140 Ga0207670_10000049 3300025936 Bacteria 89464
141 Ga0207670_10552985 3300025936 Bacteria 941
142 Ga0207711_10489952 3300025941 Unclassified 1145
143 Ga0207661_10038351 3300025944 Bacteria 3755
144 Ga0207661_10056099 3300025944 Bacteria 3162
145 Ga0207651_10261525 3300025960 Bacteria 1421
146 Ga0207712_10182890 3300025961 Unclassified 1648
147 Ga0207708_10492138 3300026075 Bacteria 1027
148 Ga0207702_10213973 3300026078 Bacteria 1793
149 Ga0207641_10138049 3300026088 Bacteria 2196
150 Ga0207676_10145664 3300026095 Bacteria 2034
151 Ga0207676_11742908 3300026095 Unclassified 621
152 Ga0207674_10340288 3300026116 Bacteria 1450
153 Ga0207675_100081981 3300026118 Bacteria 3025
154 Ga0209968_1006509 3300027526 Unclassified 1759
155 Ga0209999_1001351 3300027543 Unclassified 4209
156 Ga0209970_1002973 3300027614 Unclassified 2862
157 Ga0209983_1000004 3300027665 Bacteria 26935
158 Ga0209971_1001137 3300027682 Bacteria 6734
159 Ga0209974_10001509 3300027876 Bacteria 8452
160 Ga0207428_10562925 3300027907 Unclassified 824
161 Ga0268265_10189461 3300028380 Bacteria 1775
162 Ga0268265_10884485 3300028380 Bacteria 876
163 Ga0268264_11101156 3300028381 Bacteria 803
164 Ga0307408_100172306 3300031548 Bacteria 1729
165 Ga0307408_100470595 3300031548 Bacteria 1094
166 Ga0265313_10051547 3300031595 Unclassified 1969
167 Ga0316576_10009728 3300031727 Bacteria 6220
168 Ga0307405_10015011 3300031731 Bacteria 4181
169 Ga0307405_10150976 3300031731 Unclassified 1633
170 Ga0316577_10038089 3300031733 Unclassified 2688
171 Ga0316577_10585180 3300031733 Bacteria 635
172 Ga0307413_10018517 3300031824 Bacteria 3657
173 Ga0307413_10129130 3300031824 Unclassified 1726
174 Ga0307410_10226101 3300031852 Bacteria 1442
175 Ga0307406_10093700 3300031901 Bacteria 2028
176 Ga0307406_10122882 3300031901 Bacteria 1808
177 Ga0307407_10330105 3300031903 Bacteria 1073
178 Ga0307407_10360209 3300031903 Unclassified 1032
179 Ga0307407_11067454 3300031903 Bacteria 627
180 Ga0307412_10389233 3300031911 Unclassified 1131
181 Ga0307412_10439342 3300031911 Bacteria 1072
182 Ga0307409_100002535 3300031995 Bacteria 9578
183 Ga0307409_100452482 3300031995 Bacteria 1239
184 Ga0307409_101771630 3300031995 Unclassified 647
185 Ga0307416_100004835 3300032002 Bacteria 8195
186 Ga0307416_100522347 3300032002 Bacteria 1256
187 Ga0307416_100592086 3300032002 Bacteria 1188
188 Ga0307416_100753536 3300032002 Unclassified 1066
189 Ga0307416_101038430 3300032002 Bacteria 923
190 Ga0307414_11011065 3300032004 Unclassified 765
191 Ga0307411_10483256 3300032005 Unclassified 1043
192 Ga0307411_11086134 3300032005 Bacteria 720
193 Ga0307411_12072452 3300032005 Unclassified 532
194 Ga0307415_100147149 3300032126 Bacteria 1808
195 Ga0316585_10264591 3300032137 Bacteria 570
196 Ga0373934_0184692 3300035086 Unclassified 857
197 Ga0373931_0504775 3300035691 Bacteria 781
198 Ga0373937_0022822 3300036401 Bacteria 5630
199 Ga0316582_0722541 3300036647 Unclassified 684
200 Ga0316582_0913926 3300036647 Bacteria 600
201 Ga0439461_0031099 3300041410 Bacteria 1113
202 Ga0450923_048143 3300042125 Unclassified 911
203 Ga0450898_133830 3300042134 Unclassified 535
204 Ga0439446_0145462 3300042156 Bacteria 776
205 Ga0451577_0070100 3300042876 Unclassified 3127
206 Ga0451577_0748153 3300042876 Bacteria 884
207 Ga0453683_0006972 3300044673 Bacteria 7706
208 Ga0453683_0996423 3300044673 Bacteria 556
209 Ga0453684_0930669 3300044712 Bacteria 929
210 Ga0451576_0085971 3300045051 Unclassified 3271
211 Ga0451576_0361674 3300045051 Bacteria 1520
212 Ga0451576_1389122 3300045051 Unclassified 731
213 Ga0451576_1390176 3300045051 Bacteria 730
214 Ga0466967_0040063 3300045976 Bacteria 4032
215 Ga0466967_0074219 3300045976 Bacteria 3054
216 Ga0495629_0312919 3300046459 Bacteria 1074
217 Ga0495580_0302930 3300046472 Unclassified 1088
218 Ga0495667_0960518 3300046559 Bacteria 522
219 Ga0495635_0485799 3300046663 Bacteria 814
220 Ga0495657_0240191 3300046675 Bacteria 1093
221 Ga0495636_0120679 3300047318 Bacteria 1159
222 Ga0496104_1202669 3300048907 Bacteria 661
223 Ga0496107_0606677 3300048910 Bacteria 809
224 Ga0496112_1514008 3300048915 Bacteria 585
225 Ga0501298_195641 3300049521 Bacteria 511
226 Ga0501038_0224871 3300049574 Bacteria 1496
227 Ga0501046_0294637 3300049580 Archaea 1186
228 Ga0501048_0413043 3300049582 Archaea 965
229 Ga0501067_0488342 3300049583 Bacteria 689
230 Ga0501070_0272009 3300049586 Bacteria 1383
231 Ga0501073_0178444 3300049589 Bacteria 1470
232 Ga0501074_0053276 3300049590 Bacteria 2919
233 Ga0501075_0095433 3300049591 Unclassified 2257
234 Ga0501075_1115725 3300049591 Bacteria 599
235 Ga0501077_0686507 3300049593 Bacteria 658
236 Ga0501201_009937 3300049651 Bacteria 929
237 Ga0501209_226399 3300049656 Bacteria 580
238 Ga0501216_005536 3300049660 Bacteria 1909
239 Ga0501217_014005 3300049661 Bacteria 1806
240 Ga0501227_022321 3300049665 Bacteria 1464
241 Ga0501235_000030 3300049669 Bacteria 24020
242 Ga0501242_001038 3300049674 Bacteria 2693
243 Ga0501249_001106 3300049679 Bacteria 5697
244 Ga0501260_006903 3300049689 Bacteria 1100
245 Ga0501221_002071 3300049704 Bacteria 3342
246 Ga0501225_0002004 3300049705 Bacteria 6341
247 Ga0501234_038470 3300049707 Bacteria 780
248 Ga0501245_068633 3300049708 Bacteria 663
249 Ga0501079_0117519 3300049741 Bacteria 2067
250 Ga0501079_0627775 3300049741 Unclassified 846
251 Ga0501080_0106553 3300049742 Unclassified 2598
252 Ga0501081_0049865 3300049743 Unclassified 2884
253 Ga0501081_0250579 3300049743 Archaea 1293
254 Ga0501232_008348 3300049757 Bacteria 1117
255 Ga0501268_003260 3300049765 Bacteria 2207
256 Ga0501035_0445573 3300049822 Bacteria 1072
257 Ga0501035_0726866 3300049822 Archaea 799
258 Ga0501044_0245748 3300049823 Bacteria 1732
259 Ga0501045_1163069 3300049824 Unclassified 563
260 Ga0501212_001837 3300049851 Bacteria 2466
261 nmdc:mga05p37_138196_c1 3300050507 Bacteria 2987
262 nmdc:mga05p37_47882_c1 3300050507 Bacteria 5257
263 nmdc:mga09592_1042_c1 3300050508 Bacteria 21993
264 nmdc:mga09592_15304_c1 3300050508 Bacteria 6266
265 nmdc:mga09592_215193_c1 3300050508 Bacteria 1665
266 nmdc:mga0qj67_330681_c1 3300050509 Unclassified 1233
267 nmdc:mga06r32_334706_c1 3300050510 Bacteria 1499
268 nmdc:mga06r32_343424_c1 3300050510 Bacteria 1477
269 nmdc:mga08y16_1175777_c1 3300050511 Bacteria 739
270 nmdc:mga08y16_321554_c1 3300050511 Bacteria 1593
271 nmdc:mga08y16_63885_c1 3300050511 Bacteria 3845
272 nmdc:mga0n895_27964_c1 3300050512 Bacteria 5359
273 nmdc:mga0n895_4310_c1 3300050512 Bacteria 11655
274 nmdc:mga0n895_88906_c1 3300050512 Bacteria 3089
275 nmdc:mga0rr50_48991_c1 3300050513 Bacteria 3126
276 nmdc:mga08x19_221991_c1 3300050514 Bacteria 1298
277 nmdc:mga0a205_3275_c1 3300050515 Bacteria 14405
278 nmdc:mga0a205_395426_c1 3300050515 Bacteria 1246
279 nmdc:mga0a205_553370_c1 3300050515 Bacteria 1005
280 nmdc:mga0a205_8956_c1 3300050515 Bacteria 9123
281 Ga0495612_0255027 3300053078 Bacteria 781
282 Ga0501084_0125889 3300054114 Bacteria 2156
283 Ga0501082_0148739 3300060353 Bacteria 2034
284 Ga0530510_0529999 3300061734 Unclassified 894
285 Ga0111539_11538168
286 MBSR1b_contig_1236219
287 Ga0065715_10251610
288 Ga0065707_10023087
289 Ga0070683_100073807
290 Ga0070683_100264737
291 Ga0070690_100388653
292 Ga0070690_100511363
293 Ga0068869_100716818
294 Ga0070680_100000415
295 Ga0070689_100000666
296 Ga0070689_100001844
297 Ga0070689_100985478
298 Ga0070687_100021031
299 Ga0070692_10077608
300 Ga0070675_101119146
301 Ga0070673_100299441
302 Ga0070688_100000967
303 Ga0070688_100006207
304 Ga0070688_100215014
305 Ga0070709_10974346
306 Ga0070714_100009775
307 Ga0070714_100051021
308 Ga0070713_100023843
309 Ga0070701_10315848
310 Ga0070705_100695909
311 Ga0070705_100796101
312 Ga0070700_100151451
313 Ga0070700_100467363
314 Ga0070700_101848887
315 Ga0070694_100602539
316 Ga0070708_100001640
317 Ga0070708_100007796
318 Ga0070708_100727968
319 Ga0070708_101866861
320 Ga0070663_100845354
321 Ga0070662_100028184
322 Ga0070681_10001210
323 Ga0070681_10014764
324 Ga0070685_10022174
325 Ga0070706_100029466
326 Ga0070706_101339174
327 Ga0070707_100297693
328 Ga0070707_100457130
329 Ga0070707_100617848
330 Ga0070707_100704342
331 Ga0070698_100473549
332 Ga0070699_100025814
333 Ga0070679_100000429
334 Ga0070679_100038298
335 Ga0070684_100016594
336 Ga0070684_100503314
337 Ga0070697_100789556
338 Ga0070672_101450829
339 Ga0070686_100486845
340 Ga0070695_100961478
341 Ga0070695_101431388
342 Ga0070695_101575034
343 Ga0070696_101240906
344 Ga0070696_101324221
345 Ga0070696_101514417
346 Ga0070704_100111750
347 Ga0070704_100321576
348 Ga0070704_100584197
349 Ga0070704_100666033
350 Ga0068855_101085844
351 Ga0070664_101588817
352 Ga0068857_100673111
353 Ga0068857_100856223
354 Ga0068856_100082901
355 Ga0068859_100130575
356 Ga0068859_100781219
357 Ga0068864_100262326
358 Ga0068861_100116201
359 Ga0068863_101384011
360 Ga0068858_100615570
361 Ga0068862_100216651
362 Ga0068862_100730378
363 Ga0081455_10868504
364 Ga0070717_10113782
365 Ga0097621_100562266
366 Ga0075428_100021200
367 Ga0075430_100042912
368 Ga0075431_100216418
369 Ga0075431_100326358
370 Ga0075433_10020193
371 Ga0075433_10040364
372 Ga0075433_10477549
373 Ga0075434_100001099
374 Ga0075434_100139906
375 Ga0075434_100223034
376 Ga0075429_100004530
377 Ga0075429_100932432
378 Ga0075436_100440446
379 Ga0097620_100130583
380 Ga0097620_100781152
381 Ga0075435_100044701
382 Ga0105240_11645600
383 Ga0111539_10084299
384 Ga0111539_10226960
385 Ga0111539_10457017
386 Ga0114129_10027363
387 Ga0114129_10430482
388 Ga0114129_11294562
389 Ga0105243_11172783
390 Ga0105241_11040248
391 Ga0105248_10097915
392 Ga0105237_11248612
393 Ga0105249_10924858
394 Ga0105239_10970414
395 Ga0157370_10335952
396 Ga0157370_10751704
397 Ga0157369_10190949
398 Ga0157369_10287986
399 Ga0157369_10524084
400 Ga0157369_12011230
401 Ga0157378_10223808
402 Ga0163162_10559275
403 Ga0163162_10760194
404 Ga0157372_10606506
405 Ga0163163_12183104
406 Ga0157379_10313842
407 Ga0207699_11016193
408 Ga0207645_10198209
409 Ga0207684_10021555
410 Ga0207684_10201073
411 Ga0207684_11602330
412 Ga0207707_10002002
413 Ga0207671_10992216
414 Ga0207662_10009512
415 Ga0207652_10005112
416 Ga0207652_10029300
417 Ga0207646_10259069
418 Ga0207646_10337227
419 Ga0207646_10400926
420 Ga0207646_10605721
421 Ga0207650_11041127
422 Ga0207664_10016004
423 Ga0207706_10054295
424 Ga0207670_10000049
425 Ga0207670_10552985
426 Ga0207711_10489952
427 Ga0207661_10038351
428 Ga0207661_10056099
429 Ga0207651_10261525
430 Ga0207712_10182890
431 Ga0207708_10492138
432 Ga0207702_10213973
433 Ga0207641_10138049
434 Ga0207676_10145664
435 Ga0207676_11742908
436 Ga0207674_10340288
437 Ga0207675_100081981
438 Ga0209968_1006509
439 Ga0209999_1001351
440 Ga0209970_1002973
441 Ga0209983_1000004
442 Ga0209971_1001137
443 Ga0209974_10001509
444 Ga0207428_10562925
445 Ga0268265_10189461
446 Ga0268265_10884485
447 Ga0268264_11101156
448 Ga0307408_100172306
449 Ga0307408_100470595
450 Ga0265313_10051547
451 Ga0316576_10009728
452 Ga0307405_10015011
453 Ga0307405_10150976
454 Ga0316577_10038089
455 Ga0316577_10585180
456 Ga0307413_10018517
457 Ga0307413_10129130
458 Ga0307410_10226101
459 Ga0307406_10093700
460 Ga0307406_10122882
461 Ga0307407_10330105
462 Ga0307407_10360209
463 Ga0307407_11067454
464 Ga0307412_10389233
465 Ga0307412_10439342
466 Ga0307409_100002535
467 Ga0307409_100452482
468 Ga0307409_101771630
469 Ga0307416_100004835
470 Ga0307416_100522347
471 Ga0307416_100592086
472 Ga0307416_100753536
473 Ga0307416_101038430
474 Ga0307414_11011065
475 Ga0307411_10483256
476 Ga0307411_11086134
477 Ga0307411_12072452
478 Ga0307415_100147149
479 Ga0316585_10264591
480 Ga0373934_0184692
481 Ga0373931_0504775
482 Ga0373937_0022822
483 Ga0316582_0722541
484 Ga0316582_0913926
485 Ga0439461_0031099
486 Ga0450923_048143
487 Ga0450898_133830
488 Ga0439446_0145462
489 Ga0451577_0070100
490 Ga0451577_0748153
491 Ga0453683_0006972
492 Ga0453683_0996423
493 Ga0453684_0930669
494 Ga0451576_0085971
495 Ga0451576_0361674
496 Ga0451576_1389122
497 Ga0451576_1390176
498 Ga0466967_0040063
499 Ga0466967_0074219
500 Ga0495629_0312919
501 Ga0495580_0302930
502 Ga0495667_0960518
503 Ga0495635_0485799
504 Ga0495657_0240191
505 Ga0495636_0120679
506 Ga0496104_1202669
507 Ga0496107_0606677
508 Ga0496112_1514008
509 Ga0501298_195641
510 Ga0501038_0224871
511 Ga0501046_0294637
512 Ga0501048_0413043
513 Ga0501067_0488342
514 Ga0501070_0272009
515 Ga0501073_0178444
516 Ga0501074_0053276
517 Ga0501075_0095433
518 Ga0501075_1115725
519 Ga0501077_0686507
520 Ga0501201_009937
521 Ga0501209_226399
522 Ga0501216_005536
523 Ga0501217_014005
524 Ga0501227_022321
525 Ga0501235_000030
526 Ga0501242_001038
527 Ga0501249_001106
528 Ga0501260_006903
529 Ga0501221_002071
530 Ga0501225_0002004
531 Ga0501234_038470
532 Ga0501245_068633
533 Ga0501079_0117519
534 Ga0501079_0627775
535 Ga0501080_0106553
536 Ga0501081_0049865
537 Ga0501081_0250579
538 Ga0501232_008348
539 Ga0501268_003260
540 Ga0501035_0445573
541 Ga0501035_0726866
542 Ga0501044_0245748
543 Ga0501045_1163069
544 Ga0501212_001837
545 nmdc:mga05p37_138196_c1
546 nmdc:mga05p37_47882_c1
547 nmdc:mga09592_1042_c1
548 nmdc:mga09592_15304_c1
549 nmdc:mga09592_215193_c1
550 nmdc:mga0qj67_330681_c1
551 nmdc:mga06r32_334706_c1
552 nmdc:mga06r32_343424_c1
553 nmdc:mga08y16_1175777_c1
554 nmdc:mga08y16_321554_c1
555 nmdc:mga08y16_63885_c1
556 nmdc:mga0n895_27964_c1
557 nmdc:mga0n895_4310_c1
558 nmdc:mga0n895_88906_c1
559 nmdc:mga0rr50_48991_c1
560 nmdc:mga08x19_221991_c1
561 nmdc:mga0a205_3275_c1
562 nmdc:mga0a205_395426_c1
563 nmdc:mga0a205_553370_c1
564 nmdc:mga0a205_8956_c1
565 Ga0495612_0255027
566 Ga0501084_0125889
567 Ga0501082_0148739
568 Ga0530510_0529999

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

28

144

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a6d-assembly1.cif.gz_A crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam 0.9192 8 55
3cuq-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.913 2 54
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8986 9 57
1wq2-assembly1.cif.gz_B neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.8937 8 54
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8932 2 56
ID Description Score Start End Superfamily
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9458 2 55 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9399 2 53 1.10.10.10
1sd4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9313 2 54 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9201 1 55 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8996 2 55 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A353B8A9-F1-model_v4 CopY family transcriptional regulator 0.9562 2 113 GO:0003677
GO:0045892
AF-A0A512MC04-F1-model_v4 BlaI family transcriptional regulator 0.9358 1 108 GO:0003677
GO:0045892
AF-A0A353B8A9-F1-model_v4 CopY family transcriptional regulator 0.9244 2 113 GO:0003677
GO:0045892
AF-A0A3A4ZEK7-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.922 1 112 GO:0003677
GO:0045892
AF-A0A838Q8M7-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9086 1 115 GO:0003677
GO:0045892

Map