F386158

General Info

Members Datasets Scaffolds Average Seq Length
284 190 568 135

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10649775|Ga0111539_106497751
Length 162
Sequence MHPLFQKASGLTETIIAAAIEVHRDKGPGLIESIYEWCLLKELGLRGLACVSQRSVLIEYKGFYREEPLRFDLLVDGCVIVEAKAVEKVLPIHKAKLLSYMKLLEVPLGLLINFHELKVTDGISRLILPGANLRKLVEEIQHEQTERTEGKIRISVLSVSSC

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
132 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
133 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
152 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 1.76
Rhizosphere 96.13
Stem 0
Stem Tuber 0
Unclassified 32.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10649775 3300009094 Bacteria 1228
2 SwRhRL3b_contig_911665 2162886006 Unclassified 896
3 rootH2_10240254 3300003320 Bacteria 1211
4 rootL2_10251124 3300003322 Eukaryota 1168
5 rootH1_10066693 3300003323 Bacteria 4037
6 Ga0065715_10017115 3300005293 Bacteria 1850
7 Ga0065707_10082911 3300005295 Bacteria 11457
8 Ga0065707_10322303 3300005295 Unclassified 964
9 Ga0065707_10369666 3300005295 Bacteria 892
10 Ga0070658_10213594 3300005327 Unclassified 1630
11 Ga0070690_100001510 3300005330 Bacteria 12195
12 Ga0070690_100118870 3300005330 Bacteria 1772
13 Ga0068869_100000006 3300005334 Bacteria 87287
14 Ga0068869_100012723 3300005334 Bacteria 5565
15 Ga0070680_100490675 3300005336 Bacteria 1050
16 Ga0070682_100046941 3300005337 Bacteria 2683
17 Ga0068868_100044556 3300005338 Bacteria 3468
18 Ga0068868_100692317 3300005338 Unclassified 911
19 Ga0070689_100000617 3300005340 Bacteria 21575
20 Ga0070689_100074059 3300005340 Bacteria 2664
21 Ga0070689_100726807 3300005340 Unclassified 869
22 Ga0070689_101848561 3300005340 Unclassified 551
23 Ga0070691_10776661 3300005341 Unclassified 581
24 Ga0070692_10089782 3300005345 Bacteria 1668
25 Ga0070669_100547480 3300005353 Unclassified 964
26 Ga0070669_100856874 3300005353 Bacteria 774
27 Ga0070675_100466183 3300005354 Unclassified 1134
28 Ga0070671_100302744 3300005355 Unclassified 1361
29 Ga0070674_101029090 3300005356 Bacteria 724
30 Ga0070688_100088960 3300005365 Unclassified 2014
31 Ga0070688_100417072 3300005365 Bacteria 997
32 Ga0070688_100447168 3300005365 Unclassified 965
33 Ga0070659_100292445 3300005366 Unclassified 1357
34 Ga0070667_101722227 3300005367 Bacteria 590
35 Ga0070709_10537800 3300005434 Unclassified 892
36 Ga0070709_10996653 3300005434 Unclassified 666
37 Ga0070714_101110808 3300005435 Unclassified 770
38 Ga0070701_10137105 3300005438 Bacteria 1395
39 Ga0070711_101148235 3300005439 Unclassified 670
40 Ga0070705_100155501 3300005440 Unclassified 1522
41 Ga0070705_100239772 3300005440 Bacteria 1267
42 Ga0070705_101161231 3300005440 Unclassified 634
43 Ga0070700_100006063 3300005441 Bacteria 6436
44 Ga0070694_100274352 3300005444 Bacteria 1283
45 Ga0070678_100081188 3300005456 Bacteria 2457
46 Ga0070678_100383619 3300005456 Bacteria 1216
47 Ga0070681_10022804 3300005458 Bacteria 6292
48 Ga0068867_100001137 3300005459 Bacteria 18183
49 Ga0068867_100018064 3300005459 Bacteria 5012
50 Ga0070697_100055506 3300005536 Bacteria 3220
51 Ga0070697_100439354 3300005536 Unclassified 1135
52 Ga0070697_100870196 3300005536 Bacteria 799
53 Ga0068853_100005216 3300005539 Bacteria 10166
54 Ga0070672_100420228 3300005543 Bacteria 1148
55 Ga0070686_101013582 3300005544 Bacteria 681
56 Ga0070695_100378514 3300005545 Bacteria 1067
57 Ga0070696_100033217 3300005546 Bacteria 3543
58 Ga0070696_100565981 3300005546 Unclassified 912
59 Ga0070693_100185989 3300005547 Bacteria 1340
60 Ga0070665_100760816 3300005548 Unclassified 982
61 Ga0070704_100125076 3300005549 Bacteria 1982
62 Ga0070704_100585268 3300005549 Bacteria 979
63 Ga0068857_100004877 3300005577 Bacteria 11383
64 Ga0068857_100837400 3300005577 Unclassified 880
65 Ga0068856_100590402 3300005614 Unclassified 1132
66 Ga0070702_101007976 3300005615 Bacteria 659
67 Ga0068859_100019942 3300005617 Bacteria 6731
68 Ga0068859_100374825 3300005617 Bacteria 1519
69 Ga0068864_100678289 3300005618 Unclassified 1005
70 Ga0068864_100898481 3300005618 Bacteria 875
71 Ga0068864_101405919 3300005618 Unclassified 700
72 Ga0068866_10069235 3300005718 Bacteria 1858
73 Ga0068866_10652451 3300005718 Unclassified 717
74 Ga0068861_100027066 3300005719 Bacteria 4173
75 Ga0068870_10026887 3300005840 Bacteria 2873
76 Ga0068863_100008064 3300005841 Bacteria 10285
77 Ga0068858_100495963 3300005842 Bacteria 1179
78 Ga0068860_100268223 3300005843 Unclassified 1665
79 Ga0068862_100275786 3300005844 Bacteria 1539
80 Ga0081455_10009798 3300005937 Bacteria 9812
81 Ga0081540_1051559 3300005983 Bacteria 2033
82 Ga0070717_10547652 3300006028 Unclassified 1048
83 Ga0070715_10373792 3300006163 Unclassified 785
84 Ga0070716_100398077 3300006173 Bacteria 989
85 Ga0097621_100004751 3300006237 Bacteria 9501
86 Ga0097621_100027871 3300006237 Bacteria 4447
87 Ga0097621_100549925 3300006237 Bacteria 1051
88 Ga0097621_100970411 3300006237 Bacteria 794
89 Ga0068871_100010087 3300006358 Bacteria 6873
90 Ga0068871_100119291 3300006358 Bacteria 2226
91 Ga0068871_100640766 3300006358 Bacteria 969
92 Ga0068871_101663157 3300006358 Unclassified 605
93 Ga0075431_100129631 3300006847 Unclassified 2602
94 Ga0075433_10506235 3300006852 Bacteria 1063
95 Ga0075434_100426399 3300006871 Unclassified 1347
96 Ga0075434_101279030 3300006871 Unclassified 745
97 Ga0068865_100006518 3300006881 Bacteria 7129
98 Ga0068865_100018286 3300006881 Bacteria 4521
99 Ga0075436_100672763 3300006914 Unclassified 766
100 Ga0097620_100019942 3300006931 Bacteria 6731
101 Ga0097620_100374821 3300006931 Bacteria 1519
102 Ga0099794_10496797 3300007265 Unclassified 642
103 Ga0099795_10230189 3300007788 Bacteria 792
104 Ga0099795_10296234 3300007788 Unclassified 710
105 Ga0105240_10238404 3300009093 Bacteria 2110
106 Ga0111539_10068846 3300009094 Unclassified 4178
107 Ga0111539_11100707 3300009094 Bacteria 923
108 Ga0105245_10052807 3300009098 Bacteria 3646
109 Ga0105245_10269004 3300009098 Bacteria 1662
110 Ga0105245_11130691 3300009098 Bacteria 830
111 Ga0114129_10622283 3300009147 Unclassified 1396
112 Ga0105243_10010469 3300009148 Bacteria 7043
113 Ga0105243_10127302 3300009148 Bacteria 2157
114 Ga0105243_12221736 3300009148 Unclassified 585
115 Ga0105241_11672934 3300009174 Unclassified 618
116 Ga0105242_10040502 3300009176 Bacteria 3754
117 Ga0105242_10544878 3300009176 Bacteria 1111
118 Ga0105242_11050966 3300009176 Bacteria 825
119 Ga0105242_11142419 3300009176 Bacteria 795
120 Ga0105242_11493268 3300009176 Unclassified 706
121 Ga0105242_13014911 3300009176 Unclassified 521
122 Ga0105248_10458608 3300009177 Bacteria 1437
123 Ga0105248_11910435 3300009177 Bacteria 674
124 Ga0105248_12517599 3300009177 Bacteria 586
125 Ga0105238_10877188 3300009551 Unclassified 915
126 Ga0105249_10264034 3300009553 Bacteria 1712
127 Ga0099796_10234063 3300010159 Unclassified 757
128 Ga0105246_10420970 3300011119 Bacteria 1115
129 Ga0157370_11626942 3300013104 Bacteria 580
130 Ga0157374_10356478 3300013296 Unclassified 1454
131 Ga0157378_10881329 3300013297 Unclassified 925
132 Ga0157378_11019152 3300013297 Unclassified 863
133 Ga0157378_11177144 3300013297 Bacteria 805
134 Ga0163162_10231365 3300013306 Bacteria 1979
135 Ga0157372_10032248 3300013307 Bacteria 5743
136 Ga0157375_10077129 3300013308 Bacteria 3361
137 Ga0157375_10178237 3300013308 Bacteria 2276
138 Ga0157375_10908401 3300013308 Unclassified 1024
139 Ga0157375_12345756 3300013308 Unclassified 636
140 Ga0163163_10112936 3300014325 Unclassified 2746
141 Ga0157380_10686355 3300014326 Bacteria 1027
142 Ga0157377_10477205 3300014745 Unclassified 867
143 Ga0157379_10082440 3300014968 Bacteria 2882
144 Ga0157376_10112652 3300014969 Bacteria 2397
145 Ga0157376_10305655 3300014969 Bacteria 1507
146 Ga0157376_10632778 3300014969 Bacteria 1068
147 Ga0157376_12272806 3300014969 Unclassified 581
148 Ga0207642_10148620 3300025899 Bacteria 1244
149 Ga0207699_10126452 3300025906 Bacteria 1660
150 Ga0207645_10012001 3300025907 Bacteria 5891
151 Ga0207643_10008172 3300025908 Bacteria 5616
152 Ga0207705_10393634 3300025909 Unclassified 1071
153 Ga0207684_10725331 3300025910 Unclassified 843
154 Ga0207707_10119903 3300025912 Unclassified 2299
155 Ga0207695_11062165 3300025913 Unclassified 689
156 Ga0207693_10078296 3300025915 Bacteria 2588
157 Ga0207660_10185995 3300025917 Bacteria 1616
158 Ga0207646_10506490 3300025922 Unclassified 1087
159 Ga0207646_11757428 3300025922 Unclassified 531
160 Ga0207681_10317557 3300025923 Bacteria 1238
161 Ga0207681_10570226 3300025923 Unclassified 933
162 Ga0207694_10733667 3300025924 Unclassified 834
163 Ga0207659_10856561 3300025926 Unclassified 781
164 Ga0207687_10175175 3300025927 Bacteria 1658
165 Ga0207687_10222329 3300025927 Bacteria 1487
166 Ga0207664_10699636 3300025929 Unclassified 911
167 Ga0207686_10003285 3300025934 Bacteria 8691
168 Ga0207686_10074106 3300025934 Bacteria 2199
169 Ga0207686_10836170 3300025934 Unclassified 740
170 Ga0207709_10046527 3300025935 Bacteria 2634
171 Ga0207709_10341230 3300025935 Unclassified 1127
172 Ga0207670_10003247 3300025936 Bacteria 8620
173 Ga0207670_10879860 3300025936 Unclassified 749
174 Ga0207669_11649616 3300025937 Unclassified 547
175 Ga0207704_10016817 3300025938 Bacteria 3771
176 Ga0207704_10749255 3300025938 Bacteria 812
177 Ga0207691_10486470 3300025940 Bacteria 1049
178 Ga0207689_10000034 3300025942 Bacteria 95262
179 Ga0207689_10006401 3300025942 Bacteria 10420
180 Ga0207689_11179543 3300025942 Unclassified 645
181 Ga0207651_11890504 3300025960 Bacteria 537
182 Ga0207712_10313973 3300025961 Bacteria 1291
183 Ga0207668_10709137 3300025972 Unclassified 885
184 Ga0207658_11427581 3300025986 Bacteria 633
185 Ga0207677_10015593 3300026023 Bacteria 4476
186 Ga0207677_11146340 3300026023 Bacteria 710
187 Ga0207703_10256370 3300026035 Bacteria 1579
188 Ga0207639_10018634 3300026041 Bacteria 4937
189 Ga0207708_10007488 3300026075 Bacteria 8069
190 Ga0207641_10012809 3300026088 Bacteria 6875
191 Ga0207648_10002672 3300026089 Bacteria 18989
192 Ga0207648_10047377 3300026089 Bacteria 3768
193 Ga0207648_10194924 3300026089 Bacteria 1796
194 Ga0207676_11347355 3300026095 Unclassified 709
195 Ga0207674_10110676 3300026116 Bacteria 2721
196 Ga0207674_11313328 3300026116 Unclassified 693
197 Ga0207675_100037439 3300026118 Bacteria 4525
198 Ga0207683_10116454 3300026121 Bacteria 2396
199 Ga0207683_10485732 3300026121 Bacteria 1140
200 Ga0268266_10747627 3300028379 Unclassified 944
201 Ga0268264_11081530 3300028381 Bacteria 810
202 Ga0265337_1001121 3300028556 Bacteria 13705
203 Ga0265337_1005074 3300028556 Bacteria 5313
204 Ga0265323_10001410 3300028653 Bacteria 11829
205 Ga0265322_10076549 3300028654 Unclassified 949
206 Ga0265336_10000399 3300028666 Bacteria 27286
207 Ga0265336_10003491 3300028666 Bacteria 6151
208 Ga0265338_10121364 3300028800 Bacteria 2082
209 Ga0265338_10305683 3300028800 Unclassified 1155
210 Ga0265338_10556360 3300028800 Unclassified 802
211 Ga0265330_10212429 3300031235 Unclassified 817
212 Ga0265320_10001098 3300031240 Bacteria 19983
213 Ga0265320_10039742 3300031240 Unclassified 2350
214 Ga0265340_10053090 3300031247 Bacteria 1958
215 Ga0265331_10003331 3300031250 Bacteria 10424
216 Ga0265327_10020356 3300031251 Bacteria 4046
217 Ga0265316_10018641 3300031344 Bacteria 5961
218 Ga0265314_10184937 3300031711 Unclassified 1245
219 Ga0307416_102894875 3300032002 Unclassified 574
220 Ga0373923_0593836 3300035111 Unclassified 545
221 Ga0373954_0008798 3300035118 Bacteria 4441
222 Ga0373955_0133315 3300035172 Bacteria 1452
223 Ga0373933_0080384 3300035724 Unclassified 1998
224 Ga0373947_0027791 3300035725 Bacteria 3313
225 Ga0373937_0157358 3300036401 Bacteria 2130
226 Ga0373937_0163094 3300036401 Bacteria 2090
227 Ga0395905_0573891 3300037471 Bacteria 1029
228 Ga0451839_1310534 3300041496 Unclassified 538
229 Ga0451849_0425163 3300041505 Unclassified 556
230 Ga0451577_0161229 3300042876 Unclassified 2019
231 Ga0451577_1282093 3300042876 Bacteria 652
232 Ga0453683_0000400 3300044673 Bacteria 51192
233 Ga0466961_0737861 3300044693 Unclassified 589
234 Ga0453684_0012877 3300044712 Bacteria 13702
235 Ga0453684_0062192 3300044712 Bacteria 4784
236 Ga0453684_0176477 3300044712 Unclassified 2512
237 Ga0453684_0793552 3300044712 Bacteria 1022
238 Ga0466957_0245522 3300044842 Bacteria 1189
239 Ga0451576_0049725 3300045051 Bacteria 4400
240 Ga0451576_0095835 3300045051 Bacteria 3086
241 Ga0451576_0242239 3300045051 Bacteria 1884
242 Ga0451576_0642977 3300045051 Bacteria 1114
243 Ga0495592_0000045 3300046454 Bacteria 118163
244 Ga0495629_0117073 3300046459 Bacteria 1857
245 Ga0495662_0001928 3300046476 Bacteria 10416
246 Ga0495664_0048778 3300046477 Bacteria 2514
247 Ga0495618_0046186 3300046514 Bacteria 2748
248 Ga0495618_0051527 3300046514 Bacteria 2600
249 Ga0495628_0000028 3300046516 Bacteria 126332
250 Ga0495630_0001948 3300046517 Bacteria 14358
251 Ga0495630_0010881 3300046517 Bacteria 6570
252 Ga0495630_0209464 3300046517 Bacteria 1488
253 Ga0495666_0005977 3300046526 Bacteria 6134
254 Ga0495652_0038382 3300046529 Bacteria 4150
255 Ga0495665_0623767 3300046531 Bacteria 538
256 Ga0495640_0476475 3300046533 Unclassified 761
257 Ga0495586_0000340 3300046535 Bacteria 29309
258 Ga0495586_0015334 3300046535 Bacteria 4077
259 Ga0495645_0003694 3300046543 Bacteria 10402
260 Ga0495645_0144416 3300046543 Bacteria 1657
261 Ga0495634_0003233 3300046642 Bacteria 13162
262 Ga0495635_0068559 3300046663 Bacteria 2433
263 Ga0495635_0365705 3300046663 Bacteria 961
264 Ga0495599_0002634 3300046678 Bacteria 10460
265 Ga0495613_0001312 3300046689 Bacteria 18985
266 Ga0495613_0211560 3300046689 Bacteria 1364
267 Ga0495613_0537034 3300046689 Unclassified 784
268 Ga0495581_0889321 3300047315 Unclassified 509
269 Ga0495674_0030724 3300047319 Bacteria 4882
270 Ga0495674_0224189 3300047319 Bacteria 1553
271 Ga0495674_0526284 3300047319 Bacteria 943
272 Ga0495680_0694890 3300047322 Unclassified 672
273 Ga0495684_0030920 3300047471 Plasmid 4110
274 Ga0496103_0037416 3300048906 Bacteria 2974
275 Ga0496104_0196229 3300048907 Bacteria 1931
276 Ga0496106_1448770 3300048909 Unclassified 529
277 Ga0496114_0260530 3300048917 Bacteria 1527
278 Ga0496115_0216148 3300048918 Bacteria 1583
279 Ga0501243_038626 3300049675 Bacteria 833
280 nmdc:mga05p37_322284_c1 3300050507 Unclassified 1828
281 nmdc:mga08y16_348895_c1 3300050511 Bacteria 1520
282 nmdc:mga0n895_406108_c1 3300050512 Unclassified 1377
283 nmdc:mga08x19_447415_c1 3300050514 Bacteria 909
284 Ga0500622_0080527 3300053156 Bacteria 1631
285 Ga0111539_10649775
286 SwRhRL3b_contig_911665
287 rootH2_10240254
288 rootL2_10251124
289 rootH1_10066693
290 Ga0065715_10017115
291 Ga0065707_10082911
292 Ga0065707_10322303
293 Ga0065707_10369666
294 Ga0070658_10213594
295 Ga0070690_100001510
296 Ga0070690_100118870
297 Ga0068869_100000006
298 Ga0068869_100012723
299 Ga0070680_100490675
300 Ga0070682_100046941
301 Ga0068868_100044556
302 Ga0068868_100692317
303 Ga0070689_100000617
304 Ga0070689_100074059
305 Ga0070689_100726807
306 Ga0070689_101848561
307 Ga0070691_10776661
308 Ga0070692_10089782
309 Ga0070669_100547480
310 Ga0070669_100856874
311 Ga0070675_100466183
312 Ga0070671_100302744
313 Ga0070674_101029090
314 Ga0070688_100088960
315 Ga0070688_100417072
316 Ga0070688_100447168
317 Ga0070659_100292445
318 Ga0070667_101722227
319 Ga0070709_10537800
320 Ga0070709_10996653
321 Ga0070714_101110808
322 Ga0070701_10137105
323 Ga0070711_101148235
324 Ga0070705_100155501
325 Ga0070705_100239772
326 Ga0070705_101161231
327 Ga0070700_100006063
328 Ga0070694_100274352
329 Ga0070678_100081188
330 Ga0070678_100383619
331 Ga0070681_10022804
332 Ga0068867_100001137
333 Ga0068867_100018064
334 Ga0070697_100055506
335 Ga0070697_100439354
336 Ga0070697_100870196
337 Ga0068853_100005216
338 Ga0070672_100420228
339 Ga0070686_101013582
340 Ga0070695_100378514
341 Ga0070696_100033217
342 Ga0070696_100565981
343 Ga0070693_100185989
344 Ga0070665_100760816
345 Ga0070704_100125076
346 Ga0070704_100585268
347 Ga0068857_100004877
348 Ga0068857_100837400
349 Ga0068856_100590402
350 Ga0070702_101007976
351 Ga0068859_100019942
352 Ga0068859_100374825
353 Ga0068864_100678289
354 Ga0068864_100898481
355 Ga0068864_101405919
356 Ga0068866_10069235
357 Ga0068866_10652451
358 Ga0068861_100027066
359 Ga0068870_10026887
360 Ga0068863_100008064
361 Ga0068858_100495963
362 Ga0068860_100268223
363 Ga0068862_100275786
364 Ga0081455_10009798
365 Ga0081540_1051559
366 Ga0070717_10547652
367 Ga0070715_10373792
368 Ga0070716_100398077
369 Ga0097621_100004751
370 Ga0097621_100027871
371 Ga0097621_100549925
372 Ga0097621_100970411
373 Ga0068871_100010087
374 Ga0068871_100119291
375 Ga0068871_100640766
376 Ga0068871_101663157
377 Ga0075431_100129631
378 Ga0075433_10506235
379 Ga0075434_100426399
380 Ga0075434_101279030
381 Ga0068865_100006518
382 Ga0068865_100018286
383 Ga0075436_100672763
384 Ga0097620_100019942
385 Ga0097620_100374821
386 Ga0099794_10496797
387 Ga0099795_10230189
388 Ga0099795_10296234
389 Ga0105240_10238404
390 Ga0111539_10068846
391 Ga0111539_11100707
392 Ga0105245_10052807
393 Ga0105245_10269004
394 Ga0105245_11130691
395 Ga0114129_10622283
396 Ga0105243_10010469
397 Ga0105243_10127302
398 Ga0105243_12221736
399 Ga0105241_11672934
400 Ga0105242_10040502
401 Ga0105242_10544878
402 Ga0105242_11050966
403 Ga0105242_11142419
404 Ga0105242_11493268
405 Ga0105242_13014911
406 Ga0105248_10458608
407 Ga0105248_11910435
408 Ga0105248_12517599
409 Ga0105238_10877188
410 Ga0105249_10264034
411 Ga0099796_10234063
412 Ga0105246_10420970
413 Ga0157370_11626942
414 Ga0157374_10356478
415 Ga0157378_10881329
416 Ga0157378_11019152
417 Ga0157378_11177144
418 Ga0163162_10231365
419 Ga0157372_10032248
420 Ga0157375_10077129
421 Ga0157375_10178237
422 Ga0157375_10908401
423 Ga0157375_12345756
424 Ga0163163_10112936
425 Ga0157380_10686355
426 Ga0157377_10477205
427 Ga0157379_10082440
428 Ga0157376_10112652
429 Ga0157376_10305655
430 Ga0157376_10632778
431 Ga0157376_12272806
432 Ga0207642_10148620
433 Ga0207699_10126452
434 Ga0207645_10012001
435 Ga0207643_10008172
436 Ga0207705_10393634
437 Ga0207684_10725331
438 Ga0207707_10119903
439 Ga0207695_11062165
440 Ga0207693_10078296
441 Ga0207660_10185995
442 Ga0207646_10506490
443 Ga0207646_11757428
444 Ga0207681_10317557
445 Ga0207681_10570226
446 Ga0207694_10733667
447 Ga0207659_10856561
448 Ga0207687_10175175
449 Ga0207687_10222329
450 Ga0207664_10699636
451 Ga0207686_10003285
452 Ga0207686_10074106
453 Ga0207686_10836170
454 Ga0207709_10046527
455 Ga0207709_10341230
456 Ga0207670_10003247
457 Ga0207670_10879860
458 Ga0207669_11649616
459 Ga0207704_10016817
460 Ga0207704_10749255
461 Ga0207691_10486470
462 Ga0207689_10000034
463 Ga0207689_10006401
464 Ga0207689_11179543
465 Ga0207651_11890504
466 Ga0207712_10313973
467 Ga0207668_10709137
468 Ga0207658_11427581
469 Ga0207677_10015593
470 Ga0207677_11146340
471 Ga0207703_10256370
472 Ga0207639_10018634
473 Ga0207708_10007488
474 Ga0207641_10012809
475 Ga0207648_10002672
476 Ga0207648_10047377
477 Ga0207648_10194924
478 Ga0207676_11347355
479 Ga0207674_10110676
480 Ga0207674_11313328
481 Ga0207675_100037439
482 Ga0207683_10116454
483 Ga0207683_10485732
484 Ga0268266_10747627
485 Ga0268264_11081530
486 Ga0265337_1001121
487 Ga0265337_1005074
488 Ga0265323_10001410
489 Ga0265322_10076549
490 Ga0265336_10000399
491 Ga0265336_10003491
492 Ga0265338_10121364
493 Ga0265338_10305683
494 Ga0265338_10556360
495 Ga0265330_10212429
496 Ga0265320_10001098
497 Ga0265320_10039742
498 Ga0265340_10053090
499 Ga0265331_10003331
500 Ga0265327_10020356
501 Ga0265316_10018641
502 Ga0265314_10184937
503 Ga0307416_102894875
504 Ga0373923_0593836
505 Ga0373954_0008798
506 Ga0373955_0133315
507 Ga0373933_0080384
508 Ga0373947_0027791
509 Ga0373937_0157358
510 Ga0373937_0163094
511 Ga0395905_0573891
512 Ga0451839_1310534
513 Ga0451849_0425163
514 Ga0451577_0161229
515 Ga0451577_1282093
516 Ga0453683_0000400
517 Ga0466961_0737861
518 Ga0453684_0012877
519 Ga0453684_0062192
520 Ga0453684_0176477
521 Ga0453684_0793552
522 Ga0466957_0245522
523 Ga0451576_0049725
524 Ga0451576_0095835
525 Ga0451576_0242239
526 Ga0451576_0642977
527 Ga0495592_0000045
528 Ga0495629_0117073
529 Ga0495662_0001928
530 Ga0495664_0048778
531 Ga0495618_0046186
532 Ga0495618_0051527
533 Ga0495628_0000028
534 Ga0495630_0001948
535 Ga0495630_0010881
536 Ga0495630_0209464
537 Ga0495666_0005977
538 Ga0495652_0038382
539 Ga0495665_0623767
540 Ga0495640_0476475
541 Ga0495586_0000340
542 Ga0495586_0015334
543 Ga0495645_0003694
544 Ga0495645_0144416
545 Ga0495634_0003233
546 Ga0495635_0068559
547 Ga0495635_0365705
548 Ga0495599_0002634
549 Ga0495613_0001312
550 Ga0495613_0211560
551 Ga0495613_0537034
552 Ga0495581_0889321
553 Ga0495674_0030724
554 Ga0495674_0224189
555 Ga0495674_0526284
556 Ga0495680_0694890
557 Ga0495684_0030920
558 Ga0496103_0037416
559 Ga0496104_0196229
560 Ga0496106_1448770
561 Ga0496114_0260530
562 Ga0496115_0216148
563 Ga0501243_038626
564 nmdc:mga05p37_322284_c1
565 nmdc:mga08y16_348895_c1
566 nmdc:mga0n895_406108_c1
567 nmdc:mga08x19_447415_c1
568 Ga0500622_0080527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13366

PDDEXK_3

PD-(D/E)XK nuclease superfamily

9

126

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p45-assembly3.cif.gz_J crystal structure of apo-caspase-6 at physiological ph 0.7291 15 47
3p45-assembly4.cif.gz_N crystal structure of apo-caspase-6 at physiological ph 0.728 15 46
5okz-assembly1.cif.gz_m crystal strucrure of the mpp6 exosome complex 0.648 52 75
3ixs-assembly5.cif.gz_J ring1b c-terminal domain/rybp c-terminal domain complex 0.6415 48 70
3fqj-assembly1.cif.gz_A crystal structure of the mouse dom3z in complex with gdp 0.6374 79 131
ID Description Score Start End Superfamily
af_A0A0G2K7L5_164_250_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8854 10 47 1.10.10.60
af_A0A338P6D5_36_122_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8453 13 47 1.10.10.60
af_A0A338P6G8_38_122_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8217 10 47 1.10.10.60
5bmrA02 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.807 89 126 3.40.120.10
af_A2BEI6_164_251_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.7946 13 47 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1G4AJF4-F1-model_v4 GxxExxY protein 0.9914 1 133
AF-A0A1G4AJF4-F1-model_v4 GxxExxY protein 0.984 1 133
AF-A0A7V9EQM6-F1-model_v4 GxxExxY protein 0.9643 1 140
AF-A0A2V5MTJ5-F1-model_v4 GxxExxY protein 0.957 17 132
AF-A0A2T6CW28-F1-model_v4 GxxExxY protein 0.9499 1 141

Map