F386107

General Info

Members Datasets Scaffolds Average Seq Length
284 168 284 390

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10075348|Ga0081538_100753482
Length 421
Sequence VSGGESISLSPARAKGGCDRQNPVRVEEALTLKEAAERVGVSPATLRRWARSGVIPGVDGDGRWTPSALAHARIVARLRERGHRLEQIRAAGERGWLAYGYIEELFAGDEPRRSLRDAVEATGLEPALIERFWSSMGLPPAGLDRLTDDDIQALHYVASVLDAGFPLVAFLQLCRVYGQALAQIADAEVRLFHLYVHEPLIREGVPGLQMAEEMETLARDLLPLASPLMDYVHQRFLHHFVEQDVVGHMESELEDEELALGRVRVAIAFADLAGYTRFTEEEGEEEALSSVERFVEGVSSTLPEDARVVKTIGDEVMVVGADIGALVDWAVGFIGLFNERPEPRIGIHWGTTLYRDGDYYGREVNLASRVVARARGGEVLVTDSVMEAVRGSSHLSFEEIGQVKLKGFDEPRLLWRAIPGE

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
77 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
78 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
88 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
89 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
165 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 4.93
Rhizosphere 87.68
Stem 0
Stem Tuber 0
Unclassified 7.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000482 3300003373 Bacteria 7927
2 JGI25407J50210_10007049 3300003373 Bacteria 2811
3 Ga0070658_10024251 3300005327 Bacteria 4867
4 Ga0070683_100024005 3300005329 Bacteria 5458
5 Ga0070683_100039217 3300005329 Bacteria 4347
6 Ga0070683_100121991 3300005329 Bacteria 2463
7 Ga0070680_100001810 3300005336 Bacteria 15694
8 Ga0070682_100088440 3300005337 Bacteria 2022
9 Ga0070661_100003576 3300005344 Bacteria 10695
10 Ga0070668_100001560 3300005347 Bacteria 16543
11 Ga0070674_100268761 3300005356 Bacteria 1347
12 Ga0070659_100060266 3300005366 Bacteria 2997
13 Ga0070714_100017913 3300005435 Bacteria 5744
14 Ga0070713_100171039 3300005436 Bacteria 1946
15 Ga0070663_100184373 3300005455 Bacteria 1621
16 Ga0070662_100013756 3300005457 Bacteria 5389
17 Ga0070662_100094909 3300005457 Bacteria 2247
18 Ga0070681_10002045 3300005458 Bacteria 18281
19 Ga0070679_100001248 3300005530 Bacteria 22416
20 Ga0070679_100153049 3300005530 Bacteria 2282
21 Ga0070679_100263715 3300005530 Bacteria 1678
22 Ga0070684_100001851 3300005535 Bacteria 15491
23 Ga0070684_100114136 3300005535 Bacteria 2425
24 Ga0070697_100215179 3300005536 Bacteria 1637
25 Ga0070672_100143596 3300005543 Bacteria 1971
26 Ga0068855_100433718 3300005563 Bacteria 1436
27 Ga0070664_100026038 3300005564 Bacteria 4849
28 Ga0070664_100275298 3300005564 Bacteria 1517
29 Ga0068856_100030906 3300005614 Bacteria 5238
30 Ga0068852_100011155 3300005616 Bacteria 6749
31 Ga0068852_100160668 3300005616 Bacteria 2098
32 Ga0081455_10063774 3300005937 Bacteria 3090
33 Ga0081538_10000067 3300005981 Bacteria 97828
34 Ga0081538_10000122 3300005981 Bacteria 78780
35 Ga0081538_10000125 3300005981 Bacteria 77932
36 Ga0081538_10000171 3300005981 Bacteria 69552
37 Ga0081538_10000178 3300005981 Bacteria 69139
38 Ga0081538_10001461 3300005981 Bacteria 24255
39 Ga0081538_10020575 3300005981 Bacteria 4848
40 Ga0081538_10022859 3300005981 Bacteria 4514
41 Ga0081538_10034229 3300005981 Bacteria 3362
42 Ga0081538_10075348 3300005981 Bacteria 1831
43 Ga0075432_10008782 3300006058 Bacteria 3448
44 Ga0070712_100005842 3300006175 Bacteria 7618
45 Ga0075428_100056441 3300006844 Bacteria 4302
46 Ga0075430_100075147 3300006846 Bacteria 2833
47 Ga0075431_100060405 3300006847 Bacteria 3911
48 Ga0075431_100065024 3300006847 Bacteria 3766
49 Ga0075431_100144808 3300006847 Bacteria 2448
50 Ga0075429_100286365 3300006880 Bacteria 1443
51 Ga0105240_10041649 3300009093 Bacteria 5859
52 Ga0111539_10023699 3300009094 Bacteria 7542
53 Ga0111539_10026240 3300009094 Bacteria 7128
54 Ga0111539_10033213 3300009094 Bacteria 6266
55 Ga0105245_10019384 3300009098 Bacteria 5957
56 Ga0114129_10083082 3300009147 Bacteria 4450
57 Ga0114129_10109733 3300009147 Bacteria 3808
58 Ga0114129_10415780 3300009147 Unclassified 1770
59 Ga0105238_10033146 3300009551 Bacteria 5256
60 Ga0157371_10088678 3300013102 Unclassified 2190
61 Ga0157370_10033256 3300013104 Bacteria 5027
62 Ga0163162_10019432 3300013306 Bacteria 6663
63 Ga0157372_10183994 3300013307 Unclassified 2419
64 Ga0157372_10184807 3300013307 Bacteria 2414
65 Ga0163163_10358008 3300014325 Bacteria 1516
66 Ga0157380_10204266 3300014326 Bacteria 1755
67 Ga0163161_10134500 3300017792 Bacteria 1868
68 Ga0206353_10307548 3300020082 Bacteria 3129
69 Ga0213876_10007802 3300021384 Bacteria 5807
70 Ga0213876_10010710 3300021384 Bacteria 4913
71 Ga0213876_10042826 3300021384 Bacteria 2392
72 Ga0213875_10007104 3300021388 Bacteria 5818
73 Ga0213875_10016485 3300021388 Bacteria 3581
74 Ga0207688_10094606 3300025901 Bacteria 1719
75 Ga0207699_10071916 3300025906 Bacteria 2117
76 Ga0207707_10021371 3300025912 Bacteria 5658
77 Ga0207693_10026075 3300025915 Bacteria 4629
78 Ga0207660_10017253 3300025917 Bacteria 4792
79 Ga0207657_10144952 3300025919 Bacteria 1938
80 Ga0207652_10061523 3300025921 Bacteria 3242
81 Ga0207652_10147574 3300025921 Bacteria 2105
82 Ga0207652_10332854 3300025921 Bacteria 1371
83 Ga0207664_10022650 3300025929 Bacteria 4695
84 Ga0207664_10111284 3300025929 Unclassified 2278
85 Ga0207690_10024688 3300025932 Bacteria 3766
86 Ga0207690_10040642 3300025932 Bacteria 3042
87 Ga0207690_10071884 3300025932 Bacteria 2388
88 Ga0207706_10003697 3300025933 Bacteria 14607
89 Ga0207706_10076756 3300025933 Bacteria 2939
90 Ga0207691_10079337 3300025940 Bacteria 2954
91 Ga0207661_10002565 3300025944 Bacteria 12505
92 Ga0207661_10066428 3300025944 Bacteria 2930
93 Ga0207679_10059060 3300025945 Bacteria 2845
94 Ga0207712_10123201 3300025961 Bacteria 1965
95 Ga0207668_10037821 3300025972 Bacteria 3234
96 Ga0207708_10144306 3300026075 Bacteria 1870
97 Ga0207648_10017007 3300026089 Bacteria 6628
98 Ga0207675_100002860 3300026118 Bacteria 16985
99 Ga0207698_10005152 3300026142 Bacteria 8037
100 Ga0307405_10002032 3300031731 Bacteria 8775
101 Ga0307405_10011029 3300031731 Bacteria 4715
102 Ga0307413_10018142 3300031824 Bacteria 3684
103 Ga0307413_10221906 3300031824 Bacteria 1381
104 Ga0307410_10010801 3300031852 Bacteria 5195
105 Ga0307410_10012309 3300031852 Bacteria 4941
106 Ga0307406_10031538 3300031901 Bacteria 3228
107 Ga0307407_10057629 3300031903 Bacteria 2255
108 Ga0307412_10170165 3300031911 Bacteria 1628
109 Ga0307409_100025894 3300031995 Bacteria 4124
110 Ga0307416_100016516 3300032002 Bacteria 5134
111 Ga0307416_100017696 3300032002 Bacteria 4995
112 Ga0307416_100061208 3300032002 Bacteria 3071
113 Ga0307414_10084302 3300032004 Bacteria 2337
114 Ga0307411_10165589 3300032005 Bacteria 1661
115 Ga0307415_100029198 3300032126 Bacteria 3521
116 Ga0307415_100065159 3300032126 Bacteria 2538
117 Ga0307415_100111064 3300032126 Unclassified 2034
118 Ga0307415_100117641 3300032126 Bacteria 1985
119 Ga0307415_100138374 3300032126 Bacteria 1855
120 Ga0373953_0040127 3300035117 Bacteria 1858
121 Ga0373960_0017768 3300035121 Bacteria 1847
122 Ga0373961_0039728 3300035241 Bacteria 1353
123 Ga0373933_0216792 3300035724 Bacteria 1227
124 Ga0395900_0003291 3300037418 Bacteria 17481
125 Ga0395900_0240214 3300037418 Bacteria 1818
126 Ga0395898_0013993 3300037466 Bacteria 8245
127 Ga0395898_0036476 3300037466 Bacteria 4882
128 Ga0436364_0133131 3300037853 Bacteria 1919
129 Ga0436364_0270997 3300037853 Bacteria 6609
130 Ga0436364_0444851 3300037853 Bacteria 1754
131 Ga0436364_0564783 3300037853 Bacteria 6350
132 Ga0436364_1560845 3300037853 Bacteria 1891
133 Ga0395901_0062613 3300038443 Bacteria 3871
134 Ga0436365_0124241 3300039437 Bacteria 2501
135 Ga0436365_0179601 3300039437 Bacteria 7880
136 Ga0436365_0357794 3300039437 Bacteria 13527
137 Ga0436365_0509379 3300039437 Bacteria 3267
138 Ga0436365_1346313 3300039437 Bacteria 5876
139 Ga0436365_1373181 3300039437 Unclassified 1213
140 Ga0436365_1588578 3300039437 Bacteria 7261
141 Ga0436365_1773817 3300039437 Bacteria 3429
142 Ga0436363_0384359 3300039450 Bacteria 1407
143 Ga0436363_1520707 3300039450 Bacteria 10253
144 Ga0436362_0828737 3300039453 Bacteria 2568
145 Ga0439460_0031434 3300042461 Bacteria 1515
146 Ga0450916_015414 3300042530 Bacteria 1005
147 Ga0439440_0006176 3300042993 Bacteria 2403
148 Ga0466969_0003407 3300044656 Bacteria 8456
149 Ga0466969_0037182 3300044656 Bacteria 2457
150 Ga0466969_0037940 3300044656 Bacteria 2428
151 Ga0466965_0056662 3300044683 Unclassified 1952
152 Ga0466966_0059935 3300044684 Bacteria 2403
153 Ga0466961_0010816 3300044693 Bacteria 5828
154 Ga0466963_0003310 3300044694 Bacteria 9192
155 Ga0466963_0024706 3300044694 Bacteria 3826
156 Ga0466963_0028144 3300044694 Bacteria 3605
157 Ga0466963_0041373 3300044694 Bacteria 3022
158 Ga0466963_0103937 3300044694 Bacteria 1946
159 Ga0466963_0108551 3300044694 Unclassified 1903
160 Ga0466963_0111171 3300044694 Bacteria 1881
161 Ga0466964_0061281 3300044706 Bacteria 1566
162 Ga0466964_0117662 3300044706 Bacteria 1193
163 Ga0466971_0020287 3300044719 Bacteria 2954
164 Ga0466971_0035811 3300044719 Bacteria 2226
165 Ga0466971_0095914 3300044719 Unclassified 1360
166 Ga0466968_0020001 3300044735 Bacteria 2699
167 Ga0466970_0098419 3300044765 Bacteria 1592
168 Ga0466957_0000572 3300044842 Bacteria 18545
169 Ga0466957_0112443 3300044842 Bacteria 1728
170 Ga0466960_0001846 3300044901 Bacteria 7773
171 Ga0466959_0001894 3300045049 Bacteria 13172
172 Ga0466959_0004292 3300045049 Bacteria 9509
173 Ga0466959_0055530 3300045049 Bacteria 2891
174 Ga0466959_0138325 3300045049 Unclassified 1723
175 Ga0466959_0140450 3300045049 Bacteria 1707
176 Ga0466959_0165288 3300045049 Bacteria 1554
177 Ga0466958_0002837 3300045836 Bacteria 8820
178 Ga0466958_0020223 3300045836 Unclassified 3881
179 Ga0466958_0107472 3300045836 Bacteria 1740
180 Ga0466958_0147153 3300045836 Bacteria 1485
181 Ga0466967_0007412 3300045976 Bacteria 7912
182 Ga0466967_0019895 3300045976 Bacteria 5411
183 Ga0466967_0045488 3300045976 Bacteria 3814
184 Ga0466967_0047232 3300045976 Bacteria 3752
185 Ga0466967_0077763 3300045976 Unclassified 2987
186 Ga0466967_0191207 3300045976 Bacteria 1934
187 Ga0466967_0215938 3300045976 Bacteria 1820
188 Ga0466967_0245059 3300045976 Bacteria 1710
189 Ga0466967_0305507 3300045976 Bacteria 1531
190 Ga0466967_0360335 3300045976 Bacteria 1409
191 Ga0466967_0481851 3300045976 Bacteria 1215
192 Ga0495651_0039450 3300046462 Bacteria 3676
193 Ga0495608_0009712 3300046511 Bacteria 6715
194 Ga0495640_0015955 3300046533 Bacteria 5636
195 Ga0495645_0180480 3300046543 Bacteria 1447
196 Ga0495668_0069343 3300046616 Bacteria 1939
197 Ga0495634_0085046 3300046642 Bacteria 2062
198 Ga0495635_0012916 3300046663 Bacteria 5847
199 Ga0495657_0080535 3300046675 Bacteria 2107
200 Ga0495646_0023601 3300046680 Bacteria 3872
201 Ga0495613_0129587 3300046689 Bacteria 1807
202 Ga0495600_0008499 3300046809 Bacteria 6309
203 Ga0495674_0075164 3300047319 Bacteria 2908
204 Ga0495674_0089166 3300047319 Bacteria 2637
205 Ga0495674_0146589 3300047319 Bacteria 1981
206 Ga0495680_0006170 3300047322 Bacteria 11179
207 Ga0495675_0077393 3300047444 Bacteria 2096
208 Ga0495684_0011867 3300047471 Bacteria 6723
209 Ga0495593_0052804 3300047673 Bacteria 2147
210 Ga0496104_0052045 3300048907 Bacteria 3867
211 Ga0496104_0191373 3300048907 Bacteria 1957
212 Ga0496105_0097034 3300048908 Bacteria 2434
213 Ga0496105_0109005 3300048908 Bacteria 2286
214 Ga0496107_0281786 3300048910 Bacteria 1237
215 Ga0496109_0001631 3300048912 Bacteria 18747
216 Ga0496109_0332046 3300048912 Bacteria 1436
217 Ga0496110_0018124 3300048913 Bacteria 5898
218 Ga0496110_0089998 3300048913 Bacteria 2744
219 Ga0496111_0112082 3300048914 Bacteria 2010
220 Ga0496111_0155574 3300048914 Bacteria 1696
221 Ga0496112_0047059 3300048915 Bacteria 4231
222 Ga0496113_0067657 3300048916 Bacteria 2709
223 Ga0496113_0309621 3300048916 Bacteria 1265
224 Ga0501031_0042860 3300049568 Bacteria 2954
225 Ga0501031_0056003 3300049568 Bacteria 2569
226 Ga0501032_0075084 3300049569 Bacteria 2251
227 Ga0501033_0049811 3300049570 Bacteria 3109
228 Ga0501034_0002442 3300049571 Bacteria 22421
229 Ga0501036_0059041 3300049572 Bacteria 3250
230 Ga0501036_0062022 3300049572 Bacteria 3166
231 Ga0501037_0013686 3300049573 Bacteria 5977
232 Ga0501038_0044848 3300049574 Bacteria 3840
233 Ga0501039_0056606 3300049575 Bacteria 3038
234 Ga0501039_0123937 3300049575 Bacteria 2026
235 Ga0501040_0026019 3300049576 Bacteria 3937
236 Ga0501040_0194332 3300049576 Bacteria 1440
237 Ga0501041_0075145 3300049577 Bacteria 2077
238 Ga0501042_0016248 3300049578 Bacteria 5108
239 Ga0501042_0075118 3300049578 Bacteria 2418
240 Ga0501042_0133657 3300049578 Bacteria 1788
241 Ga0501043_0019832 3300049579 Bacteria 5280
242 Ga0501046_0088058 3300049580 Bacteria 2391
243 Ga0501046_0149441 3300049580 Bacteria 1763
244 Ga0501046_0193818 3300049580 Bacteria 1515
245 Ga0501047_0150050 3300049581 Bacteria 2207
246 Ga0501048_0031204 3300049582 Bacteria 3855
247 Ga0501048_0067349 3300049582 Bacteria 2531
248 Ga0501048_0167014 3300049582 Bacteria 1558
249 Ga0501067_0038602 3300049583 Bacteria 2651
250 Ga0501068_0032320 3300049584 Bacteria 3112
251 Ga0501069_0138487 3300049585 Bacteria 1395
252 Ga0501071_0015551 3300049587 Bacteria 5225
253 Ga0501071_0038399 3300049587 Bacteria 3422
254 Ga0501072_0072745 3300049588 Bacteria 2717
255 Ga0501073_0057969 3300049589 Bacteria 2707
256 Ga0501074_0224787 3300049590 Bacteria 1336
257 Ga0501075_0192998 3300049591 Bacteria 1553
258 Ga0501076_0026751 3300049592 Bacteria 4472
259 Ga0501076_0133944 3300049592 Bacteria 2011
260 Ga0501077_0053891 3300049593 Bacteria 2554
261 Ga0501080_0123614 3300049742 Bacteria 2397
262 Ga0501081_0085570 3300049743 Bacteria 2213
263 Ga0501035_0131928 3300049822 Bacteria 2177
264 Ga0501035_0179304 3300049822 Bacteria 1826
265 Ga0501044_0134706 3300049823 Bacteria 2462
266 Ga0501045_0098535 3300049824 Bacteria 2163
267 nmdc:mga05p37_125083_c1 3300050507 Bacteria 3158
268 nmdc:mga05p37_134573_c1 3300050507 Bacteria 3032
269 nmdc:mga09592_115547_c1 3300050508 Bacteria 2303
270 nmdc:mga09592_268037_c1 3300050508 Bacteria 1481
271 nmdc:mga0qj67_159773_c1 3300050509 Bacteria 1829
272 nmdc:mga0qj67_22151_c1 3300050509 Bacteria 4878
273 nmdc:mga06r32_189676_c1 3300050510 Bacteria 2043
274 nmdc:mga06r32_76984_c1 3300050510 Bacteria 3240
275 nmdc:mga08y16_146256_c1 3300050511 Bacteria 2457
276 nmdc:mga08y16_16127_c1 3300050511 Bacteria 7856
277 nmdc:mga08y16_263987_c1 3300050511 Bacteria 1778
278 nmdc:mga0a205_72440_c1 3300050515 Bacteria 3328
279 Ga0495655_0005270 3300053083 Bacteria 2273
280 Ga0500616_0023422 3300053153 Bacteria 3439
281 Ga0501084_0060235 3300054114 Bacteria 3178
282 Ga0501082_0038628 3300060353 Bacteria 4118
283 Ga0466962_0020884 3300061719 Bacteria 3146
284 Ga0466962_0024991 3300061719 Bacteria 2867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042530 Ga0450916_015414 Ga0450916_015414_17_979 318
2 3300045976 Ga0466967_0007412 Ga0466967_0007412_5697_6722 338
3 3300035724 Ga0373933_0216792 Ga0373933_0216792_14_1078 343
4 3300046642 Ga0495634_0085046 Ga0495634_0085046_13_1047 343
5 3300048910 Ga0496107_0281786 Ga0496107_0281786_51_1088 344
6 3300037853 Ga0436364_0133131 Ga0436364_0133131_115_1323 346
7 3300006847 Ga0075431_100065024 Ga0075431_1000650242 352
8 3300006880 Ga0075429_100286365 Ga0075429_1002863652 352
9 3300050507 nmdc:mga05p37_134573_c1 nmdc:mga05p37_134573_c1_775_1836 352
10 3300046543 Ga0495645_0180480 Ga0495645_0180480_25_1128 356
11 3300005981 Ga0081538_10034229 Ga0081538_100342292 366
12 3300044683 Ga0466965_0056662 Ga0466965_0056662_343_1464 369
13 3300044694 Ga0466963_0108551 Ga0466963_0108551_638_1759 369
14 3300044842 Ga0466957_0000572 Ga0466957_0000572_199_1320 369
15 3300045836 Ga0466958_0020223 Ga0466958_0020223_2582_3703 369
16 3300045976 Ga0466967_0077763 Ga0466967_0077763_1673_2794 369
17 3300049578 Ga0501042_0133657 Ga0501042_0133657_14_1126 369
18 3300005457 Ga0070662_100094909 Ga0070662_1000949093 370
19 3300005564 Ga0070664_100026038 Ga0070664_1000260384 370
20 3300005564 Ga0070664_100275298 Ga0070664_1002752981 370
21 3300025919 Ga0207657_10144952 Ga0207657_101449522 370
22 3300025932 Ga0207690_10040642 Ga0207690_100406424 370
23 3300025933 Ga0207706_10076756 Ga0207706_100767563 370
24 3300045976 Ga0466967_0019895 Ga0466967_0019895_682_1851 370
25 3300044656 Ga0466969_0037940 Ga0466969_0037940_1259_2386 373
26 3300005981 Ga0081538_10000178 Ga0081538_1000017823 374
27 3300044719 Ga0466971_0035811 Ga0466971_0035811_504_1634 375
28 3300049568 Ga0501031_0056003 Ga0501031_0056003_1043_2215 376
29 3300049576 Ga0501040_0194332 Ga0501040_0194332_233_1405 376
30 3300049578 Ga0501042_0075118 Ga0501042_0075118_131_1303 376
31 3300049580 Ga0501046_0149441 Ga0501046_0149441_560_1732 376
32 3300049582 Ga0501048_0067349 Ga0501048_0067349_1017_2189 376
33 3300049587 Ga0501071_0015551 Ga0501071_0015551_2225_3397 376
34 3300049588 Ga0501072_0072745 Ga0501072_0072745_830_2002 376
35 3300049590 Ga0501074_0224787 Ga0501074_0224787_111_1295 376
36 3300049592 Ga0501076_0026751 Ga0501076_0026751_951_2123 376
37 3300049593 Ga0501077_0053891 Ga0501077_0053891_1104_2276 376
38 3300054114 Ga0501084_0060235 Ga0501084_0060235_515_1687 376
39 3300031824 Ga0307413_10018142 Ga0307413_100181422 377
40 3300031852 Ga0307410_10012309 Ga0307410_100123092 377
41 3300031995 Ga0307409_100025894 Ga0307409_1000258942 377
42 3300032126 Ga0307415_100138374 Ga0307415_1001383742 377
43 3300048916 Ga0496113_0067657 Ga0496113_0067657_926_2143 377
44 3300037853 Ga0436364_1560845 Ga0436364_1560845_414_1553 378
45 3300039437 Ga0436365_1373181 Ga0436365_1373181_30_1172 378
46 3300050508 nmdc:mga09592_115547_c1 nmdc:mga09592_115547_c1_221_1420 378
47 3300050509 nmdc:mga0qj67_22151_c1 nmdc:mga0qj67_22151_c1_1741_2940 378
48 3300050510 nmdc:mga06r32_189676_c1 nmdc:mga06r32_189676_c1_728_1927 378
49 3300005347 Ga0070668_100001560 Ga0070668_1000015606 379
50 3300005457 Ga0070662_100013756 Ga0070662_1000137562 379
51 3300005616 Ga0068852_100160668 Ga0068852_1001606682 379
52 3300006058 Ga0075432_10008782 Ga0075432_100087822 379
53 3300009094 Ga0111539_10026240 Ga0111539_100262402 379
54 3300009098 Ga0105245_10019384 Ga0105245_100193842 379
55 3300013306 Ga0163162_10019432 Ga0163162_100194322 379
56 3300017792 Ga0163161_10134500 Ga0163161_101345002 379
57 3300021384 Ga0213876_10042826 Ga0213876_100428262 379
58 3300021388 Ga0213875_10016485 Ga0213875_100164855 379
59 3300025933 Ga0207706_10003697 Ga0207706_1000369711 379
60 3300025961 Ga0207712_10123201 Ga0207712_101232012 379
61 3300026118 Ga0207675_100002860 Ga0207675_1000028609 379
62 3300032126 Ga0307415_100111064 Ga0307415_1001110641 379
63 3300035121 Ga0373960_0017768 Ga0373960_0017768_381_1574 379
64 3300035241 Ga0373961_0039728 Ga0373961_0039728_34_1227 379
65 3300039437 Ga0436365_0179601 Ga0436365_0179601_5617_6789 379
66 3300044706 Ga0466964_0117662 Ga0466964_0117662_11_1150 379
67 3300049575 Ga0501039_0056606 Ga0501039_0056606_1640_2833 379
68 3300049576 Ga0501040_0026019 Ga0501040_0026019_1469_2662 379
69 3300049580 Ga0501046_0193818 Ga0501046_0193818_75_1268 379
70 3300050509 nmdc:mga0qj67_159773_c1 nmdc:mga0qj67_159773_c1_306_1502 379
71 3300050511 nmdc:mga08y16_16127_c1 nmdc:mga08y16_16127_c1_3159_4352 379
72 3300050515 nmdc:mga0a205_72440_c1 nmdc:mga0a205_72440_c1_1005_2198 379
73 3300005356 Ga0070674_100268761 Ga0070674_1002687611 380
74 3300049743 Ga0501081_0085570 Ga0501081_0085570_192_1388 380
75 3300045049 Ga0466959_0138325 Ga0466959_0138325_312_1466 381
76 3300005981 Ga0081538_10020575 Ga0081538_100205754 382
77 3300050508 nmdc:mga09592_268037_c1 nmdc:mga09592_268037_c1_17_1168 382
78 3300005536 Ga0070697_100215179 Ga0070697_1002151791 383
79 3300006175 Ga0070712_100005842 Ga0070712_1000058424 383
80 3300025915 Ga0207693_10026075 Ga0207693_100260754 383
81 3300035117 Ga0373953_0040127 Ga0373953_0040127_231_1448 383
82 3300046462 Ga0495651_0039450 Ga0495651_0039450_236_1453 383
83 3300046511 Ga0495608_0009712 Ga0495608_0009712_1903_3120 383
84 3300046533 Ga0495640_0015955 Ga0495640_0015955_2856_4073 383
85 3300046663 Ga0495635_0012916 Ga0495635_0012916_2965_4182 383
86 3300046675 Ga0495657_0080535 Ga0495657_0080535_706_1923 383
87 3300046680 Ga0495646_0023601 Ga0495646_0023601_252_1469 383
88 3300046689 Ga0495613_0129587 Ga0495613_0129587_247_1464 383
89 3300046809 Ga0495600_0008499 Ga0495600_0008499_3249_4466 383
90 3300047319 Ga0495674_0146589 Ga0495674_0146589_615_1832 383
91 3300047322 Ga0495680_0006170 Ga0495680_0006170_7130_8347 383
92 3300047444 Ga0495675_0077393 Ga0495675_0077393_706_1923 383
93 3300047471 Ga0495684_0011867 Ga0495684_0011867_4120_5337 383
94 3300047673 Ga0495593_0052804 Ga0495593_0052804_850_2067 383
95 3300048907 Ga0496104_0052045 Ga0496104_0052045_2097_3314 383
96 3300048908 Ga0496105_0109005 Ga0496105_0109005_376_1593 383
97 3300048913 Ga0496110_0018124 Ga0496110_0018124_3819_5036 383
98 3300048915 Ga0496112_0047059 Ga0496112_0047059_609_1826 383
99 3300005337 Ga0070682_100088440 Ga0070682_1000884402 385
100 3300005366 Ga0070659_100060266 Ga0070659_1000602662 385
101 3300005455 Ga0070663_100184373 Ga0070663_1001843732 385
102 3300025932 Ga0207690_10071884 Ga0207690_100718842 385
103 3300037418 Ga0395900_0003291 Ga0395900_0003291_657_1820 386
104 3300037466 Ga0395898_0013993 Ga0395898_0013993_7014_8177 386
105 3300044656 Ga0466969_0037182 Ga0466969_0037182_242_1405 386
106 3300045049 Ga0466959_0140450 Ga0466959_0140450_194_1357 386
107 3300045976 Ga0466967_0047232 Ga0466967_0047232_644_1804 386
108 3300005614 Ga0068856_100030906 Ga0068856_1000309065 387
109 3300049571 Ga0501034_0002442 Ga0501034_0002442_200_1432 387
110 3300005329 Ga0070683_100121991 Ga0070683_1001219913 388
111 3300005543 Ga0070672_100143596 Ga0070672_1001435962 388
112 3300009094 Ga0111539_10033213 Ga0111539_100332132 388
113 3300014325 Ga0163163_10358008 Ga0163163_103580082 388
114 3300025945 Ga0207679_10059060 Ga0207679_100590604 388
115 3300031903 Ga0307407_10057629 Ga0307407_100576292 388
116 3300032126 Ga0307415_100065159 Ga0307415_1000651592 388
117 3300044694 Ga0466963_0024706 Ga0466963_0024706_1398_2570 388
118 3300044694 Ga0466963_0041373 Ga0466963_0041373_1075_2244 388
119 3300044694 Ga0466963_0103937 Ga0466963_0103937_674_1840 388
120 3300044694 Ga0466963_0111171 Ga0466963_0111171_383_1549 388
121 3300044706 Ga0466964_0061281 Ga0466964_0061281_187_1353 388
122 3300045976 Ga0466967_0191207 Ga0466967_0191207_703_1872 388
123 3300045976 Ga0466967_0215938 Ga0466967_0215938_589_1758 388
124 3300045976 Ga0466967_0360335 Ga0466967_0360335_98_1264 388
125 3300048908 Ga0496105_0097034 Ga0496105_0097034_927_2105 388
126 3300048914 Ga0496111_0112082 Ga0496111_0112082_325_1494 388
127 3300061719 Ga0466962_0020884 Ga0466962_0020884_1855_3024 388
128 3300005981 Ga0081538_10022859 Ga0081538_100228594 389
129 3300013307 Ga0157372_10184807 Ga0157372_101848072 389
130 3300021384 Ga0213876_10010710 Ga0213876_100107104 389
131 3300025940 Ga0207691_10079337 Ga0207691_100793372 389
132 3300037418 Ga0395900_0240214 Ga0395900_0240214_330_1514 389
133 3300037466 Ga0395898_0036476 Ga0395898_0036476_1599_2780 389
134 3300038443 Ga0395901_0062613 Ga0395901_0062613_237_1418 389
135 3300039437 Ga0436365_0509379 Ga0436365_0509379_419_1618 389
136 3300039437 Ga0436365_1346313 Ga0436365_1346313_2823_4034 389
137 3300045049 Ga0466959_0001894 Ga0466959_0001894_4640_5815 389
138 3300045049 Ga0466959_0165288 Ga0466959_0165288_155_1354 389
139 3300045836 Ga0466958_0107472 Ga0466958_0107472_79_1251 389
140 3300045976 Ga0466967_0245059 Ga0466967_0245059_45_1256 389
141 3300048912 Ga0496109_0332046 Ga0496109_0332046_79_1260 389
142 3300048913 Ga0496110_0089998 Ga0496110_0089998_365_1546 389
143 3300049572 Ga0501036_0059041 Ga0501036_0059041_2038_3222 389
144 3300021384 Ga0213876_10007802 Ga0213876_100078024 390
145 3300039437 Ga0436365_1588578 Ga0436365_1588578_777_2021 390
146 3300044694 Ga0466963_0028144 Ga0466963_0028144_10_1194 390
147 3300048914 Ga0496111_0155574 Ga0496111_0155574_486_1670 390
148 3300049568 Ga0501031_0042860 Ga0501031_0042860_1210_2391 390
149 3300049569 Ga0501032_0075084 Ga0501032_0075084_236_1417 390
150 3300049570 Ga0501033_0049811 Ga0501033_0049811_1227_2408 390
151 3300049572 Ga0501036_0062022 Ga0501036_0062022_1315_2496 390
152 3300049573 Ga0501037_0013686 Ga0501037_0013686_54_1235 390
153 3300049574 Ga0501038_0044848 Ga0501038_0044848_860_2041 390
154 3300049578 Ga0501042_0016248 Ga0501042_0016248_2125_3306 390
155 3300049579 Ga0501043_0019832 Ga0501043_0019832_1865_3046 390
156 3300049580 Ga0501046_0088058 Ga0501046_0088058_93_1274 390
157 3300049581 Ga0501047_0150050 Ga0501047_0150050_981_2162 390
158 3300049582 Ga0501048_0031204 Ga0501048_0031204_701_1882 390
159 3300049583 Ga0501067_0038602 Ga0501067_0038602_105_1286 390
160 3300049584 Ga0501068_0032320 Ga0501068_0032320_231_1412 390
161 3300049585 Ga0501069_0138487 Ga0501069_0138487_66_1247 390
162 3300049589 Ga0501073_0057969 Ga0501073_0057969_418_1599 390
163 3300049742 Ga0501080_0123614 Ga0501080_0123614_556_1737 390
164 3300049822 Ga0501035_0131928 Ga0501035_0131928_295_1476 390
165 3300049823 Ga0501044_0134706 Ga0501044_0134706_1177_2358 390
166 3300060353 Ga0501082_0038628 Ga0501082_0038628_1144_2325 390
167 3300005435 Ga0070714_100017913 Ga0070714_1000179135 391
168 3300005436 Ga0070713_100171039 Ga0070713_1001710392 391
169 3300009147 Ga0114129_10415780 Ga0114129_104157802 391
170 3300014326 Ga0157380_10204266 Ga0157380_102042662 391
171 3300025901 Ga0207688_10094606 Ga0207688_100946062 391
172 3300025929 Ga0207664_10022650 Ga0207664_100226503 391
173 3300025972 Ga0207668_10037821 Ga0207668_100378213 391
174 3300026075 Ga0207708_10144306 Ga0207708_101443062 391
175 3300026089 Ga0207648_10017007 Ga0207648_100170074 391
176 3300031731 Ga0307405_10002032 Ga0307405_100020322 391
177 3300042993 Ga0439440_0006176 Ga0439440_0006176_431_1612 391
178 3300044901 Ga0466960_0001846 Ga0466960_0001846_6485_7684 391
179 3300045976 Ga0466967_0305507 Ga0466967_0305507_330_1505 391
180 3300045976 Ga0466967_0481851 Ga0466967_0481851_27_1202 391
181 3300047319 Ga0495674_0075164 Ga0495674_0075164_1538_2725 391
182 3300047319 Ga0495674_0089166 Ga0495674_0089166_66_1283 391
183 3300048907 Ga0496104_0191373 Ga0496104_0191373_581_1798 391
184 3300048912 Ga0496109_0001631 Ga0496109_0001631_6522_7712 391
185 3300050511 nmdc:mga08y16_263987_c1 nmdc:mga08y16_263987_c1_88_1272 391
186 3300006847 Ga0075431_100060405 Ga0075431_1000604053 392
187 3300009094 Ga0111539_10023699 Ga0111539_100236998 392
188 3300009147 Ga0114129_10109733 Ga0114129_101097333 392
189 3300021388 Ga0213875_10007104 Ga0213875_100071044 392
190 3300025906 Ga0207699_10071916 Ga0207699_100719163 392
191 3300025929 Ga0207664_10111284 Ga0207664_101112842 392
192 3300037853 Ga0436364_0270997 Ga0436364_0270997_2356_3582 392
193 3300037853 Ga0436364_0444851 Ga0436364_0444851_151_1365 392
194 3300037853 Ga0436364_0564783 Ga0436364_0564783_2534_3766 392
195 3300039437 Ga0436365_0124241 Ga0436365_0124241_316_1533 392
196 3300039437 Ga0436365_0357794 Ga0436365_0357794_8127_9332 392
197 3300039437 Ga0436365_1773817 Ga0436365_1773817_2030_3262 392
198 3300039450 Ga0436363_0384359 Ga0436363_0384359_176_1369 392
199 3300039450 Ga0436363_1520707 Ga0436363_1520707_3468_4685 392
200 3300044656 Ga0466969_0003407 Ga0466969_0003407_5489_6679 392
201 3300044684 Ga0466966_0059935 Ga0466966_0059935_1171_2361 392
202 3300044693 Ga0466961_0010816 Ga0466961_0010816_4155_5345 392
203 3300044694 Ga0466963_0003310 Ga0466963_0003310_3633_4823 392
204 3300044719 Ga0466971_0020287 Ga0466971_0020287_775_1965 392
205 3300044735 Ga0466968_0020001 Ga0466968_0020001_790_1980 392
206 3300044765 Ga0466970_0098419 Ga0466970_0098419_31_1227 392
207 3300044842 Ga0466957_0112443 Ga0466957_0112443_453_1643 392
208 3300045049 Ga0466959_0004292 Ga0466959_0004292_5326_6516 392
209 3300045049 Ga0466959_0055530 Ga0466959_0055530_949_2139 392
210 3300045836 Ga0466958_0002837 Ga0466958_0002837_3507_4697 392
211 3300045836 Ga0466958_0147153 Ga0466958_0147153_200_1405 392
212 3300045976 Ga0466967_0045488 Ga0466967_0045488_210_1415 392
213 3300048916 Ga0496113_0309621 Ga0496113_0309621_19_1230 392
214 3300050510 nmdc:mga06r32_76984_c1 nmdc:mga06r32_76984_c1_1381_2559 392
215 3300053083 Ga0495655_0005270 Ga0495655_0005270_452_1633 392
216 3300053153 Ga0500616_0023422 Ga0500616_0023422_1931_3127 392
217 3300061719 Ga0466962_0024991 Ga0466962_0024991_765_1955 392
218 3300039453 Ga0436362_0828737 Ga0436362_0828737_299_1528 393
219 3300044719 Ga0466971_0095914 Ga0466971_0095914_86_1330 394
220 3300005327 Ga0070658_10024251 Ga0070658_100242512 395
221 3300005329 Ga0070683_100024005 Ga0070683_1000240054 395
222 3300005329 Ga0070683_100039217 Ga0070683_1000392171 395
223 3300005336 Ga0070680_100001810 Ga0070680_1000018102 395
224 3300005344 Ga0070661_100003576 Ga0070661_1000035767 395
225 3300005458 Ga0070681_10002045 Ga0070681_100020454 395
226 3300005530 Ga0070679_100001248 Ga0070679_10000124820 395
227 3300005530 Ga0070679_100153049 Ga0070679_1001530491 395
228 3300005535 Ga0070684_100001851 Ga0070684_10000185116 395
229 3300005535 Ga0070684_100114136 Ga0070684_1001141362 395
230 3300005563 Ga0068855_100433718 Ga0068855_1004337182 395
231 3300005616 Ga0068852_100011155 Ga0068852_1000111552 395
232 3300009093 Ga0105240_10041649 Ga0105240_100416494 395
233 3300009147 Ga0114129_10083082 Ga0114129_100830821 395
234 3300009551 Ga0105238_10033146 Ga0105238_100331462 395
235 3300013102 Ga0157371_10088678 Ga0157371_100886782 395
236 3300013104 Ga0157370_10033256 Ga0157370_100332562 395
237 3300013307 Ga0157372_10183994 Ga0157372_101839942 395
238 3300020082 Ga0206353_10307548 Ga0206353_103075482 395
239 3300025912 Ga0207707_10021371 Ga0207707_100213712 395
240 3300025917 Ga0207660_10017253 Ga0207660_100172532 395
241 3300025921 Ga0207652_10061523 Ga0207652_100615232 395
242 3300025921 Ga0207652_10147574 Ga0207652_101475741 395
243 3300025932 Ga0207690_10024688 Ga0207690_100246883 395
244 3300025944 Ga0207661_10002565 Ga0207661_100025652 395
245 3300025944 Ga0207661_10066428 Ga0207661_100664282 395
246 3300026142 Ga0207698_10005152 Ga0207698_100051526 395
247 3300031731 Ga0307405_10011029 Ga0307405_100110292 395
248 3300031852 Ga0307410_10010801 Ga0307410_100108013 395
249 3300031911 Ga0307412_10170165 Ga0307412_101701651 395
250 3300032002 Ga0307416_100017696 Ga0307416_1000176965 395
251 3300032005 Ga0307411_10165589 Ga0307411_101655892 395
252 3300032126 Ga0307415_100029198 Ga0307415_1000291982 395
253 3300050507 nmdc:mga05p37_125083_c1 nmdc:mga05p37_125083_c1_150_1340 395
254 3300050511 nmdc:mga08y16_146256_c1 nmdc:mga08y16_146256_c1_158_1348 395
255 3300005530 Ga0070679_100263715 Ga0070679_1002637152 396
256 3300006844 Ga0075428_100056441 Ga0075428_1000564412 396
257 3300025921 Ga0207652_10332854 Ga0207652_103328541 396
258 3300005981 Ga0081538_10000122 Ga0081538_100001224 397
259 3300005981 Ga0081538_10000125 Ga0081538_1000012510 397
260 3300005981 Ga0081538_10001461 Ga0081538_100014619 397
261 3300005981 Ga0081538_10075348 Ga0081538_100753482 397
262 3300006846 Ga0075430_100075147 Ga0075430_1000751472 397
263 3300006847 Ga0075431_100144808 Ga0075431_1001448082 397
264 3300031824 Ga0307413_10221906 Ga0307413_102219062 397
265 3300031901 Ga0307406_10031538 Ga0307406_100315382 397
266 3300032002 Ga0307416_100016516 Ga0307416_1000165162 397
267 3300032004 Ga0307414_10084302 Ga0307414_100843022 397
268 3300032126 Ga0307415_100117641 Ga0307415_1001176412 397
269 3300042461 Ga0439460_0031434 Ga0439460_0031434_167_1363 397
270 3300049575 Ga0501039_0123937 Ga0501039_0123937_252_1448 397
271 3300049577 Ga0501041_0075145 Ga0501041_0075145_792_1988 397
272 3300049582 Ga0501048_0167014 Ga0501048_0167014_255_1451 397
273 3300049587 Ga0501071_0038399 Ga0501071_0038399_392_1588 397
274 3300049591 Ga0501075_0192998 Ga0501075_0192998_243_1439 397
275 3300049592 Ga0501076_0133944 Ga0501076_0133944_546_1742 397
276 3300049822 Ga0501035_0179304 Ga0501035_0179304_380_1576 397
277 3300049824 Ga0501045_0098535 Ga0501045_0098535_918_2114 397
278 3300003373 JGI25407J50210_10000482 JGI25407J50210_100004823 398
279 3300003373 JGI25407J50210_10007049 JGI25407J50210_100070492 398
280 3300005937 Ga0081455_10063774 Ga0081455_100637742 398
281 3300005981 Ga0081538_10000067 Ga0081538_1000006785 398
282 3300005981 Ga0081538_10000171 Ga0081538_100001717 398
283 3300032002 Ga0307416_100061208 Ga0307416_1000612082 398
284 3300046616 Ga0495668_0069343 Ga0495668_0069343_329_1528 398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13411

MerR_1

MerR HTH family regulatory protein

30

93

0.95

PF00211

Guanylate_cyc

Adenylate and Guanylate cyclase catalytic domain

261

415

0.9

PF00376

MerR

MerR family regulatory protein

31

64

0.9

PF12728

HTH_17

Helix-turn-helix domain

29

65

0.9

PF16701

Ad_Cy_reg

Adenylate cyclase regulatory domain

48

241

0.82

Feature Viewer

pLDDT pTM Quality
83.05 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map