F386098

General Info

Members Datasets Scaffolds Average Seq Length
284 174 568 475

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100003075|Ga0068858_10000307511
Length 547
Sequence MRRGDYSLAAERIRRDRNVAWQNYRKNVTEWSETLFLRRRWCISRVGMNDSSSGGAVFQHRPKDECGVFAVFGHPQAAEITFFGLYALQHRGQESAGIVVSGGKDRKFKGHHGMGLVPQVFNEQKLAGLPGTRAIGHVRYSTTGSSTLENAQPIVADCSRGQIAVGHNGNLINAHVLRDELEAKGAIFKTTVDSEVILHLMAQPSNNLGDSILVQTLCKVKGAFSLVLMNEQEIIGVRDSLGFRPLCIGKVDDAWLLSSESCAFDIIPGAKFVRDVEPGEIVVIDENGLRSIKPFVAKPRLGFCIFEYVYFARPDSTLEGVNVSAVRTNMGRELARLHPVDADLVIPVPDSGNYAALGFSEESGIPYDHAFVRNHYVGRTFLNPSQLARDFGVKVKLNIIKERVAGKRVVVVDDSIVRGTTARSRVMNLRNAGAKEVHIRISCPPHRFPCHYGIDFPDPKDLIANQLSHQEIAKYLQADSLGYLDEAGMVRATGRGEDKFCMACFNQKYPIAVNPDLDKLIFERRKMRAESLVFAEETAPRLFNGKI

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014486 Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG Metagenome Unclassified
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
97 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
106 3300044649 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4E Metagenome Unclassified
107 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
108 3300044651 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC4E Metagenome Unclassified
109 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
110 3300044660 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E1 Metagenome Unclassified
111 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
112 3300044662 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA4E Metagenome Unclassified
113 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
114 3300044665 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC1E Metagenome Unclassified
115 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
116 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
117 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
118 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
119 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
135 3300048619 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC3E Metagenome Unclassified
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
169 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
170 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
171 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
172 2857472729 Cohnella sp. R-74144 Isolate Unclassified
173 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
174 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 0
Isolates 2.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 1.76
Rhizosphere 81.34
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100003075 3300005842 Bacteria 16708
2 rootH1_10008242 3300003316 Eukaryota 2538
3 rootH2_10028126 3300003320 Bacteria 1863
4 rootH2_10038270 3300003320 Bacteria 36451
5 rootL2_10047096 3300003322 Bacteria 2963
6 Ga0065704_10122673 3300005289 Bacteria 1746
7 Ga0065707_10009094 3300005295 Bacteria 2288
8 Ga0070670_100003184 3300005331 Bacteria 13548
9 Ga0068869_100148046 3300005334 Bacteria 1819
10 Ga0070666_10019588 3300005335 Bacteria 4371
11 Ga0068868_100063365 3300005338 Bacteria 2932
12 Ga0070661_100092812 3300005344 Bacteria 2237
13 Ga0070675_100046700 3300005354 Bacteria 3547
14 Ga0070671_100000274 3300005355 Bacteria 34813
15 Ga0070688_100110930 3300005365 Bacteria 1824
16 Ga0070667_100054916 3300005367 Bacteria 3363
17 Ga0070701_10103162 3300005438 Bacteria 1583
18 Ga0070663_100035503 3300005455 Bacteria 3459
19 Ga0070662_100093661 3300005457 Bacteria 2260
20 Ga0070706_100001235 3300005467 Bacteria 27354
21 Ga0070706_100012896 3300005467 Bacteria 7736
22 Ga0070706_100174637 3300005467 Bacteria 2006
23 Ga0070707_100009731 3300005468 Bacteria 8935
24 Ga0070707_100014021 3300005468 Bacteria 7511
25 Ga0070707_100172561 3300005468 Bacteria 2107
26 Ga0070698_100010760 3300005471 Bacteria 9732
27 Ga0070698_100041064 3300005471 Bacteria 4751
28 Ga0070698_100055120 3300005471 Bacteria 4034
29 Ga0070697_100021644 3300005536 Bacteria 5096
30 Ga0070672_100072246 3300005543 Bacteria 2747
31 Ga0070695_100056806 3300005545 Bacteria 2527
32 Ga0070696_100011168 3300005546 Bacteria 6009
33 Ga0070665_100000037 3300005548 Bacteria 312727
34 Ga0070665_100080330 3300005548 Bacteria 3266
35 Ga0070664_100012459 3300005564 Bacteria 6913
36 Ga0068859_100007004 3300005617 Bacteria 11449
37 Ga0068859_100015382 3300005617 Bacteria 7687
38 Ga0068859_100092154 3300005617 Bacteria 3082
39 Ga0068859_100112515 3300005617 Bacteria 2785
40 Ga0068864_100003868 3300005618 Bacteria 12331
41 Ga0068864_100011401 3300005618 Bacteria 7342
42 Ga0068870_10009261 3300005840 Bacteria 4471
43 Ga0068863_100000999 3300005841 Bacteria 28338
44 Ga0068863_100056619 3300005841 Bacteria 3711
45 Ga0068863_100182759 3300005841 Unclassified 2013
46 Ga0081455_10017985 3300005937 Bacteria 6751
47 Ga0081538_10003088 3300005981 Bacteria 15836
48 Ga0081540_1018686 3300005983 Bacteria 4243
49 Ga0068871_100096356 3300006358 Bacteria 2472
50 Ga0075428_100000364 3300006844 Bacteria 44975
51 Ga0075428_100179660 3300006844 Bacteria 2291
52 Ga0075428_100179991 3300006844 Bacteria 2289
53 Ga0075428_100207544 3300006844 Bacteria 2117
54 Ga0075428_100328685 3300006844 Bacteria 1642
55 Ga0075430_100005326 3300006846 Bacteria 10857
56 Ga0075431_100011595 3300006847 Bacteria 8888
57 Ga0075431_100061437 3300006847 Bacteria 3877
58 Ga0075433_10001659 3300006852 Bacteria 16554
59 Ga0075433_10016177 3300006852 Bacteria 6138
60 Ga0075433_10040886 3300006852 Bacteria 4015
61 Ga0075434_100001258 3300006871 Bacteria 21125
62 Ga0075429_100012193 3300006880 Bacteria 7451
63 Ga0068865_100041645 3300006881 Bacteria 3127
64 Ga0075436_100000001 3300006914 Bacteria 622380
65 Ga0075436_100032091 3300006914 Bacteria 3619
66 Ga0075436_100054795 3300006914 Bacteria 2753
67 Ga0097620_100007004 3300006931 Bacteria 11449
68 Ga0097620_100015381 3300006931 Bacteria 7687
69 Ga0097620_100092154 3300006931 Bacteria 3082
70 Ga0097620_100112515 3300006931 Bacteria 2785
71 Ga0075435_100002748 3300007076 Bacteria 11744
72 Ga0105240_10002004 3300009093 Bacteria 33588
73 Ga0111539_10017175 3300009094 Bacteria 8957
74 Ga0111539_10038174 3300009094 Bacteria 5794
75 Ga0114129_10011499 3300009147 Bacteria 12603
76 Ga0114129_10036685 3300009147 Bacteria 6921
77 Ga0114129_10041297 3300009147 Bacteria 6501
78 Ga0114129_10245881 3300009147 Bacteria 2403
79 Ga0105237_10004238 3300009545 Bacteria 16690
80 Ga0105238_10153513 3300009551 Bacteria 2277
81 Ga0105249_10137747 3300009553 Bacteria 2338
82 Ga0105249_10168118 3300009553 Bacteria 2124
83 Ga0163162_10047133 3300013306 Bacteria 4320
84 Ga0157375_10029594 3300013308 Bacteria 5153
85 Ga0157375_10083415 3300013308 Bacteria 3241
86 Ga0157375_10090231 3300013308 Bacteria 3123
87 Ga0163163_10063596 3300014325 Bacteria 3659
88 Ga0163163_10162442 3300014325 Bacteria 2279
89 Ga0182004_10021896 3300014486 Eukaryota 4757
90 Ga0157376_10004538 3300014969 Bacteria 9667
91 Ga0209566_100237 3300025225 Bacteria 53305
92 Ga0207697_10012496 3300025315 Bacteria 3559
93 Ga0207688_10082375 3300025901 Bacteria 1839
94 Ga0207645_10014772 3300025907 Bacteria 5214
95 Ga0207643_10005340 3300025908 Bacteria 6875
96 Ga0207684_10001310 3300025910 Bacteria 27343
97 Ga0207695_10005518 3300025913 Bacteria 16742
98 Ga0207646_10004015 3300025922 Bacteria 16287
99 Ga0207646_10018379 3300025922 Bacteria 6521
100 Ga0207646_10044952 3300025922 Bacteria 3964
101 Ga0207694_10111218 3300025924 Bacteria 2179
102 Ga0207650_10025335 3300025925 Bacteria 4225
103 Ga0207659_10106593 3300025926 Bacteria 2122
104 Ga0207664_10120837 3300025929 Bacteria 2192
105 Ga0207644_10000819 3300025931 Bacteria 19763
106 Ga0207706_10043490 3300025933 Bacteria 3980
107 Ga0207706_10192767 3300025933 Bacteria 1788
108 Ga0207704_10021312 3300025938 Bacteria 3449
109 Ga0207704_10030565 3300025938 Bacteria 3021
110 Ga0207691_10000978 3300025940 Bacteria 28398
111 Ga0207691_10222369 3300025940 Bacteria 1637
112 Ga0207689_10129702 3300025942 Bacteria 2075
113 Ga0207689_10143184 3300025942 Bacteria 1969
114 Ga0207668_10110105 3300025972 Bacteria 2064
115 Ga0207658_10116195 3300025986 Bacteria 2125
116 Ga0207703_10002721 3300026035 Bacteria 15151
117 Ga0207703_10152829 3300026035 Bacteria 2014
118 Ga0207641_10001044 3300026088 Bacteria 28005
119 Ga0207641_10254222 3300026088 Bacteria 1642
120 Ga0207648_10006162 3300026089 Bacteria 11952
121 Ga0207676_10022842 3300026095 Bacteria 4606
122 Ga0207675_100012160 3300026118 Bacteria 8040
123 Ga0207683_10008757 3300026121 Bacteria 8638
124 Ga0209999_1004757 3300027543 Bacteria 2440
125 Ga0209970_1002280 3300027614 Bacteria 3273
126 Ga0209983_1000818 3300027665 Bacteria 6798
127 Ga0209971_1001217 3300027682 Bacteria 6476
128 Ga0209974_10003546 3300027876 Bacteria 5613
129 Ga0268266_10000046 3300028379 Bacteria 312745
130 Ga0265338_10020178 3300028800 Bacteria 7024
131 Ga0307511_10000275 3300030521 Bacteria 53845
132 Ga0265332_10010247 3300031238 Bacteria 4173
133 Ga0265331_10026020 3300031250 Bacteria 2948
134 Ga0265331_10036045 3300031250 Bacteria 2432
135 Ga0265316_10000145 3300031344 Bacteria 77692
136 Ga0265316_10012402 3300031344 Bacteria 7646
137 Ga0265316_10026215 3300031344 Bacteria 4854
138 Ga0265316_10028539 3300031344 Bacteria 4603
139 Ga0265316_10030919 3300031344 Bacteria 4383
140 Ga0265316_10037774 3300031344 Bacteria 3894
141 Ga0265316_10117817 3300031344 Bacteria 2007
142 Ga0316579_10006127 3300031691 Bacteria 4887
143 Ga0265342_10000513 3300031712 Bacteria 41410
144 Ga0265342_10024355 3300031712 Bacteria 3822
145 Ga0373954_0089821 3300035118 Bacteria 1475
146 Ga0373956_0020689 3300035119 Bacteria 2803
147 Ga0316574_0009997 3300035398 Bacteria 5337
148 Ga0316574_0027157 3300035398 Bacteria 3447
149 Ga0373937_0020826 3300036401 Bacteria 5883
150 Ga0316582_0009030 3300036647 Bacteria 5388
151 Ga0316584_0172627 3300036712 Bacteria 1603
152 Ga0395905_0063507 3300037471 Bacteria 3455
153 Ga0400489_37299 3300039093 Bacteria 63307
154 Ga0436365_0044436 3300039437 Bacteria 8927
155 Ga0436365_0923171 3300039437 Bacteria 4786
156 Ga0451577_0000138 3300042876 Bacteria 161887
157 Ga0451577_0005897 3300042876 Bacteria 12374
158 Ga0451577_0028168 3300042876 Bacteria 5082
159 Ga0451577_0045064 3300042876 Bacteria 3948
160 Ga0451577_0132663 3300042876 Bacteria 2235
161 Ga0451577_0168797 3300042876 Bacteria 1971
162 Ga0466988_0002895 3300044536 Eukaryota 6789
163 Ga0466988_0051305 3300044536 Eukaryota 2420
164 Ga0466984_0015447 3300044649 Eukaryota 5167
165 Ga0466984_0048963 3300044649 Eukaryota 3064
166 Ga0466986_0006260 3300044650 Eukaryota 6800
167 Ga0466986_0035830 3300044650 Eukaryota 3392
168 Ga0466985_0009399 3300044651 Eukaryota 5958
169 Ga0466985_0017917 3300044651 Eukaryota 4629
170 Ga0466973_0017065 3300044659 Eukaryota 6902
171 Ga0466973_0023259 3300044659 Eukaryota 5932
172 Ga0466974_0014171 3300044660 Eukaryota 4832
173 Ga0466974_0077417 3300044660 Eukaryota 2218
174 Ga0466975_0007119 3300044661 Eukaryota 6565
175 Ga0466975_0011363 3300044661 Eukaryota 5586
176 Ga0466976_0009126 3300044662 Eukaryota 5044
177 Ga0466976_0020528 3300044662 Eukaryota 3729
178 Ga0466989_0009824 3300044663 Eukaryota 5046
179 Ga0466987_0027859 3300044665 Eukaryota 3440
180 Ga0466987_0052821 3300044665 Eukaryota 2556
181 Ga0466977_0008729 3300044666 Eukaryota 5650
182 Ga0466977_0011861 3300044666 Eukaryota 5040
183 Ga0466980_0001727 3300044668 Eukaryota 10110
184 Ga0466980_0009815 3300044668 Eukaryota 5920
185 Ga0466981_0008885 3300044669 Eukaryota 6312
186 Ga0466981_0015756 3300044669 Eukaryota 5100
187 Ga0466978_0007673 3300044671 Eukaryota 5648
188 Ga0466982_0003631 3300044672 Eukaryota 6761
189 Ga0453683_0001225 3300044673 Bacteria 22976
190 Ga0453684_0000466 3300044712 Bacteria 161109
191 Ga0453684_0003024 3300044712 Bacteria 39091
192 Ga0453684_0004746 3300044712 Bacteria 28076
193 Ga0453684_0006845 3300044712 Bacteria 21419
194 Ga0453684_0017574 3300044712 Bacteria 11063
195 Ga0453684_0032692 3300044712 Bacteria 7271
196 Ga0453684_0040620 3300044712 Bacteria 6312
197 Ga0453684_0042024 3300044712 Bacteria 6170
198 Ga0453684_0045215 3300044712 Bacteria 5877
199 Ga0453684_0062883 3300044712 Bacteria 4751
200 Ga0453684_0110175 3300044712 Bacteria 3347
201 Ga0453684_0122033 3300044712 Bacteria 3144
202 Ga0453684_0175003 3300044712 Bacteria 2525
203 Ga0453684_0176370 3300044712 Bacteria 2513
204 Ga0466959_0004790 3300045049 Bacteria 9130
205 Ga0451576_0000117 3300045051 Bacteria 206301
206 Ga0451576_0000912 3300045051 Bacteria 55998
207 Ga0451576_0002623 3300045051 Bacteria 26316
208 Ga0451576_0004090 3300045051 Bacteria 19262
209 Ga0451576_0037914 3300045051 Bacteria 5104
210 Ga0451576_0038770 3300045051 Bacteria 5043
211 Ga0495629_0000006 3300046459 Bacteria 389181
212 Ga0495629_0002226 3300046459 Bacteria 14959
213 Ga0495629_0061553 3300046459 Bacteria 2623
214 Ga0495580_0000368 3300046472 Bacteria 36781
215 Ga0495639_0024472 3300046475 Bacteria 2658
216 Ga0495630_0050121 3300046517 Bacteria 3124
217 Ga0495634_0102320 3300046642 Bacteria 1850
218 Ga0495635_0002060 3300046663 Bacteria 13617
219 Ga0495613_0029049 3300046689 Bacteria 4111
220 Ga0495581_0003189 3300047315 Bacteria 9387
221 Ga0495674_0237161 3300047319 Bacteria 1504
222 Ga0495680_0004022 3300047322 Bacteria 14185
223 Ga0495614_0005017 3300048089 Bacteria 5972
224 Ga0466979_0010203 3300048619 Eukaryota 6680
225 Ga0466979_0013465 3300048619 Eukaryota 5963
226 Ga0496102_0114374 3300048905 Bacteria 2518
227 Ga0496104_0322682 3300048907 Bacteria 1457
228 Ga0496110_0009744 3300048913 Bacteria 7781
229 Ga0496113_0237319 3300048916 Bacteria 1454
230 Ga0496122_0097896 3300048925 Bacteria 1972
231 Ga0496125_0002283 3300048928 Bacteria 25392
232 Ga0496125_0005228 3300048928 Bacteria 14550
233 Ga0466983_0011000 3300048986 Eukaryota 6842
234 Ga0466983_0059175 3300048986 Eukaryota 3217
235 Ga0501033_0060062 3300049570 Bacteria 2806
236 Ga0501038_0002837 3300049574 Bacteria 16119
237 Ga0501039_0014190 3300049575 Bacteria 6102
238 Ga0501039_0099834 3300049575 Bacteria 2265
239 Ga0501040_0005969 3300049576 Bacteria 7883
240 Ga0501040_0040790 3300049576 Bacteria 3160
241 Ga0501040_0161488 3300049576 Bacteria 1584
242 Ga0501041_0039736 3300049577 Bacteria 2855
243 Ga0501071_0015615 3300049587 Bacteria 5214
244 Ga0501072_0001389 3300049588 Bacteria 18217
245 Ga0501075_0000108 3300049591 Bacteria 39150
246 Ga0501075_0011054 3300049591 Bacteria 6371
247 Ga0501075_0030652 3300049591 Bacteria 3985
248 Ga0501076_0000967 3300049592 Bacteria 18822
249 Ga0501076_0041389 3300049592 Bacteria 3625
250 Ga0501079_0047626 3300049741 Bacteria 3308
251 Ga0501083_0002541 3300049744 Bacteria 12527
252 Ga0501045_0020670 3300049824 Bacteria 4704
253 nmdc:mga05p37_10226_c1 3300050507 Bacteria 11140
254 nmdc:mga05p37_420456_c1 3300050507 Bacteria 1555
255 nmdc:mga05p37_7867_c1 3300050507 Bacteria 12587
256 nmdc:mga09592_156322_c1 3300050508 Bacteria 1968
257 nmdc:mga09592_22048_c1 3300050508 Bacteria 5255
258 nmdc:mga0qj67_23158_c1 3300050509 Bacteria 4775
259 nmdc:mga06r32_39095_c1 3300050510 Bacteria 4500
260 nmdc:mga06r32_99550_c1 3300050510 Bacteria 2851
261 nmdc:mga08y16_41624_c1 3300050511 Bacteria 4812
262 nmdc:mga08y16_9122_c1 3300050511 Bacteria 10413
263 nmdc:mga0n895_212078_c1 3300050512 Bacteria 1967
264 nmdc:mga0n895_65056_c1 3300050512 Bacteria 3608
265 nmdc:mga0rr50_16604_c1 3300050513 Bacteria 4896
266 nmdc:mga08x19_1654_c2 3300050514 Bacteria 12492
267 nmdc:mga08x19_1_c1 3300050514 Bacteria 2010344
268 nmdc:mga08x19_74584_c1 3300050514 Bacteria 2217
269 nmdc:mga0a205_191700_c1 3300050515 Bacteria 1936
270 nmdc:mga0a205_20663_c1 3300050515 Bacteria 6217
271 nmdc:mga0a205_2630_c1 3300050515 Bacteria 15859
272 nmdc:mga0a205_58_c3 3300050515 Bacteria 28865
273 Ga0495612_0009812 3300053078 Bacteria 3877
274 Ga0495619_0006553 3300053085 Bacteria 7365
275 Ga0495619_0016380 3300053085 Bacteria 4693
276 Ga0501084_0152102 3300054114 Bacteria 1951
277 Ga0501082_0010642 3300060353 Bacteria 7919
278 Ga0530510_0000038 3300061734 Bacteria 60081
279 2787438436 2786546517 Bacteria 6614109
280 2787506826 2786546548 Bacteria 4745694
281 2837185603 2837183177 Bacteria 4637169
282 2857474781 2857472729 Bacteria 6568124
283 2929299210 2929297113 Bacteria 3141306
284 8002318056 8002317523 Bacteria 8051857
285 Ga0068858_100003075
286 rootH1_10008242
287 rootH2_10028126
288 rootH2_10038270
289 rootL2_10047096
290 Ga0065704_10122673
291 Ga0065707_10009094
292 Ga0070670_100003184
293 Ga0068869_100148046
294 Ga0070666_10019588
295 Ga0068868_100063365
296 Ga0070661_100092812
297 Ga0070675_100046700
298 Ga0070671_100000274
299 Ga0070688_100110930
300 Ga0070667_100054916
301 Ga0070701_10103162
302 Ga0070663_100035503
303 Ga0070662_100093661
304 Ga0070706_100001235
305 Ga0070706_100012896
306 Ga0070706_100174637
307 Ga0070707_100009731
308 Ga0070707_100014021
309 Ga0070707_100172561
310 Ga0070698_100010760
311 Ga0070698_100041064
312 Ga0070698_100055120
313 Ga0070697_100021644
314 Ga0070672_100072246
315 Ga0070695_100056806
316 Ga0070696_100011168
317 Ga0070665_100000037
318 Ga0070665_100080330
319 Ga0070664_100012459
320 Ga0068859_100007004
321 Ga0068859_100015382
322 Ga0068859_100092154
323 Ga0068859_100112515
324 Ga0068864_100003868
325 Ga0068864_100011401
326 Ga0068870_10009261
327 Ga0068863_100000999
328 Ga0068863_100056619
329 Ga0068863_100182759
330 Ga0081455_10017985
331 Ga0081538_10003088
332 Ga0081540_1018686
333 Ga0068871_100096356
334 Ga0075428_100000364
335 Ga0075428_100179660
336 Ga0075428_100179991
337 Ga0075428_100207544
338 Ga0075428_100328685
339 Ga0075430_100005326
340 Ga0075431_100011595
341 Ga0075431_100061437
342 Ga0075433_10001659
343 Ga0075433_10016177
344 Ga0075433_10040886
345 Ga0075434_100001258
346 Ga0075429_100012193
347 Ga0068865_100041645
348 Ga0075436_100000001
349 Ga0075436_100032091
350 Ga0075436_100054795
351 Ga0097620_100007004
352 Ga0097620_100015381
353 Ga0097620_100092154
354 Ga0097620_100112515
355 Ga0075435_100002748
356 Ga0105240_10002004
357 Ga0111539_10017175
358 Ga0111539_10038174
359 Ga0114129_10011499
360 Ga0114129_10036685
361 Ga0114129_10041297
362 Ga0114129_10245881
363 Ga0105237_10004238
364 Ga0105238_10153513
365 Ga0105249_10137747
366 Ga0105249_10168118
367 Ga0163162_10047133
368 Ga0157375_10029594
369 Ga0157375_10083415
370 Ga0157375_10090231
371 Ga0163163_10063596
372 Ga0163163_10162442
373 Ga0182004_10021896
374 Ga0157376_10004538
375 Ga0209566_100237
376 Ga0207697_10012496
377 Ga0207688_10082375
378 Ga0207645_10014772
379 Ga0207643_10005340
380 Ga0207684_10001310
381 Ga0207695_10005518
382 Ga0207646_10004015
383 Ga0207646_10018379
384 Ga0207646_10044952
385 Ga0207694_10111218
386 Ga0207650_10025335
387 Ga0207659_10106593
388 Ga0207664_10120837
389 Ga0207644_10000819
390 Ga0207706_10043490
391 Ga0207706_10192767
392 Ga0207704_10021312
393 Ga0207704_10030565
394 Ga0207691_10000978
395 Ga0207691_10222369
396 Ga0207689_10129702
397 Ga0207689_10143184
398 Ga0207668_10110105
399 Ga0207658_10116195
400 Ga0207703_10002721
401 Ga0207703_10152829
402 Ga0207641_10001044
403 Ga0207641_10254222
404 Ga0207648_10006162
405 Ga0207676_10022842
406 Ga0207675_100012160
407 Ga0207683_10008757
408 Ga0209999_1004757
409 Ga0209970_1002280
410 Ga0209983_1000818
411 Ga0209971_1001217
412 Ga0209974_10003546
413 Ga0268266_10000046
414 Ga0265338_10020178
415 Ga0307511_10000275
416 Ga0265332_10010247
417 Ga0265331_10026020
418 Ga0265331_10036045
419 Ga0265316_10000145
420 Ga0265316_10012402
421 Ga0265316_10026215
422 Ga0265316_10028539
423 Ga0265316_10030919
424 Ga0265316_10037774
425 Ga0265316_10117817
426 Ga0316579_10006127
427 Ga0265342_10000513
428 Ga0265342_10024355
429 Ga0373954_0089821
430 Ga0373956_0020689
431 Ga0316574_0009997
432 Ga0316574_0027157
433 Ga0373937_0020826
434 Ga0316582_0009030
435 Ga0316584_0172627
436 Ga0395905_0063507
437 Ga0400489_37299
438 Ga0436365_0044436
439 Ga0436365_0923171
440 Ga0451577_0000138
441 Ga0451577_0005897
442 Ga0451577_0028168
443 Ga0451577_0045064
444 Ga0451577_0132663
445 Ga0451577_0168797
446 Ga0466988_0002895
447 Ga0466988_0051305
448 Ga0466984_0015447
449 Ga0466984_0048963
450 Ga0466986_0006260
451 Ga0466986_0035830
452 Ga0466985_0009399
453 Ga0466985_0017917
454 Ga0466973_0017065
455 Ga0466973_0023259
456 Ga0466974_0014171
457 Ga0466974_0077417
458 Ga0466975_0007119
459 Ga0466975_0011363
460 Ga0466976_0009126
461 Ga0466976_0020528
462 Ga0466989_0009824
463 Ga0466987_0027859
464 Ga0466987_0052821
465 Ga0466977_0008729
466 Ga0466977_0011861
467 Ga0466980_0001727
468 Ga0466980_0009815
469 Ga0466981_0008885
470 Ga0466981_0015756
471 Ga0466978_0007673
472 Ga0466982_0003631
473 Ga0453683_0001225
474 Ga0453684_0000466
475 Ga0453684_0003024
476 Ga0453684_0004746
477 Ga0453684_0006845
478 Ga0453684_0017574
479 Ga0453684_0032692
480 Ga0453684_0040620
481 Ga0453684_0042024
482 Ga0453684_0045215
483 Ga0453684_0062883
484 Ga0453684_0110175
485 Ga0453684_0122033
486 Ga0453684_0175003
487 Ga0453684_0176370
488 Ga0466959_0004790
489 Ga0451576_0000117
490 Ga0451576_0000912
491 Ga0451576_0002623
492 Ga0451576_0004090
493 Ga0451576_0037914
494 Ga0451576_0038770
495 Ga0495629_0000006
496 Ga0495629_0002226
497 Ga0495629_0061553
498 Ga0495580_0000368
499 Ga0495639_0024472
500 Ga0495630_0050121
501 Ga0495634_0102320
502 Ga0495635_0002060
503 Ga0495613_0029049
504 Ga0495581_0003189
505 Ga0495674_0237161
506 Ga0495680_0004022
507 Ga0495614_0005017
508 Ga0466979_0010203
509 Ga0466979_0013465
510 Ga0496102_0114374
511 Ga0496104_0322682
512 Ga0496110_0009744
513 Ga0496113_0237319
514 Ga0496122_0097896
515 Ga0496125_0002283
516 Ga0496125_0005228
517 Ga0466983_0011000
518 Ga0466983_0059175
519 Ga0501033_0060062
520 Ga0501038_0002837
521 Ga0501039_0014190
522 Ga0501039_0099834
523 Ga0501040_0005969
524 Ga0501040_0040790
525 Ga0501040_0161488
526 Ga0501041_0039736
527 Ga0501071_0015615
528 Ga0501072_0001389
529 Ga0501075_0000108
530 Ga0501075_0011054
531 Ga0501075_0030652
532 Ga0501076_0000967
533 Ga0501076_0041389
534 Ga0501079_0047626
535 Ga0501083_0002541
536 Ga0501045_0020670
537 nmdc:mga05p37_10226_c1
538 nmdc:mga05p37_420456_c1
539 nmdc:mga05p37_7867_c1
540 nmdc:mga09592_156322_c1
541 nmdc:mga09592_22048_c1
542 nmdc:mga0qj67_23158_c1
543 nmdc:mga06r32_39095_c1
544 nmdc:mga06r32_99550_c1
545 nmdc:mga08y16_41624_c1
546 nmdc:mga08y16_9122_c1
547 nmdc:mga0n895_212078_c1
548 nmdc:mga0n895_65056_c1
549 nmdc:mga0rr50_16604_c1
550 nmdc:mga08x19_1654_c2
551 nmdc:mga08x19_1_c1
552 nmdc:mga08x19_74584_c1
553 nmdc:mga0a205_191700_c1
554 nmdc:mga0a205_20663_c1
555 nmdc:mga0a205_2630_c1
556 nmdc:mga0a205_58_c3
557 Ga0495612_0009812
558 Ga0495619_0006553
559 Ga0495619_0016380
560 Ga0501084_0152102
561 Ga0501082_0010642
562 Ga0530510_0000038
563 2787438436
564 2787506826
565 2837185603
566 2857474781
567 2929299210
568 8002318056

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13537

GATase_7

Glutamine amidotransferase domain

137

265

0.91

PF13522

GATase_6

Glutamine amidotransferase domain

121

260

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lbp-assembly1.cif.gz_A structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana 0.9741 50 501
6lbp-assembly1.cif.gz_A structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana 0.947 50 501
1ao0-assembly1.cif.gz_C glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. subtilis complexed with adp and gmp 0.9324 50 499
1gph-assembly1.cif.gz_1 structure of the allosteric regulatory enzyme of purine biosynthesis 0.9296 50 505
1ao0-assembly1.cif.gz_C glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. subtilis complexed with adp and gmp 0.9204 50 499
ID Description Score Start End Superfamily
af_P38620_200_307_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9683 390 427 3.40.50.2020
af_Q22134_287_448_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9665 315 475 3.40.50.2020
1gph401 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9637 50 311 3.60.20.10
af_P0A717_198_307_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.963 396 427 3.40.50.2020
1ao0B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9617 314 477 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A452Z6P1-F1-model_v4 Amidophosphoribosyltransferase (ATase) (EC 2.4.2.14) (Glutamine phosphoribosylpyrophosphate amidotransferase) 0.9907 63 507 GO:0004044
GO:0006189
GO:0009113
GO:0046872
GO:0051536
AF-A0A7J7H359-F1-model_v4 Amidophosphoribosyltransferase (ATase) (EC 2.4.2.14) (Glutamine phosphoribosylpyrophosphate amidotransferase) 0.988 134 501 GO:0004044
GO:0006189
GO:0009113
GO:0046872
GO:0051536
AF-A0A2H5QVJ4-F1-model_v4 Glutamine amidotransferase type-2 domain-containing protein 0.9842 73 322
AF-A0A382JGK8-F1-model_v4 Glutamine amidotransferase type-2 domain-containing protein 0.9828 50 351
AF-A0A7J9G1Z3-F1-model_v4 amidophosphoribosyltransferase (EC 2.4.2.14) 0.9824 165 501 GO:0004044
GO:0006189
GO:0009113
GO:0051536

Map