F386019

General Info

Members Datasets Scaffolds Average Seq Length
284 170 568 131

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100277415|Ga0070668_1002774152
Length 149
Sequence LSAGAAEEAATAAGTQRLDKWLWFARFVKTRTLATDIVAAGKVRLNRVRIDKPAQTVRAGDVLTLNLNRRIQLVRVLGIAERRGPSAAARALYEELTAEGDVIKPQSSSSPPGAGRQPSEGGPIRRPVGSGRPTKKERREIDRLNGKGR

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
91 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
106 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
107 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
108 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
109 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
147 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
148 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 2534681786 Brucella suis 92/29 Isolate Unclassified
153 2643221613 Oerskovia sp. Root22 Isolate Unclassified
154 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
155 2643221721 Oerskovia sp. Root918 Isolate Unclassified
156 2738543024 Aminobacter sp. AP02 Isolate Unclassified
157 2751185800 Brucella pituitosa AA2 Isolate Unclassified
158 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
159 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
160 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
161 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
162 2854911287 Brucella lupini LUP21 Isolate Unclassified
163 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
164 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
165 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
166 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
167 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
168 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
169 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
170 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.31
Metatranscriptomes 0
Isolates 6.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.93
Nodule 0.7
Rhizoplane 2.82
Rhizosphere 85.56
Stem 0
Stem Tuber 0
Unclassified 4.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100277415 3300005347 Bacteria 1399
2 Ga0065707_10208081 3300005295 Bacteria 1278
3 Ga0070690_100142333 3300005330 Bacteria 1629
4 Ga0068869_100310104 3300005334 Bacteria 1277
5 Ga0070689_100558421 3300005340 Bacteria 987
6 Ga0070668_100699203 3300005347 Bacteria 894
7 Ga0070668_101010073 3300005347 Bacteria 748
8 Ga0070669_101464883 3300005353 Bacteria 593
9 Ga0070671_100630729 3300005355 Bacteria 927
10 Ga0070673_100225803 3300005364 Bacteria 1623
11 Ga0070673_101549637 3300005364 Bacteria 625
12 Ga0070667_101068292 3300005367 Bacteria 754
13 Ga0070705_100157268 3300005440 Bacteria 1515
14 Ga0070694_100127752 3300005444 Bacteria 1832
15 Ga0070694_100372286 3300005444 Bacteria 1112
16 Ga0070662_100871922 3300005457 Bacteria 767
17 Ga0070662_101192434 3300005457 Bacteria 654
18 Ga0070699_101297182 3300005518 Bacteria 668
19 Ga0070686_100111486 3300005544 Bacteria 1865
20 Ga0070686_100115317 3300005544 Bacteria 1837
21 Ga0070695_100096057 3300005545 Bacteria 1987
22 Ga0070696_100398813 3300005546 Bacteria 1076
23 Ga0070693_100302961 3300005547 Bacteria 1078
24 Ga0070665_100317531 3300005548 Bacteria 1562
25 Ga0070704_100248470 3300005549 Viruses 1459
26 Ga0070704_100419614 3300005549 Bacteria 1145
27 Ga0068857_100074494 3300005577 Bacteria 3025
28 Ga0068854_100857128 3300005578 Bacteria 796
29 Ga0070702_100049576 3300005615 Bacteria 2395
30 Ga0068859_100012675 3300005617 Bacteria 8477
31 Ga0068859_100068004 3300005617 Bacteria 3597
32 Ga0068859_100659169 3300005617 Bacteria 1138
33 Ga0068866_10887041 3300005718 Unclassified 626
34 Ga0068861_100021200 3300005719 Bacteria 4669
35 Ga0068863_100522839 3300005841 Bacteria 1170
36 Ga0068858_100252440 3300005842 Bacteria 1676
37 Ga0068858_100665348 3300005842 Bacteria 1012
38 Ga0068860_100705765 3300005843 Bacteria 1019
39 Ga0068862_100089944 3300005844 Bacteria 2672
40 Ga0081455_10011326 3300005937 Bacteria 8971
41 Ga0081539_10002530 3300005985 Bacteria 25517
42 Ga0075365_10049484 3300006038 Bacteria 2769
43 Ga0075365_10346402 3300006038 Bacteria 1047
44 Ga0075366_10461688 3300006195 Bacteria 784
45 Ga0075370_10384580 3300006353 Bacteria 841
46 Ga0075430_100594368 3300006846 Bacteria 913
47 Ga0075433_10018474 3300006852 Bacteria 5796
48 Ga0075434_100113933 3300006871 Bacteria 2716
49 Ga0068865_101021179 3300006881 Archaea 725
50 Ga0075436_100728190 3300006914 Bacteria 736
51 Ga0097620_100012675 3300006931 Bacteria 8477
52 Ga0097620_100068004 3300006931 Bacteria 3597
53 Ga0097620_100659210 3300006931 Bacteria 1138
54 Ga0075435_100020594 3300007076 Bacteria 5058
55 Ga0075435_100152282 3300007076 Bacteria 1945
56 Ga0105244_10127328 3300009036 Bacteria 1230
57 Ga0105247_10120642 3300009101 Bacteria 1698
58 Ga0105247_10185990 3300009101 Bacteria 1389
59 Ga0105243_10154551 3300009148 Bacteria 1971
60 Ga0105243_10543668 3300009148 Bacteria 1109
61 Ga0105241_10362552 3300009174 Bacteria 1262
62 Ga0105248_10023605 3300009177 Bacteria 6833
63 Ga0105248_11166167 3300009177 Bacteria 871
64 Ga0105249_10240899 3300009553 Bacteria 1788
65 Ga0099796_10534101 3300010159 Bacteria 527
66 Ga0105239_10428698 3300010375 Bacteria 1499
67 Ga0105239_11986248 3300010375 Bacteria 675
68 Ga0105246_10067041 3300011119 Bacteria 2514
69 Ga0157369_10262454 3300013105 Bacteria 1801
70 Ga0157378_10119113 3300013297 Bacteria 2431
71 Ga0157378_10205911 3300013297 Bacteria 1863
72 Ga0163162_10799389 3300013306 Bacteria 1061
73 Ga0157375_10171342 3300013308 Bacteria 2318
74 Ga0157375_12259839 3300013308 Bacteria 648
75 Ga0163163_10082694 3300014325 Bacteria 3215
76 Ga0163163_10753707 3300014325 Bacteria 1037
77 Ga0157380_10246008 3300014326 Bacteria 1616
78 Ga0157379_10103268 3300014968 Bacteria 2558
79 Ga0157379_10348222 3300014968 Bacteria 1356
80 Ga0157376_12704882 3300014969 Unclassified 536
81 Ga0209025_1072523 3300025294 Bacteria 1214
82 Ga0207642_11110461 3300025899 Bacteria 511
83 Ga0207710_10103159 3300025900 Bacteria 1347
84 Ga0207710_10103488 3300025900 Bacteria 1345
85 Ga0207646_11705748 3300025922 Bacteria 541
86 Ga0207706_10328512 3300025933 Bacteria 1330
87 Ga0207669_10815146 3300025937 Bacteria 775
88 Ga0207704_10165940 3300025938 Bacteria 1577
89 Ga0207704_10363387 3300025938 Bacteria 1131
90 Ga0207711_10031712 3300025941 Bacteria 4463
91 Ga0207711_11105498 3300025941 Bacteria 733
92 Ga0207689_10412774 3300025942 Bacteria 1126
93 Ga0207689_11448703 3300025942 Bacteria 575
94 Ga0207667_10950743 3300025949 Bacteria 849
95 Ga0207651_10857340 3300025960 Bacteria 807
96 Ga0207712_10111878 3300025961 Bacteria 2050
97 Ga0207668_10417539 3300025972 Bacteria 1138
98 Ga0207703_10365853 3300026035 Bacteria 1331
99 Ga0207703_10405367 3300026035 Bacteria 1266
100 Ga0207674_10019125 3300026116 Bacteria 7424
101 Ga0207675_100022518 3300026118 Bacteria 5866
102 Ga0207675_100096342 3300026118 Bacteria 2785
103 Ga0207675_100847509 3300026118 Bacteria 929
104 Ga0268265_10168016 3300028380 Bacteria 1871
105 Ga0268264_10550326 3300028381 Bacteria 1132
106 Ga0268264_11054377 3300028381 Bacteria 820
107 Ga0265327_10001524 3300031251 Bacteria 28621
108 Ga0307513_10498774 3300031456 Bacteria 935
109 Ga0307408_100483232 3300031548 Bacteria 1081
110 Ga0307408_102016355 3300031548 Bacteria 555
111 Ga0307410_10623544 3300031852 Bacteria 902
112 Ga0307412_11133595 3300031911 Bacteria 697
113 Ga0307409_101430840 3300031995 Bacteria 718
114 Ga0307416_100179899 3300032002 Bacteria 1980
115 Ga0307411_11473897 3300032005 Unclassified 625
116 Ga0307411_11908520 3300032005 Bacteria 553
117 Ga0307415_101220141 3300032126 Bacteria 709
118 Ga0307415_102028457 3300032126 Unclassified 561
119 Ga0373926_0204816 3300035083 Viruses 760
120 Ga0373931_0823523 3300035691 Unclassified 620
121 Ga0395898_0158842 3300037466 Bacteria 2162
122 Ga0395898_0754797 3300037466 Bacteria 914
123 Ga0395901_0250145 3300038443 Bacteria 1847
124 Ga0439438_108276 3300041405 Bacteria 672
125 Ga0439465_0021655 3300041413 Bacteria 2017
126 Ga0439465_0153737 3300041413 Bacteria 823
127 Ga0451576_2398604 3300045051 Bacteria 540
128 Ga0495638_0104129 3300046460 Unclassified 1693
129 Ga0495597_0366827 3300046542 Unclassified 551
130 Ga0495625_0437193 3300046660 Bacteria 811
131 Ga0495658_0161316 3300046683 Bacteria 1383
132 Ga0495672_0485857 3300047320 Bacteria 551
133 Ga0496102_0498748 3300048905 Bacteria 1139
134 Ga0496108_0039825 3300048911 Bacteria 3917
135 Ga0496109_0039357 3300048912 Bacteria 4279
136 Ga0496110_0031103 3300048913 Bacteria 4604
137 Ga0496111_0039927 3300048914 Bacteria 3367
138 Ga0496113_0122549 3300048916 Bacteria 2034
139 Ga0496115_0099932 3300048918 Bacteria 2378
140 Ga0496119_0023201 3300048922 Bacteria 4412
141 Ga0496120_0067066 3300048923 Bacteria 1983
142 Ga0496121_0098856 3300048924 Bacteria 2257
143 Ga0496124_0057965 3300048927 Bacteria 3260
144 Ga0496125_0040877 3300048928 Bacteria 3971
145 Ga0501031_0007683 3300049568 Bacteria 7018
146 Ga0501031_0472866 3300049568 Bacteria 809
147 Ga0501032_0016786 3300049569 Bacteria 5144
148 Ga0501033_0033514 3300049570 Bacteria 3856
149 Ga0501033_0069474 3300049570 Bacteria 2589
150 Ga0501033_0080920 3300049570 Bacteria 2383
151 Ga0501033_0098814 3300049570 Bacteria 2131
152 Ga0501033_0099210 3300049570 Bacteria 2126
153 Ga0501033_0542696 3300049570 Bacteria 801
154 Ga0501034_0000046 3300049571 Bacteria 224049
155 Ga0501034_0005230 3300049571 Bacteria 14239
156 Ga0501034_0062481 3300049571 Bacteria 3740
157 Ga0501034_0090641 3300049571 Bacteria 3055
158 Ga0501034_0376941 3300049571 Bacteria 1344
159 Ga0501034_0681092 3300049571 Bacteria 928
160 Ga0501034_0912096 3300049571 Bacteria 766
161 Ga0501036_0008545 3300049572 Bacteria 8396
162 Ga0501036_0010092 3300049572 Bacteria 7783
163 Ga0501036_0106734 3300049572 Bacteria 2368
164 Ga0501037_0000733 3300049573 Bacteria 24889
165 Ga0501037_0003375 3300049573 Bacteria 11608
166 Ga0501037_0080960 3300049573 Bacteria 2355
167 Ga0501038_0005773 3300049574 Bacteria 11464
168 Ga0501038_0036990 3300049574 Bacteria 4282
169 Ga0501038_0067443 3300049574 Bacteria 3044
170 Ga0501038_0078280 3300049574 Bacteria 2790
171 Ga0501038_0081922 3300049574 Bacteria 2718
172 Ga0501038_0162043 3300049574 Bacteria 1817
173 Ga0501038_0827492 3300049574 Unclassified 687
174 Ga0501039_0000174 3300049575 Bacteria 45337
175 Ga0501039_0036257 3300049575 Bacteria 3805
176 Ga0501039_0259236 3300049575 Bacteria 1367
177 Ga0501039_0700462 3300049575 Bacteria 792
178 Ga0501039_0805990 3300049575 Bacteria 732
179 Ga0501040_0087506 3300049576 Bacteria 2163
180 Ga0501040_1032891 3300049576 Unclassified 596
181 Ga0501042_0095564 3300049578 Bacteria 2135
182 Ga0501043_0014031 3300049579 Bacteria 6270
183 Ga0501043_0201470 3300049579 Bacteria 1545
184 Ga0501046_0002066 3300049580 Bacteria 19046
185 Ga0501046_0011834 3300049580 Bacteria 7449
186 Ga0501047_0000258 3300049581 Bacteria 61962
187 Ga0501047_0025566 3300049581 Bacteria 5676
188 Ga0501047_0033681 3300049581 Bacteria 4943
189 Ga0501047_0059488 3300049581 Bacteria 3688
190 Ga0501047_0232977 3300049581 Bacteria 1694
191 Ga0501047_0291675 3300049581 Bacteria 1475
192 Ga0501047_0468448 3300049581 Bacteria 1088
193 Ga0501047_1017530 3300049581 Bacteria 642
194 Ga0501048_0007163 3300049582 Bacteria 8473
195 Ga0501067_0000255 3300049583 Bacteria 29230
196 Ga0501068_0195049 3300049584 Bacteria 1284
197 Ga0501068_0467923 3300049584 Bacteria 816
198 Ga0501068_0675149 3300049584 Bacteria 675
199 Ga0501069_0042346 3300049585 Bacteria 2519
200 Ga0501070_0000525 3300049586 Bacteria 35201
201 Ga0501070_0002263 3300049586 Bacteria 16922
202 Ga0501070_0156935 3300049586 Bacteria 1876
203 Ga0501070_0297166 3300049586 Bacteria 1316
204 Ga0501070_0347361 3300049586 Bacteria 1204
205 Ga0501070_0405260 3300049586 Bacteria 1103
206 Ga0501070_0703428 3300049586 Bacteria 799
207 Ga0501071_0058605 3300049587 Bacteria 2785
208 Ga0501071_0551569 3300049587 Bacteria 885
209 Ga0501072_0030615 3300049588 Bacteria 4210
210 Ga0501072_1141218 3300049588 Unclassified 606
211 Ga0501073_0009256 3300049589 Bacteria 7265
212 Ga0501073_0132367 3300049589 Bacteria 1729
213 Ga0501073_0133849 3300049589 Bacteria 1718
214 Ga0501073_0440892 3300049589 Bacteria 900
215 Ga0501074_0074241 3300049590 Bacteria 2442
216 Ga0501075_0087857 3300049591 Bacteria 2356
217 Ga0501076_1117149 3300049592 Bacteria 649
218 Ga0501077_0024861 3300049593 Bacteria 3803
219 Ga0501079_0073944 3300049741 Bacteria 2634
220 Ga0501080_0000032 3300049742 Bacteria 86373
221 Ga0501080_0001418 3300049742 Bacteria 20101
222 Ga0501080_0146513 3300049742 Bacteria 2183
223 Ga0501080_0284704 3300049742 Bacteria 1502
224 Ga0501080_0335794 3300049742 Bacteria 1366
225 Ga0501080_0687969 3300049742 Bacteria 903
226 Ga0501080_1040484 3300049742 Bacteria 709
227 Ga0501081_0517887 3300049743 Bacteria 889
228 Ga0501035_0000454 3300049822 Bacteria 45808
229 Ga0501035_0000634 3300049822 Bacteria 38769
230 Ga0501035_0001308 3300049822 Bacteria 25746
231 Ga0501035_0039913 3300049822 Bacteria 4244
232 Ga0501035_0045850 3300049822 Bacteria 3932
233 Ga0501035_0181495 3300049822 Bacteria 1813
234 Ga0501035_0328032 3300049822 Bacteria 1285
235 Ga0501035_0450688 3300049822 Bacteria 1064
236 Ga0501044_0000020 3300049823 Bacteria 213460
237 Ga0501044_0003751 3300049823 Bacteria 17076
238 Ga0501044_0007460 3300049823 Bacteria 12028
239 Ga0501044_0014712 3300049823 Bacteria 8436
240 Ga0501044_0064361 3300049823 Bacteria 3744
241 Ga0501044_0173906 3300049823 Bacteria 2123
242 Ga0501044_0191697 3300049823 Bacteria 2006
243 Ga0501044_0319227 3300049823 Bacteria 1478
244 Ga0501045_0029215 3300049824 Bacteria 3983
245 Ga0501045_0030868 3300049824 Bacteria 3880
246 Ga0501045_0065627 3300049824 Bacteria 2665
247 nmdc:mga0yw44_137634_c1 3300050492 Bacteria 1585
248 nmdc:mga0yw44_308709_c1 3300050492 Bacteria 1061
249 nmdc:mga0yw44_420959_c1 3300050492 Bacteria 904
250 nmdc:mga07m45_292478_c1 3300050496 Bacteria 947
251 nmdc:mga0qj67_523378_c1 3300050509 Bacteria 952
252 nmdc:mga0rr50_274065_c1 3300050513 Bacteria 1407
253 nmdc:mga0rr50_309329_c1 3300050513 Bacteria 1323
254 nmdc:mga08x19_831310_c1 3300050514 Unclassified 656
255 Ga0500643_012988 3300053087 Bacteria 2962
256 Ga0500554_102352 3300053102 Bacteria 959
257 Ga0500556_0000082 3300053104 Bacteria 89905
258 Ga0500616_0015994 3300053153 Bacteria 4280
259 Ga0500616_0356882 3300053153 Unclassified 593
260 Ga0501084_0048146 3300054114 Bacteria 3569
261 Ga0501084_0836049 3300054114 Unclassified 775
262 Ga0501082_0006553 3300060353 Bacteria 10086
263 Ga0501082_0056739 3300060353 Bacteria 3374
264 Ga0501082_0428111 3300060353 Bacteria 1156
265 Ga0501082_0773679 3300060353 Unclassified 840
266 2535485831 2534681786 Bacteria 3308809
267 2644081096 2643221613 Bacteria 4622396
268 2644131349 2643221623 Bacteria 5239945
269 2644663593 2643221721 Bacteria 4486924
270 2739306266 2738543024 Bacteria 5603683
271 2753360226 2751185800 Bacteria 5467370
272 2757572685 2757320392 Bacteria 3737298
273 2765468078 2765235802 Bacteria 5618596
274 2768644914 2767802112 Bacteria 6465194
275 2840766152 2840764183 Bacteria 6358399
276 2854913035 2854911287 Bacteria 5582813
277 2894653955 2894652903 Bacteria 4587256
278 2904580201 2904578770 Bacteria 5302906
279 2915654270 2915650412 Bacteria 4288180
280 2919120126 2919119836 Bacteria 5208557
281 2935892754 2935890801 Bacteria 4593001
282 2996339549 2996336353 Bacteria 5511628
283 3002141458 3002141150 Bacteria 5254435
284 8002290544 8002285264 Bacteria 6717907
285 Ga0070668_100277415
286 Ga0065707_10208081
287 Ga0070690_100142333
288 Ga0068869_100310104
289 Ga0070689_100558421
290 Ga0070668_100699203
291 Ga0070668_101010073
292 Ga0070669_101464883
293 Ga0070671_100630729
294 Ga0070673_100225803
295 Ga0070673_101549637
296 Ga0070667_101068292
297 Ga0070705_100157268
298 Ga0070694_100127752
299 Ga0070694_100372286
300 Ga0070662_100871922
301 Ga0070662_101192434
302 Ga0070699_101297182
303 Ga0070686_100111486
304 Ga0070686_100115317
305 Ga0070695_100096057
306 Ga0070696_100398813
307 Ga0070693_100302961
308 Ga0070665_100317531
309 Ga0070704_100248470
310 Ga0070704_100419614
311 Ga0068857_100074494
312 Ga0068854_100857128
313 Ga0070702_100049576
314 Ga0068859_100012675
315 Ga0068859_100068004
316 Ga0068859_100659169
317 Ga0068866_10887041
318 Ga0068861_100021200
319 Ga0068863_100522839
320 Ga0068858_100252440
321 Ga0068858_100665348
322 Ga0068860_100705765
323 Ga0068862_100089944
324 Ga0081455_10011326
325 Ga0081539_10002530
326 Ga0075365_10049484
327 Ga0075365_10346402
328 Ga0075366_10461688
329 Ga0075370_10384580
330 Ga0075430_100594368
331 Ga0075433_10018474
332 Ga0075434_100113933
333 Ga0068865_101021179
334 Ga0075436_100728190
335 Ga0097620_100012675
336 Ga0097620_100068004
337 Ga0097620_100659210
338 Ga0075435_100020594
339 Ga0075435_100152282
340 Ga0105244_10127328
341 Ga0105247_10120642
342 Ga0105247_10185990
343 Ga0105243_10154551
344 Ga0105243_10543668
345 Ga0105241_10362552
346 Ga0105248_10023605
347 Ga0105248_11166167
348 Ga0105249_10240899
349 Ga0099796_10534101
350 Ga0105239_10428698
351 Ga0105239_11986248
352 Ga0105246_10067041
353 Ga0157369_10262454
354 Ga0157378_10119113
355 Ga0157378_10205911
356 Ga0163162_10799389
357 Ga0157375_10171342
358 Ga0157375_12259839
359 Ga0163163_10082694
360 Ga0163163_10753707
361 Ga0157380_10246008
362 Ga0157379_10103268
363 Ga0157379_10348222
364 Ga0157376_12704882
365 Ga0209025_1072523
366 Ga0207642_11110461
367 Ga0207710_10103159
368 Ga0207710_10103488
369 Ga0207646_11705748
370 Ga0207706_10328512
371 Ga0207669_10815146
372 Ga0207704_10165940
373 Ga0207704_10363387
374 Ga0207711_10031712
375 Ga0207711_11105498
376 Ga0207689_10412774
377 Ga0207689_11448703
378 Ga0207667_10950743
379 Ga0207651_10857340
380 Ga0207712_10111878
381 Ga0207668_10417539
382 Ga0207703_10365853
383 Ga0207703_10405367
384 Ga0207674_10019125
385 Ga0207675_100022518
386 Ga0207675_100096342
387 Ga0207675_100847509
388 Ga0268265_10168016
389 Ga0268264_10550326
390 Ga0268264_11054377
391 Ga0265327_10001524
392 Ga0307513_10498774
393 Ga0307408_100483232
394 Ga0307408_102016355
395 Ga0307410_10623544
396 Ga0307412_11133595
397 Ga0307409_101430840
398 Ga0307416_100179899
399 Ga0307411_11473897
400 Ga0307411_11908520
401 Ga0307415_101220141
402 Ga0307415_102028457
403 Ga0373926_0204816
404 Ga0373931_0823523
405 Ga0395898_0158842
406 Ga0395898_0754797
407 Ga0395901_0250145
408 Ga0439438_108276
409 Ga0439465_0021655
410 Ga0439465_0153737
411 Ga0451576_2398604
412 Ga0495638_0104129
413 Ga0495597_0366827
414 Ga0495625_0437193
415 Ga0495658_0161316
416 Ga0495672_0485857
417 Ga0496102_0498748
418 Ga0496108_0039825
419 Ga0496109_0039357
420 Ga0496110_0031103
421 Ga0496111_0039927
422 Ga0496113_0122549
423 Ga0496115_0099932
424 Ga0496119_0023201
425 Ga0496120_0067066
426 Ga0496121_0098856
427 Ga0496124_0057965
428 Ga0496125_0040877
429 Ga0501031_0007683
430 Ga0501031_0472866
431 Ga0501032_0016786
432 Ga0501033_0033514
433 Ga0501033_0069474
434 Ga0501033_0080920
435 Ga0501033_0098814
436 Ga0501033_0099210
437 Ga0501033_0542696
438 Ga0501034_0000046
439 Ga0501034_0005230
440 Ga0501034_0062481
441 Ga0501034_0090641
442 Ga0501034_0376941
443 Ga0501034_0681092
444 Ga0501034_0912096
445 Ga0501036_0008545
446 Ga0501036_0010092
447 Ga0501036_0106734
448 Ga0501037_0000733
449 Ga0501037_0003375
450 Ga0501037_0080960
451 Ga0501038_0005773
452 Ga0501038_0036990
453 Ga0501038_0067443
454 Ga0501038_0078280
455 Ga0501038_0081922
456 Ga0501038_0162043
457 Ga0501038_0827492
458 Ga0501039_0000174
459 Ga0501039_0036257
460 Ga0501039_0259236
461 Ga0501039_0700462
462 Ga0501039_0805990
463 Ga0501040_0087506
464 Ga0501040_1032891
465 Ga0501042_0095564
466 Ga0501043_0014031
467 Ga0501043_0201470
468 Ga0501046_0002066
469 Ga0501046_0011834
470 Ga0501047_0000258
471 Ga0501047_0025566
472 Ga0501047_0033681
473 Ga0501047_0059488
474 Ga0501047_0232977
475 Ga0501047_0291675
476 Ga0501047_0468448
477 Ga0501047_1017530
478 Ga0501048_0007163
479 Ga0501067_0000255
480 Ga0501068_0195049
481 Ga0501068_0467923
482 Ga0501068_0675149
483 Ga0501069_0042346
484 Ga0501070_0000525
485 Ga0501070_0002263
486 Ga0501070_0156935
487 Ga0501070_0297166
488 Ga0501070_0347361
489 Ga0501070_0405260
490 Ga0501070_0703428
491 Ga0501071_0058605
492 Ga0501071_0551569
493 Ga0501072_0030615
494 Ga0501072_1141218
495 Ga0501073_0009256
496 Ga0501073_0132367
497 Ga0501073_0133849
498 Ga0501073_0440892
499 Ga0501074_0074241
500 Ga0501075_0087857
501 Ga0501076_1117149
502 Ga0501077_0024861
503 Ga0501079_0073944
504 Ga0501080_0000032
505 Ga0501080_0001418
506 Ga0501080_0146513
507 Ga0501080_0284704
508 Ga0501080_0335794
509 Ga0501080_0687969
510 Ga0501080_1040484
511 Ga0501081_0517887
512 Ga0501035_0000454
513 Ga0501035_0000634
514 Ga0501035_0001308
515 Ga0501035_0039913
516 Ga0501035_0045850
517 Ga0501035_0181495
518 Ga0501035_0328032
519 Ga0501035_0450688
520 Ga0501044_0000020
521 Ga0501044_0003751
522 Ga0501044_0007460
523 Ga0501044_0014712
524 Ga0501044_0064361
525 Ga0501044_0173906
526 Ga0501044_0191697
527 Ga0501044_0319227
528 Ga0501045_0029215
529 Ga0501045_0030868
530 Ga0501045_0065627
531 nmdc:mga0yw44_137634_c1
532 nmdc:mga0yw44_308709_c1
533 nmdc:mga0yw44_420959_c1
534 nmdc:mga07m45_292478_c1
535 nmdc:mga0qj67_523378_c1
536 nmdc:mga0rr50_274065_c1
537 nmdc:mga0rr50_309329_c1
538 nmdc:mga08x19_831310_c1
539 Ga0500643_012988
540 Ga0500554_102352
541 Ga0500556_0000082
542 Ga0500616_0015994
543 Ga0500616_0356882
544 Ga0501084_0048146
545 Ga0501084_0836049
546 Ga0501082_0006553
547 Ga0501082_0056739
548 Ga0501082_0428111
549 Ga0501082_0773679
550 2535485831
551 2644081096
552 2644131349
553 2644663593
554 2739306266
555 2753360226
556 2757572685
557 2765468078
558 2768644914
559 2840766152
560 2854913035
561 2894653955
562 2904580201
563 2915654270
564 2919120126
565 2935892754
566 2996339549
567 3002141458
568 8002290544

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

16

63

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7asa-assembly1.cif.gz_1 bacillus subtilis ribosome-associated quality control complex state b, multibody refinement focussed on rqch. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo 0.9405 4 83
5wxm-assembly1.cif.gz_A crystal structure of the imp3 and mpp10 complex 0.9395 4 45
7ope-assembly1.cif.gz_1 rqch dr variant bound to 50s-peptidyl-trna-rqcp rqc complex (rigid body refinement) 0.9327 4 83
8d8l-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 3) 0.9286 4 52
8d8k-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 2) 0.9277 4 52
ID Description Score Start End Superfamily
af_Q2G0R5_1_87_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.953 4 83 3.10.290.10
af_P9WHQ3_3_67_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.934 2 54 3.10.290.10
af_A0A1D6JNZ0_152_214_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9312 2 52 3.10.290.10
af_Q25804_3_135_1.10.1050.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S4 Delta 41; Chain A, domain 1;Ribosomal protein S4/S9, N-terminal domain 0.9302 4 48 1.10.1050.10
af_A0A144A2N8_107_181_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9265 5 45 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A848QFZ8-F1-model_v4 deleted 0.9936 1 82
AF-A0A3R9SKR7-F1-model_v4 RNA-binding S4 domain-containing protein 0.9886 2 81 GO:0003723
AF-A0A5N8XSN4-F1-model_v4 RNA-binding S4 domain-containing protein 0.9858 3 82 GO:0003723
AF-A0A2N8TC58-F1-model_v4 Ribosome-associated heat shock protein 0.983 2 82 GO:0003723
AF-A0A6I2ZF95-F1-model_v4 deleted 0.9803 2 84

Map