F385826

General Info

Members Datasets Scaffolds Average Seq Length
283 176 566 135

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0226482|Ga0496114_0226482_58_540
Length 160
Sequence MGDHLLTAHLRCHASTVEGGSDRLASMRSELLEVHTGSREVVHDLTRDCAAFVQGEDDGLLHVFVPHATAGIAILETGAGSDDDLLAALGDLLPADDRWQHQHGSPGHGRSHVMPALIPPFATVPVLHGRLALGTWQSICLVDLNVDNPDRQVRLSFLPG

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
83 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
95 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
96 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
131 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
158 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
159 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
164 2643221548 Streptomyces sp. Root55 Isolate Unclassified
165 2643221617 Nocardioides sp. Root79 Isolate Unclassified
166 2643221620 Nocardioides sp. Root240 Isolate Unclassified
167 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
168 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
169 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
170 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
171 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
172 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
173 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
174 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
175 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
176 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.7
Metatranscriptomes 0.71
Isolates 4.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.47
Nodule 0
Rhizoplane 7.42
Rhizosphere 81.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0226482 3300048917 Bacteria 1642
2 Ga0070658_10192567 3300005327 Bacteria 1719
3 Ga0070683_101017234 3300005329 Bacteria 796
4 Ga0070682_100040636 3300005337 Bacteria 2862
5 Ga0070682_101219323 3300005337 Bacteria 636
6 Ga0068868_100014645 3300005338 Bacteria 5784
7 Ga0070660_100246865 3300005339 Bacteria 1455
8 Ga0070660_101567377 3300005339 Bacteria 560
9 Ga0070691_10029363 3300005341 Bacteria 2571
10 Ga0070687_100049269 3300005343 Bacteria 2170
11 Ga0070692_10012045 3300005345 Bacteria 3990
12 Ga0070674_100098065 3300005356 Bacteria 2130
13 Ga0070673_100157090 3300005364 Bacteria 1931
14 Ga0070688_100172168 3300005365 Bacteria 1495
15 Ga0070667_100845175 3300005367 Bacteria 851
16 Ga0070700_100002575 3300005441 Bacteria 9269
17 Ga0070708_101046122 3300005445 Bacteria 765
18 Ga0070685_10089985 3300005466 Bacteria 1856
19 Ga0070685_10490447 3300005466 Bacteria 868
20 Ga0070684_100321740 3300005535 Bacteria 1421
21 Ga0070684_100760604 3300005535 Bacteria 905
22 Ga0070672_100002643 3300005543 Bacteria 11448
23 Ga0070665_100868099 3300005548 Bacteria 915
24 Ga0068854_100116366 3300005578 Bacteria 2023
25 Ga0068856_100174490 3300005614 Bacteria 2162
26 Ga0068856_100219779 3300005614 Bacteria 1915
27 Ga0070702_100012413 3300005615 Bacteria 4268
28 Ga0068852_100006640 3300005616 Bacteria 8383
29 Ga0068852_100046724 3300005616 Bacteria 3690
30 Ga0068866_10027314 3300005718 Bacteria 2705
31 Ga0068861_100080530 3300005719 Bacteria 2548
32 Ga0068861_100255426 3300005719 Bacteria 1498
33 Ga0068870_10055165 3300005840 Bacteria 2116
34 Ga0081455_10000090 3300005937 Bacteria 97813
35 Ga0081455_10001042 3300005937 Bacteria 34961
36 Ga0075365_10046053 3300006038 Bacteria 2863
37 Ga0075365_10234111 3300006038 Bacteria 1290
38 Ga0075365_10796757 3300006038 Bacteria 667
39 Ga0075428_102059595 3300006844 Bacteria 591
40 Ga0068865_100018716 3300006881 Bacteria 4473
41 Ga0111539_10096692 3300009094 Bacteria 3469
42 Ga0105245_10266641 3300009098 Bacteria 1668
43 Ga0105245_11551174 3300009098 Bacteria 714
44 Ga0105245_11927576 3300009098 Bacteria 644
45 Ga0105245_12336331 3300009098 Bacteria 588
46 Ga0105243_10025502 3300009148 Bacteria 4518
47 Ga0105243_10125334 3300009148 Bacteria 2172
48 Ga0105243_11136891 3300009148 Bacteria 791
49 Ga0105241_10082163 3300009174 Bacteria 2525
50 Ga0105248_10246395 3300009177 Bacteria 2011
51 Ga0105237_12195600 3300009545 Bacteria 561
52 Ga0105238_10124727 3300009551 Bacteria 2555
53 Ga0105238_10767424 3300009551 Bacteria 979
54 Ga0105249_10406395 3300009553 Bacteria 1393
55 Ga0105249_11979924 3300009553 Bacteria 655
56 Ga0105249_12173985 3300009553 Bacteria 628
57 Ga0105246_10098783 3300011119 Bacteria 2121
58 Ga0105246_10322343 3300011119 Bacteria 1256
59 Ga0157371_10079677 3300013102 Bacteria 2320
60 Ga0157371_10203190 3300013102 Bacteria 1421
61 Ga0157369_10242916 3300013105 Bacteria 1881
62 Ga0157369_10397013 3300013105 Bacteria 1431
63 Ga0157378_11412271 3300013297 Bacteria 739
64 Ga0157372_10231944 3300013307 Bacteria 2140
65 Ga0157375_10247856 3300013308 Bacteria 1942
66 Ga0157375_10665610 3300013308 Bacteria 1196
67 Ga0163163_10158887 3300014325 Bacteria 2305
68 Ga0163163_10966907 3300014325 Bacteria 915
69 Ga0163163_11808969 3300014325 Bacteria 671
70 Ga0157377_10014660 3300014745 Bacteria 3992
71 Ga0157377_11137917 3300014745 Bacteria 600
72 Ga0157376_10701217 3300014969 Bacteria 1017
73 Ga0163161_10042135 3300017792 Bacteria 3282
74 Ga0206353_10646270 3300020082 Bacteria 699
75 Ga0206353_11604383 3300020082 Bacteria 543
76 Ga0213875_10003580 3300021388 Bacteria 8805
77 Ga0207642_10017682 3300025899 Bacteria 2718
78 Ga0207643_10019738 3300025908 Bacteria 3695
79 Ga0207654_10091901 3300025911 Bacteria 1852
80 Ga0207671_10927502 3300025914 Bacteria 688
81 Ga0207662_10063521 3300025918 Bacteria 2220
82 Ga0207694_10294350 3300025924 Bacteria 1335
83 Ga0207694_10580081 3300025924 Bacteria 942
84 Ga0207659_11086728 3300025926 Bacteria 688
85 Ga0207687_10039738 3300025927 Bacteria 3222
86 Ga0207687_10548860 3300025927 Bacteria 969
87 Ga0207687_11077207 3300025927 Bacteria 690
88 Ga0207687_11165891 3300025927 Bacteria 662
89 Ga0207690_10000514 3300025932 Bacteria 25113
90 Ga0207706_10591899 3300025933 Bacteria 953
91 Ga0207686_10204629 3300025934 Bacteria 1416
92 Ga0207709_10127423 3300025935 Bacteria 1729
93 Ga0207669_10137305 3300025937 Bacteria 1691
94 Ga0207704_10090027 3300025938 Bacteria 2012
95 Ga0207691_10069993 3300025940 Bacteria 3168
96 Ga0207661_10083045 3300025944 Bacteria 2650
97 Ga0207661_11473712 3300025944 Bacteria 624
98 Ga0207667_10022972 3300025949 Bacteria 6876
99 Ga0207667_11320077 3300025949 Bacteria 697
100 Ga0207651_10357901 3300025960 Bacteria 1231
101 Ga0207712_10489694 3300025961 Bacteria 1049
102 Ga0207668_10609580 3300025972 Bacteria 952
103 Ga0207658_11735660 3300025986 Bacteria 570
104 Ga0207677_10024703 3300026023 Bacteria 3738
105 Ga0207678_10305146 3300026067 Bacteria 1368
106 Ga0207708_10001801 3300026075 Bacteria 15780
107 Ga0207702_10083323 3300026078 Bacteria 2782
108 Ga0207702_10322476 3300026078 Bacteria 1471
109 Ga0207675_100004664 3300026118 Bacteria 13204
110 Ga0207675_100028036 3300026118 Bacteria 5243
111 Ga0207675_100334491 3300026118 Bacteria 1481
112 Ga0207698_10096656 3300026142 Bacteria 2435
113 Ga0207698_10321580 3300026142 Bacteria 1449
114 Ga0207698_10866167 3300026142 Bacteria 909
115 Ga0207428_10100439 3300027907 Bacteria 2236
116 Ga0268266_10942464 3300028379 Bacteria 835
117 Ga0307517_10118670 3300028786 Bacteria 1968
118 Ga0307515_10317135 3300028794 Bacteria 1228
119 Ga0307511_10000566 3300030521 Bacteria 39711
120 Ga0307511_10064943 3300030521 Bacteria 2738
121 Ga0307512_10426156 3300030522 Bacteria 546
122 Ga0307508_10035246 3300031616 Bacteria 4510
123 Ga0307514_10215388 3300031649 Bacteria 1186
124 Ga0307405_10076410 3300031731 Bacteria 2173
125 Ga0326468_10034253 3300031889 Bacteria 691
126 Ga0307407_10114214 3300031903 Bacteria 1701
127 Ga0307407_10129314 3300031903 Bacteria 1613
128 Ga0307409_100012293 3300031995 Bacteria 5449
129 Ga0307409_100305084 3300031995 Bacteria 1483
130 Ga0307416_100238974 3300032002 Bacteria 1758
131 Ga0307416_100624138 3300032002 Bacteria 1160
132 Ga0307414_10753886 3300032004 Bacteria 885
133 Ga0307411_10922030 3300032005 Bacteria 777
134 Ga0307411_11005410 3300032005 Bacteria 747
135 Ga0307415_100035632 3300032126 Bacteria 3251
136 Ga0307507_10013961 3300033179 Bacteria 9658
137 Ga0307510_10042207 3300033180 Bacteria 4973
138 Ga0373942_0176636 3300035207 Bacteria 698
139 Ga0373925_0044011 3300037068 Bacteria 3314
140 Ga0436364_0624094 3300037853 Bacteria 124588
141 Ga0451841_0600425 3300041498 Bacteria 721
142 Ga0466972_0028399 3300044658 Bacteria 2760
143 Ga0466972_0177641 3300044658 Bacteria 999
144 Ga0466965_0358048 3300044683 Bacteria 800
145 Ga0466966_0004597 3300044684 Bacteria 9092
146 Ga0466966_0113104 3300044684 Bacteria 1672
147 Ga0466961_0000779 3300044693 Bacteria 19969
148 Ga0466961_0027464 3300044693 Bacteria 3660
149 Ga0466961_0062721 3300044693 Bacteria 2362
150 Ga0466963_0005302 3300044694 Bacteria 7535
151 Ga0466963_0175122 3300044694 Bacteria 1497
152 Ga0466963_0227172 3300044694 Bacteria 1308
153 Ga0466963_0242040 3300044694 Bacteria 1265
154 Ga0466963_0272029 3300044694 Bacteria 1190
155 Ga0466963_0311927 3300044694 Bacteria 1107
156 Ga0466963_0325892 3300044694 Bacteria 1081
157 Ga0466963_0582778 3300044694 Bacteria 790
158 Ga0466964_0034748 3300044706 Bacteria 2013
159 Ga0466964_0860024 3300044706 Bacteria 516
160 Ga0466971_0091820 3300044719 Bacteria 1391
161 Ga0466971_0223467 3300044719 Bacteria 893
162 Ga0466970_0008933 3300044765 Bacteria 5053
163 Ga0466970_0061841 3300044765 Bacteria 2007
164 Ga0466970_0319069 3300044765 Bacteria 878
165 Ga0466957_0085604 3300044842 Bacteria 1969
166 Ga0466957_0323662 3300044842 Bacteria 1041
167 Ga0466957_0357598 3300044842 Bacteria 992
168 Ga0466960_0004788 3300044901 Bacteria 5318
169 Ga0466960_0098946 3300044901 Bacteria 1499
170 Ga0466959_0002335 3300045049 Bacteria 12114
171 Ga0466959_0017243 3300045049 Bacteria 5290
172 Ga0466959_0242524 3300045049 Bacteria 1244
173 Ga0466959_0751229 3300045049 Bacteria 653
174 Ga0466958_0030509 3300045836 Bacteria 3203
175 Ga0466967_0002669 3300045976 Bacteria 11257
176 Ga0466967_0032334 3300045976 Bacteria 4416
177 Ga0466967_0035035 3300045976 Bacteria 4268
178 Ga0466967_0037123 3300045976 Bacteria 4166
179 Ga0466967_0054950 3300045976 Bacteria 3507
180 Ga0466967_0058791 3300045976 Bacteria 3400
181 Ga0466967_0084245 3300045976 Bacteria 2876
182 Ga0466967_0125300 3300045976 Bacteria 2379
183 Ga0466967_0144122 3300045976 Bacteria 2221
184 Ga0466967_0158440 3300045976 Bacteria 2123
185 Ga0466967_0332156 3300045976 Bacteria 1468
186 Ga0466967_0337364 3300045976 Bacteria 1457
187 Ga0466967_0485127 3300045976 Bacteria 1211
188 Ga0466967_0722639 3300045976 Bacteria 987
189 Ga0495627_061443 3300046453 Bacteria 1111
190 Ga0495641_0533456 3300046461 Bacteria 536
191 Ga0495582_0140767 3300046473 Bacteria 1367
192 Ga0495630_0668800 3300046517 Bacteria 795
193 Ga0495667_0174037 3300046559 Bacteria 1383
194 Ga0495676_0134162 3300047321 Bacteria 1783
195 Ga0496100_0142403 3300048903 Bacteria 1701
196 Ga0496101_0035745 3300048904 Bacteria 3515
197 Ga0496102_0050671 3300048905 Bacteria 3781
198 Ga0496102_0383540 3300048905 Bacteria 1322
199 Ga0496102_0625941 3300048905 Bacteria 999
200 Ga0496102_0649077 3300048905 Bacteria 978
201 Ga0496102_0770219 3300048905 Bacteria 885
202 Ga0496103_0031910 3300048906 Bacteria 3213
203 Ga0496106_0017877 3300048909 Bacteria 5243
204 Ga0496106_0376296 3300048909 Bacteria 1141
205 Ga0496106_0587269 3300048909 Bacteria 893
206 Ga0496107_0028537 3300048910 Bacteria 3966
207 Ga0496107_0698347 3300048910 Bacteria 746
208 Ga0496108_0770475 3300048911 Bacteria 831
209 Ga0496109_0117098 3300048912 Bacteria 2480
210 Ga0496109_0312778 3300048912 Bacteria 1482
211 Ga0496110_0171619 3300048913 Bacteria 1968
212 Ga0496114_0023928 3300048917 Bacteria 4984
213 Ga0496115_0242526 3300048918 Bacteria 1485
214 Ga0496115_0297721 3300048918 Bacteria 1322
215 Ga0496118_0270131 3300048921 Bacteria 953
216 Ga0496119_0004777 3300048922 Bacteria 13305
217 Ga0496120_0004511 3300048923 Bacteria 11640
218 Ga0501031_0026320 3300049568 Bacteria 3793
219 Ga0501031_0311418 3300049568 Bacteria 1020
220 Ga0501032_0007241 3300049569 Bacteria 8116
221 Ga0501032_0094678 3300049569 Bacteria 1980
222 Ga0501033_0038967 3300049570 Bacteria 3551
223 Ga0501034_0752060 3300049571 Bacteria 870
224 Ga0501036_0174265 3300049572 Bacteria 1812
225 Ga0501036_0343708 3300049572 Bacteria 1246
226 Ga0501037_0324037 3300049573 Bacteria 1066
227 Ga0501037_0718075 3300049573 Bacteria 664
228 Ga0501038_0001270 3300049574 Bacteria 22905
229 Ga0501038_0031065 3300049574 Bacteria 4722
230 Ga0501038_0320835 3300049574 Bacteria 1212
231 Ga0501038_0750003 3300049574 Bacteria 728
232 Ga0501039_0047386 3300049575 Bacteria 3322
233 Ga0501039_0114798 3300049575 Bacteria 2107
234 Ga0501040_0169646 3300049576 Bacteria 1545
235 Ga0501043_0029790 3300049579 Bacteria 4288
236 Ga0501046_0017264 3300049580 Bacteria 6027
237 Ga0501046_0100869 3300049580 Bacteria 2215
238 Ga0501047_0537950 3300049581 Bacteria 993
239 Ga0501048_0001394 3300049582 Bacteria 18326
240 Ga0501067_0002751 3300049583 Bacteria 9673
241 Ga0501068_0152432 3300049584 Bacteria 1453
242 Ga0501069_0119317 3300049585 Bacteria 1506
243 Ga0501069_0527494 3300049585 Bacteria 705
244 Ga0501070_1278936 3300049586 Bacteria 561
245 Ga0501071_0171468 3300049587 Bacteria 1624
246 Ga0501074_0063898 3300049590 Bacteria 2651
247 Ga0501080_0350394 3300049742 Bacteria 1333
248 Ga0501081_1482662 3300049743 Bacteria 515
249 Ga0501035_0190186 3300049822 Bacteria 1765
250 Ga0501044_0090856 3300049823 Bacteria 3080
251 Ga0501044_0110301 3300049823 Bacteria 2760
252 Ga0501044_0534983 3300049823 Bacteria 1070
253 nmdc:mga0yw44_104119_c1 3300050492 Bacteria 1811
254 nmdc:mga0yw44_723675_c1 3300050492 Bacteria 676
255 nmdc:mga0yw44_775610_c1 3300050492 Bacteria 651
256 nmdc:mga08y16_184114_c1 3300050511 Bacteria 2168
257 Ga0495655_0112274 3300053083 Bacteria 820
258 Ga0495595_0321435 3300053084 Bacteria 779
259 Ga0495595_0450225 3300053084 Bacteria 654
260 Ga0500559_0002278 3300053136 Bacteria 10128
261 Ga0501084_1402227 3300054114 Bacteria 585
262 Ga0501084_1704727 3300054114 Bacteria 526
263 Ga0501082_0132199 3300060353 Bacteria 2165
264 Ga0501082_1315012 3300060353 Bacteria 631
265 Ga0466962_0042739 3300061719 Bacteria 2169
266 Ga0466962_0073451 3300061719 Bacteria 1634
267 Ga0466962_0134605 3300061719 Bacteria 1196
268 Ga0466962_0134810 3300061719 Bacteria 1195
269 Ga0530510_0076185 3300061734 Bacteria 2437
270 Ga0530510_0374500 3300061734 Bacteria 1071
271 2643764372 2643221548 Bacteria 8053412
272 2644100587 2643221617 Bacteria 5139111
273 2644116995 2643221620 Bacteria 5134593
274 2644458569 2643221682 Bacteria 6743283
275 2753070844 2751185734 Bacteria 8863695
276 2804849248 2802429296 Bacteria 7227771
277 2819698693 2818991463 Bacteria 7948711
278 2862292991 2862290372 Bacteria 7471434
279 2899368728 2899359706 Bacteria 10940472
280 2917740903 2917736166 Bacteria 9690793
281 3006429168 3006425503 Bacteria 6491253
282 8025413823 8025413630 Bacteria 7014048
283 8047718127 8047710418 Bacteria 11023148
284 Ga0496114_0226482
285 Ga0070658_10192567
286 Ga0070683_101017234
287 Ga0070682_100040636
288 Ga0070682_101219323
289 Ga0068868_100014645
290 Ga0070660_100246865
291 Ga0070660_101567377
292 Ga0070691_10029363
293 Ga0070687_100049269
294 Ga0070692_10012045
295 Ga0070674_100098065
296 Ga0070673_100157090
297 Ga0070688_100172168
298 Ga0070667_100845175
299 Ga0070700_100002575
300 Ga0070708_101046122
301 Ga0070685_10089985
302 Ga0070685_10490447
303 Ga0070684_100321740
304 Ga0070684_100760604
305 Ga0070672_100002643
306 Ga0070665_100868099
307 Ga0068854_100116366
308 Ga0068856_100174490
309 Ga0068856_100219779
310 Ga0070702_100012413
311 Ga0068852_100006640
312 Ga0068852_100046724
313 Ga0068866_10027314
314 Ga0068861_100080530
315 Ga0068861_100255426
316 Ga0068870_10055165
317 Ga0081455_10000090
318 Ga0081455_10001042
319 Ga0075365_10046053
320 Ga0075365_10234111
321 Ga0075365_10796757
322 Ga0075428_102059595
323 Ga0068865_100018716
324 Ga0111539_10096692
325 Ga0105245_10266641
326 Ga0105245_11551174
327 Ga0105245_11927576
328 Ga0105245_12336331
329 Ga0105243_10025502
330 Ga0105243_10125334
331 Ga0105243_11136891
332 Ga0105241_10082163
333 Ga0105248_10246395
334 Ga0105237_12195600
335 Ga0105238_10124727
336 Ga0105238_10767424
337 Ga0105249_10406395
338 Ga0105249_11979924
339 Ga0105249_12173985
340 Ga0105246_10098783
341 Ga0105246_10322343
342 Ga0157371_10079677
343 Ga0157371_10203190
344 Ga0157369_10242916
345 Ga0157369_10397013
346 Ga0157378_11412271
347 Ga0157372_10231944
348 Ga0157375_10247856
349 Ga0157375_10665610
350 Ga0163163_10158887
351 Ga0163163_10966907
352 Ga0163163_11808969
353 Ga0157377_10014660
354 Ga0157377_11137917
355 Ga0157376_10701217
356 Ga0163161_10042135
357 Ga0206353_10646270
358 Ga0206353_11604383
359 Ga0213875_10003580
360 Ga0207642_10017682
361 Ga0207643_10019738
362 Ga0207654_10091901
363 Ga0207671_10927502
364 Ga0207662_10063521
365 Ga0207694_10294350
366 Ga0207694_10580081
367 Ga0207659_11086728
368 Ga0207687_10039738
369 Ga0207687_10548860
370 Ga0207687_11077207
371 Ga0207687_11165891
372 Ga0207690_10000514
373 Ga0207706_10591899
374 Ga0207686_10204629
375 Ga0207709_10127423
376 Ga0207669_10137305
377 Ga0207704_10090027
378 Ga0207691_10069993
379 Ga0207661_10083045
380 Ga0207661_11473712
381 Ga0207667_10022972
382 Ga0207667_11320077
383 Ga0207651_10357901
384 Ga0207712_10489694
385 Ga0207668_10609580
386 Ga0207658_11735660
387 Ga0207677_10024703
388 Ga0207678_10305146
389 Ga0207708_10001801
390 Ga0207702_10083323
391 Ga0207702_10322476
392 Ga0207675_100004664
393 Ga0207675_100028036
394 Ga0207675_100334491
395 Ga0207698_10096656
396 Ga0207698_10321580
397 Ga0207698_10866167
398 Ga0207428_10100439
399 Ga0268266_10942464
400 Ga0307517_10118670
401 Ga0307515_10317135
402 Ga0307511_10000566
403 Ga0307511_10064943
404 Ga0307512_10426156
405 Ga0307508_10035246
406 Ga0307514_10215388
407 Ga0307405_10076410
408 Ga0326468_10034253
409 Ga0307407_10114214
410 Ga0307407_10129314
411 Ga0307409_100012293
412 Ga0307409_100305084
413 Ga0307416_100238974
414 Ga0307416_100624138
415 Ga0307414_10753886
416 Ga0307411_10922030
417 Ga0307411_11005410
418 Ga0307415_100035632
419 Ga0307507_10013961
420 Ga0307510_10042207
421 Ga0373942_0176636
422 Ga0373925_0044011
423 Ga0436364_0624094
424 Ga0451841_0600425
425 Ga0466972_0028399
426 Ga0466972_0177641
427 Ga0466965_0358048
428 Ga0466966_0004597
429 Ga0466966_0113104
430 Ga0466961_0000779
431 Ga0466961_0027464
432 Ga0466961_0062721
433 Ga0466963_0005302
434 Ga0466963_0175122
435 Ga0466963_0227172
436 Ga0466963_0242040
437 Ga0466963_0272029
438 Ga0466963_0311927
439 Ga0466963_0325892
440 Ga0466963_0582778
441 Ga0466964_0034748
442 Ga0466964_0860024
443 Ga0466971_0091820
444 Ga0466971_0223467
445 Ga0466970_0008933
446 Ga0466970_0061841
447 Ga0466970_0319069
448 Ga0466957_0085604
449 Ga0466957_0323662
450 Ga0466957_0357598
451 Ga0466960_0004788
452 Ga0466960_0098946
453 Ga0466959_0002335
454 Ga0466959_0017243
455 Ga0466959_0242524
456 Ga0466959_0751229
457 Ga0466958_0030509
458 Ga0466967_0002669
459 Ga0466967_0032334
460 Ga0466967_0035035
461 Ga0466967_0037123
462 Ga0466967_0054950
463 Ga0466967_0058791
464 Ga0466967_0084245
465 Ga0466967_0125300
466 Ga0466967_0144122
467 Ga0466967_0158440
468 Ga0466967_0332156
469 Ga0466967_0337364
470 Ga0466967_0485127
471 Ga0466967_0722639
472 Ga0495627_061443
473 Ga0495641_0533456
474 Ga0495582_0140767
475 Ga0495630_0668800
476 Ga0495667_0174037
477 Ga0495676_0134162
478 Ga0496100_0142403
479 Ga0496101_0035745
480 Ga0496102_0050671
481 Ga0496102_0383540
482 Ga0496102_0625941
483 Ga0496102_0649077
484 Ga0496102_0770219
485 Ga0496103_0031910
486 Ga0496106_0017877
487 Ga0496106_0376296
488 Ga0496106_0587269
489 Ga0496107_0028537
490 Ga0496107_0698347
491 Ga0496108_0770475
492 Ga0496109_0117098
493 Ga0496109_0312778
494 Ga0496110_0171619
495 Ga0496114_0023928
496 Ga0496115_0242526
497 Ga0496115_0297721
498 Ga0496118_0270131
499 Ga0496119_0004777
500 Ga0496120_0004511
501 Ga0501031_0026320
502 Ga0501031_0311418
503 Ga0501032_0007241
504 Ga0501032_0094678
505 Ga0501033_0038967
506 Ga0501034_0752060
507 Ga0501036_0174265
508 Ga0501036_0343708
509 Ga0501037_0324037
510 Ga0501037_0718075
511 Ga0501038_0001270
512 Ga0501038_0031065
513 Ga0501038_0320835
514 Ga0501038_0750003
515 Ga0501039_0047386
516 Ga0501039_0114798
517 Ga0501040_0169646
518 Ga0501043_0029790
519 Ga0501046_0017264
520 Ga0501046_0100869
521 Ga0501047_0537950
522 Ga0501048_0001394
523 Ga0501067_0002751
524 Ga0501068_0152432
525 Ga0501069_0119317
526 Ga0501069_0527494
527 Ga0501070_1278936
528 Ga0501071_0171468
529 Ga0501074_0063898
530 Ga0501080_0350394
531 Ga0501081_1482662
532 Ga0501035_0190186
533 Ga0501044_0090856
534 Ga0501044_0110301
535 Ga0501044_0534983
536 nmdc:mga0yw44_104119_c1
537 nmdc:mga0yw44_723675_c1
538 nmdc:mga0yw44_775610_c1
539 nmdc:mga08y16_184114_c1
540 Ga0495655_0112274
541 Ga0495595_0321435
542 Ga0495595_0450225
543 Ga0500559_0002278
544 Ga0501084_1402227
545 Ga0501084_1704727
546 Ga0501082_0132199
547 Ga0501082_1315012
548 Ga0466962_0042739
549 Ga0466962_0073451
550 Ga0466962_0134605
551 Ga0466962_0134810
552 Ga0530510_0076185
553 Ga0530510_0374500
554 2643764372
555 2644100587
556 2644116995
557 2644458569
558 2753070844
559 2804849248
560 2819698693
561 2862292991
562 2899368728
563 2917740903
564 3006429168
565 8025413823
566 8047718127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

44

157

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.9212 2 134
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.9082 2 134
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.8997 4 132
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.8985 2 132
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.8971 3 134
ID Description Score Start End Superfamily
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9768 1 132 2.60.120.460
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9623 1 132 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9182 3 134 2.60.120.460
1ve0A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9017 3 129 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8988 3 134 2.60.120.460
ID Description Score Start End GO Terms
AF-Q5Z332-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 1 3 134
AF-A0A7G9RBH8-F1-model_v4 YjbQ family protein 0.9997 1 134
AF-A0A0S4R0L1-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9996 6 134
AF-A0A6N7HZD7-F1-model_v4 YjbQ family protein 0.9988 1 134
AF-A0A1V1WBL4-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9983 3 134

Map