F385816

General Info

Members Datasets Scaffolds Average Seq Length
283 188 566 283

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0207861|Ga0496105_0207861_39_980
Length 313
Sequence MRVEIEPGVRLFVDIEGPQFVPDGPVLREKPTLILLHGGPGYDHSGFKPRFSALADIAQVVYYDHRGHGRSDRRPPAEWTLDTFADDIVRLCDVLGIVKPIVLGQSFGGFVAQRYIERHPAHPAKVILSSTSPHMKLERKLAMFEKFGGPSARASAEAFWSNPNPDTWADYLLKCRQHYNTTLQDETAGRRTLYNLDILFASASGEQRTMNLLPGLANAQCPVLVIAGEQDPVCPLEDAKDIAAALPPQWMQFRSFPGTGHGAYRDDPDAVFEVLRQFVLSPPRVLSPHAPAGRCPPRGPAGXXXXEPGPFLP

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
57 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
62 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
93 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
96 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
97 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
114 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
115 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
166 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
167 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
168 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
169 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
170 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
171 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
172 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
173 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
174 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
175 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
176 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
181 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
182 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
183 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
184 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
185 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
186 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
187 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
188 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.88
Metatranscriptomes 0
Isolates 2.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.73
Nodule 0
Rhizoplane 2.83
Rhizosphere 51.59
Stem 0
Stem Tuber 0
Unclassified 1.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0207861 3300048908 Bacteria 1596
2 JGI25156J39149_1001158 3300002705 Bacteria 11806
3 JGI25157J39369_1001127 3300002741 Bacteria 11806
4 JGI25164J39214_1006124 3300002772 Bacteria 1273
5 JGI25152J39213_1000320 3300002773 Bacteria 30822
6 JGI25153J46596_10000925 3300003215 Bacteria 17828
7 JGI25153J46596_10002237 3300003215 Bacteria 11292
8 rootH1_10015858 3300003316 Bacteria 5575
9 rootH1_10015859 3300003316 Bacteria 6273
10 rootH2_10026509 3300003320 Bacteria 5189
11 rootL2_10024229 3300003322 Bacteria 15481
12 rootL2_10043383 3300003322 Bacteria 4603
13 rootH1_10023125 3300003323 Bacteria 4432
14 rootH1_10052468 3300003323 Bacteria 5536
15 rootH1_10148604 3300003323 Bacteria 3282
16 Ga0055539_1000239 3300003752 Bacteria 36797
17 Ga0055539_1000716 3300003752 Bacteria 8463
18 Ga0055533_1000016 3300003756 Bacteria 396179
19 Ga0055525_1001107 3300003759 Bacteria 6676
20 Ga0055535_1000165 3300003761 Bacteria 71549
21 Ga0055542_1012066 3300003762 Bacteria 1507
22 Ga0055529_1000214 3300003763 Bacteria 76244
23 Ga0055526_1003784 3300003771 Bacteria 9426
24 Ga0065165_1010472 3300005262 Bacteria 4001
25 Ga0070670_100091009 3300005331 Bacteria 2622
26 Ga0070660_100032999 3300005339 Bacteria 3900
27 Ga0070659_100496499 3300005366 Bacteria 1040
28 Ga0070667_100248812 3300005367 Bacteria 1589
29 Ga0068867_100472448 3300005459 Bacteria 1073
30 Ga0068855_100113765 3300005563 Bacteria 3104
31 Ga0068855_100355551 3300005563 Bacteria 1613
32 Ga0068855_100608895 3300005563 Bacteria 1177
33 Ga0068857_100008338 3300005577 Bacteria 8951
34 Ga0068856_100006192 3300005614 Bacteria 11739
35 Ga0068852_100290610 3300005616 Bacteria 1579
36 Ga0068864_100144333 3300005618 Bacteria 2150
37 Ga0068861_100569649 3300005719 Bacteria 1035
38 Ga0068863_100020825 3300005841 Bacteria 6263
39 Ga0068858_100130594 3300005842 Bacteria 2355
40 Ga0068862_100180127 3300005844 Bacteria 1896
41 Ga0075367_10030974 3300006178 Bacteria 3070
42 Ga0075369_10119458 3300006186 Bacteria 1192
43 Ga0075366_10025745 3300006195 Bacteria 3441
44 Ga0075370_10006543 3300006353 Bacteria 5868
45 Ga0075370_10011253 3300006353 Bacteria 4696
46 Ga0075370_10017229 3300006353 Bacteria 3902
47 Ga0105240_10031422 3300009093 Bacteria 6886
48 Ga0105243_10213759 3300009148 Bacteria 1700
49 Ga0105241_10085047 3300009174 Bacteria 2485
50 Ga0105242_10222754 3300009176 Bacteria 1687
51 Ga0105248_10011540 3300009177 Bacteria 9737
52 Ga0105237_10069362 3300009545 Bacteria 3521
53 Ga0105237_10661354 3300009545 Bacteria 1051
54 Ga0105238_10007404 3300009551 Bacteria 10994
55 Ga0105249_10508816 3300009553 Bacteria 1250
56 Ga0105239_10033562 3300010375 Bacteria 5635
57 Ga0157369_10115244 3300013105 Bacteria 2854
58 Ga0157378_10225871 3300013297 Bacteria 1782
59 Ga0157372_10614371 3300013307 Bacteria 1267
60 Ga0163163_10452604 3300014325 Bacteria 1344
61 Ga0157376_10000330 3300014969 Bacteria 31809
62 Ga0157376_10288540 3300014969 Bacteria 1548
63 Ga0182007_10043084 3300015262 Bacteria 1501
64 Ga0209674_100041 3300025226 Bacteria 396231
65 Ga0209563_100043 3300025230 Bacteria 397271
66 Ga0207427_100398 3300025231 Bacteria 25631
67 Ga0209258_100270 3300025242 Bacteria 89254
68 Ga0209258_101065 3300025242 Bacteria 11915
69 Ga0207425_1000334 3300025245 Bacteria 33005
70 Ga0209646_1000157 3300025246 Bacteria 94054
71 Ga0209026_1000006 3300025250 Bacteria 677225
72 Ga0209677_100098 3300025253 Bacteria 96201
73 Ga0209677_100245 3300025253 Bacteria 37185
74 Ga0209677_100632 3300025253 Bacteria 18831
75 Ga0209148_1000760 3300025254 Bacteria 24607
76 Ga0209148_1006610 3300025254 Bacteria 2494
77 Ga0209759_1000194 3300025256 Bacteria 97047
78 Ga0209759_1000635 3300025256 Bacteria 32980
79 Ga0209759_1000895 3300025256 Bacteria 22272
80 Ga0209759_1001736 3300025256 Bacteria 11199
81 Ga0209759_1002761 3300025256 Bacteria 7442
82 Ga0209129_1000027 3300025258 Bacteria 409587
83 Ga0209455_1000195 3300025272 Bacteria 89254
84 Ga0209564_1000014 3300025295 Bacteria 621501
85 Ga0209758_1000307 3300025297 Bacteria 95192
86 Ga0209758_1000524 3300025297 Bacteria 61366
87 Ga0209050_1001282 3300025298 Bacteria 28698
88 Ga0209256_1025091 3300025299 Bacteria 1743
89 Ga0209051_1010186 3300025303 Bacteria 4779
90 Ga0209051_1033687 3300025303 Bacteria 1933
91 Ga0207680_10237827 3300025903 Bacteria 1254
92 Ga0207654_10218301 3300025911 Bacteria 1263
93 Ga0207695_10056022 3300025913 Bacteria 4105
94 Ga0207695_10095404 3300025913 Bacteria 2978
95 Ga0207671_10550989 3300025914 Bacteria 919
96 Ga0207657_10002333 3300025919 Bacteria 20574
97 Ga0207657_10060982 3300025919 Bacteria 3236
98 Ga0207649_10025838 3300025920 Bacteria 3429
99 Ga0207650_10082672 3300025925 Bacteria 2438
100 Ga0207690_10216768 3300025932 Bacteria 1462
101 Ga0207690_10296997 3300025932 Bacteria 1263
102 Ga0207686_10187142 3300025934 Bacteria 1473
103 Ga0207709_10117381 3300025935 Bacteria 1790
104 Ga0207689_10099414 3300025942 Bacteria 2390
105 Ga0207667_10021823 3300025949 Bacteria 7086
106 Ga0207667_10176018 3300025949 Bacteria 2198
107 Ga0207667_10303426 3300025949 Bacteria 1631
108 Ga0207667_10692958 3300025949 Bacteria 1022
109 Ga0207651_10068563 3300025960 Bacteria 2501
110 Ga0207640_10001763 3300025981 Bacteria 11620
111 Ga0207658_10238323 3300025986 Bacteria 1540
112 Ga0207702_10010797 3300026078 Bacteria 7621
113 Ga0207641_10076129 3300026088 Bacteria 2900
114 Ga0207648_10336770 3300026089 Bacteria 1358
115 Ga0207676_10023274 3300026095 Bacteria 4568
116 Ga0207674_10015895 3300026116 Bacteria 8249
117 Ga0207675_100047735 3300026118 Bacteria 3997
118 Ga0207698_10208407 3300026142 Bacteria 1757
119 Ga0265334_10037761 3300028573 Bacteria 1903
120 Ga0265336_10000133 3300028666 Bacteria 53127
121 Ga0307517_10017121 3300028786 Bacteria 9467
122 Ga0307517_10041379 3300028786 Bacteria 4978
123 Ga0307515_10000011 3300028794 Bacteria 633903
124 Ga0307515_10000281 3300028794 Bacteria 125306
125 Ga0307515_10002144 3300028794 Bacteria 43311
126 Ga0307515_10016657 3300028794 Bacteria 13443
127 Ga0307515_10019977 3300028794 Bacteria 11998
128 Ga0307515_10049174 3300028794 Bacteria 6354
129 Ga0307515_10062143 3300028794 Bacteria 5282
130 Ga0307515_10148049 3300028794 Bacteria 2473
131 Ga0307515_10215030 3300028794 Bacteria 1755
132 Ga0265324_10003353 3300029957 Bacteria 7674
133 Ga0307512_10011191 3300030522 Bacteria 8515
134 Ga0307512_10034668 3300030522 Bacteria 4314
135 Ga0316182_1135129 3300030745 Bacteria 1425
136 Ga0307513_10028493 3300031456 Bacteria 6383
137 Ga0307513_10056883 3300031456 Bacteria 4172
138 Ga0307513_10208260 3300031456 Bacteria 1789
139 Ga0307509_10002279 3300031507 Bacteria 31377
140 Ga0307509_10006738 3300031507 Bacteria 15302
141 Ga0307509_10024396 3300031507 Bacteria 6772
142 Ga0307509_10105876 3300031507 Bacteria 2833
143 Ga0307508_10000143 3300031616 Bacteria 85046
144 Ga0307508_10000216 3300031616 Bacteria 69990
145 Ga0307508_10146440 3300031616 Bacteria 1966
146 Ga0307514_10006402 3300031649 Bacteria 10268
147 Ga0307514_10108122 3300031649 Bacteria 1979
148 Ga0307516_10000901 3300031730 Bacteria 40815
149 Ga0307516_10001560 3300031730 Bacteria 31520
150 Ga0307516_10007648 3300031730 Bacteria 12375
151 Ga0307516_10285988 3300031730 Bacteria 1329
152 Ga0307412_10292248 3300031911 Bacteria 1284
153 Ga0307507_10099984 3300033179 Bacteria 2433
154 Ga0307510_10003871 3300033180 Bacteria 17537
155 Ga0307510_10024947 3300033180 Bacteria 6903
156 Ga0307510_10040916 3300033180 Bacteria 5077
157 Ga0307510_10091678 3300033180 Bacteria 2879
158 Ga0307510_10201332 3300033180 Bacteria 1525
159 Ga0373931_0028881 3300035691 Bacteria 2843
160 Ga0373931_0051548 3300035691 Bacteria 2192
161 Ga0373927_0100511 3300035695 Bacteria 1881
162 Ga0395900_0625721 3300037418 Bacteria 1015
163 Ga0395898_0019412 3300037466 Bacteria 6917
164 Ga0395905_0019503 3300037471 Bacteria 6427
165 Ga0395905_0263872 3300037471 Bacteria 1607
166 Ga0395905_0284991 3300037471 Bacteria 1538
167 Ga0395905_0327498 3300037471 Bacteria 1422
168 Ga0436364_0693644 3300037853 Unclassified 1266
169 Ga0395901_0004699 3300038443 Bacteria 13781
170 Ga0395901_0014164 3300038443 Bacteria 8120
171 Ga0451800_0269633 3300041459 Bacteria 1152
172 Ga0451807_0219865 3300041486 Bacteria 1789
173 Ga0451843_1294181 3300041509 Bacteria 903
174 Ga0451853_1570849 3300041512 Bacteria 1257
175 Ga0451577_0002254 3300042876 Bacteria 23406
176 Ga0451577_0015977 3300042876 Bacteria 6965
177 Ga0451577_0077181 3300042876 Bacteria 2970
178 Ga0466969_0094692 3300044656 Bacteria 1411
179 Ga0466965_0002259 3300044683 Bacteria 8117
180 Ga0466965_0014157 3300044683 Bacteria 3774
181 Ga0466965_0016931 3300044683 Bacteria 3477
182 Ga0466966_0001037 3300044684 Bacteria 17758
183 Ga0466966_0001053 3300044684 Bacteria 17605
184 Ga0466966_0019476 3300044684 Bacteria 4464
185 Ga0466963_0140188 3300044694 Bacteria 1674
186 Ga0466964_0000627 3300044706 Bacteria 11249
187 Ga0466964_0003127 3300044706 Bacteria 6020
188 Ga0466964_0032605 3300044706 Bacteria 2071
189 Ga0453684_0098874 3300044712 Bacteria 3576
190 Ga0453684_0167261 3300044712 Bacteria 2595
191 Ga0453684_0341686 3300044712 Bacteria 1690
192 Ga0466971_0026538 3300044719 Bacteria 2589
193 Ga0466971_0061759 3300044719 Bacteria 1695
194 Ga0466968_0061488 3300044735 Bacteria 1620
195 Ga0466970_0001967 3300044765 Bacteria 9939
196 Ga0466970_0002128 3300044765 Bacteria 9567
197 Ga0466957_0015906 3300044842 Bacteria 4397
198 Ga0466957_0066376 3300044842 Bacteria 2224
199 Ga0466957_0086211 3300044842 Bacteria 1962
200 Ga0466957_0135432 3300044842 Bacteria 1582
201 Ga0466959_0000306 3300045049 Bacteria 29171
202 Ga0466959_0002313 3300045049 Bacteria 12152
203 Ga0466959_0010623 3300045049 Bacteria 6591
204 Ga0466959_0219383 3300045049 Unclassified 1319
205 Ga0466958_0029530 3300045836 Bacteria 3253
206 Ga0466967_0050869 3300045976 Bacteria 3629
207 Ga0466967_0153539 3300045976 Bacteria 2154
208 Ga0466967_0476369 3300045976 Bacteria 1222
209 Ga0495592_0000517 3300046454 Bacteria 27891
210 Ga0495629_0074501 3300046459 Unclassified 2370
211 Ga0495651_0088904 3300046462 Bacteria 2321
212 Ga0495650_0013322 3300046471 Bacteria 4355
213 Ga0495585_0027614 3300046492 Bacteria 3239
214 Ga0495583_0000328 3300046506 Bacteria 75213
215 Ga0495606_0010644 3300046507 Bacteria 7606
216 Ga0495610_0010566 3300046512 Bacteria 5725
217 Ga0495610_0111400 3300046512 Bacteria 1212
218 Ga0495632_0002637 3300046519 Bacteria 13495
219 Ga0495632_0009553 3300046519 Bacteria 5835
220 Ga0495643_0011053 3300046522 Bacteria 5520
221 Ga0495644_0005844 3300046523 Bacteria 4806
222 Ga0495622_0122423 3300046557 Bacteria 1187
223 Ga0495668_0022047 3300046616 Bacteria 3644
224 Ga0495625_0003598 3300046660 Bacteria 15235
225 Ga0495661_0061029 3300046665 Bacteria 2239
226 Ga0495658_0072335 3300046683 Bacteria 2005
227 Ga0495613_0139213 3300046689 Unclassified 1735
228 Ga0495624_0058701 3300046690 Bacteria 2416
229 Ga0495649_0006602 3300046694 Bacteria 7213
230 Ga0495589_0087978 3300046794 Bacteria 1508
231 Ga0495604_0034603 3300047317 Bacteria 3996
232 Ga0495676_0132620 3300047321 Bacteria 1796
233 Ga0495680_0024253 3300047322 Bacteria 5033
234 Ga0495686_0005178 3300047472 Bacteria 10381
235 Ga0495686_0024153 3300047472 Bacteria 3997
236 Ga0495686_0080694 3300047472 Bacteria 1988
237 Ga0495593_0115945 3300047673 Bacteria 1365
238 Ga0495602_0015985 3300048088 Bacteria 7555
239 Ga0496102_0029506 3300048905 Bacteria 4908
240 Ga0496102_0398047 3300048905 Bacteria 1295
241 Ga0496106_0013873 3300048909 Bacteria 5954
242 Ga0496107_0009952 3300048910 Bacteria 6597
243 Ga0496115_0063607 3300048918 Bacteria 2977
244 Ga0496121_0123969 3300048924 Bacteria 1946
245 Ga0501035_0039026 3300049822 Bacteria 4299
246 Ga0501035_0192632 3300049822 Bacteria 1752
247 nmdc:mga0k408_18445_c1 3300050493 Bacteria 3896
248 nmdc:mga07m45_12435_c1 3300050496 Bacteria 4499
249 nmdc:mga07m45_18380_c1 3300050496 Bacteria 3771
250 nmdc:mga0sz30_142258_c1 3300050516 Bacteria 1059
251 Ga0500635_0000295 3300053080 Bacteria 17777
252 Ga0500635_0067211 3300053080 Bacteria 1264
253 Ga0500578_0000006 3300053086 Bacteria 234598
254 Ga0500578_0162413 3300053086 Bacteria 1385
255 Ga0500578_0167322 3300053086 Bacteria 1361
256 Ga0500644_0023359 3300053088 Bacteria 1877
257 Ga0500651_0028430 3300053093 Bacteria 3515
258 Ga0500651_0108418 3300053093 Bacteria 1696
259 Ga0500562_029278 3300053108 Bacteria 1449
260 Ga0500594_0003277 3300053118 Bacteria 3548
261 Ga0500614_050786 3300053123 Bacteria 1088
262 Ga0500642_0002612 3300053130 Bacteria 5322
263 Ga0500652_000046 3300053131 Bacteria 58476
264 Ga0500652_056667 3300053131 Bacteria 1608
265 Ga0500655_002561 3300053133 Bacteria 3300
266 Ga0500559_0000558 3300053136 Bacteria 25786
267 Ga0500559_0015547 3300053136 Bacteria 3213
268 Ga0500568_0046597 3300053139 Bacteria 1720
269 Ga0500604_0020501 3300053151 Bacteria 1861
270 Ga0500604_0078671 3300053151 Bacteria 1062
271 Ga0500622_0000415 3300053156 Bacteria 40612
272 Ga0500622_0002629 3300053156 Bacteria 12769
273 Ga0500622_0109431 3300053156 Bacteria 1351
274 Ga0500636_0007387 3300053177 Bacteria 6356
275 Ga0500587_000110 3300053739 Bacteria 7431
276 Ga0500587_002253 3300053739 Bacteria 2750
277 Ga0500661_020586 3300055283 Bacteria 1172
278 2587730766 2585428057 Bacteria 6737412
279 2587736777 2585428058 Bacteria 6853932
280 2588295755 2588253510 Bacteria 6901809
281 2643966949 2643221592 Bacteria 6608788
282 2644142682 2643221625 Bacteria 6512927
283 2644273643 2643221648 Bacteria 6521465
284 Ga0496105_0207861
285 JGI25156J39149_1001158
286 JGI25157J39369_1001127
287 JGI25164J39214_1006124
288 JGI25152J39213_1000320
289 JGI25153J46596_10000925
290 JGI25153J46596_10002237
291 rootH1_10015858
292 rootH1_10015859
293 rootH2_10026509
294 rootL2_10024229
295 rootL2_10043383
296 rootH1_10023125
297 rootH1_10052468
298 rootH1_10148604
299 Ga0055539_1000239
300 Ga0055539_1000716
301 Ga0055533_1000016
302 Ga0055525_1001107
303 Ga0055535_1000165
304 Ga0055542_1012066
305 Ga0055529_1000214
306 Ga0055526_1003784
307 Ga0065165_1010472
308 Ga0070670_100091009
309 Ga0070660_100032999
310 Ga0070659_100496499
311 Ga0070667_100248812
312 Ga0068867_100472448
313 Ga0068855_100113765
314 Ga0068855_100355551
315 Ga0068855_100608895
316 Ga0068857_100008338
317 Ga0068856_100006192
318 Ga0068852_100290610
319 Ga0068864_100144333
320 Ga0068861_100569649
321 Ga0068863_100020825
322 Ga0068858_100130594
323 Ga0068862_100180127
324 Ga0075367_10030974
325 Ga0075369_10119458
326 Ga0075366_10025745
327 Ga0075370_10006543
328 Ga0075370_10011253
329 Ga0075370_10017229
330 Ga0105240_10031422
331 Ga0105243_10213759
332 Ga0105241_10085047
333 Ga0105242_10222754
334 Ga0105248_10011540
335 Ga0105237_10069362
336 Ga0105237_10661354
337 Ga0105238_10007404
338 Ga0105249_10508816
339 Ga0105239_10033562
340 Ga0157369_10115244
341 Ga0157378_10225871
342 Ga0157372_10614371
343 Ga0163163_10452604
344 Ga0157376_10000330
345 Ga0157376_10288540
346 Ga0182007_10043084
347 Ga0209674_100041
348 Ga0209563_100043
349 Ga0207427_100398
350 Ga0209258_100270
351 Ga0209258_101065
352 Ga0207425_1000334
353 Ga0209646_1000157
354 Ga0209026_1000006
355 Ga0209677_100098
356 Ga0209677_100245
357 Ga0209677_100632
358 Ga0209148_1000760
359 Ga0209148_1006610
360 Ga0209759_1000194
361 Ga0209759_1000635
362 Ga0209759_1000895
363 Ga0209759_1001736
364 Ga0209759_1002761
365 Ga0209129_1000027
366 Ga0209455_1000195
367 Ga0209564_1000014
368 Ga0209758_1000307
369 Ga0209758_1000524
370 Ga0209050_1001282
371 Ga0209256_1025091
372 Ga0209051_1010186
373 Ga0209051_1033687
374 Ga0207680_10237827
375 Ga0207654_10218301
376 Ga0207695_10056022
377 Ga0207695_10095404
378 Ga0207671_10550989
379 Ga0207657_10002333
380 Ga0207657_10060982
381 Ga0207649_10025838
382 Ga0207650_10082672
383 Ga0207690_10216768
384 Ga0207690_10296997
385 Ga0207686_10187142
386 Ga0207709_10117381
387 Ga0207689_10099414
388 Ga0207667_10021823
389 Ga0207667_10176018
390 Ga0207667_10303426
391 Ga0207667_10692958
392 Ga0207651_10068563
393 Ga0207640_10001763
394 Ga0207658_10238323
395 Ga0207702_10010797
396 Ga0207641_10076129
397 Ga0207648_10336770
398 Ga0207676_10023274
399 Ga0207674_10015895
400 Ga0207675_100047735
401 Ga0207698_10208407
402 Ga0265334_10037761
403 Ga0265336_10000133
404 Ga0307517_10017121
405 Ga0307517_10041379
406 Ga0307515_10000011
407 Ga0307515_10000281
408 Ga0307515_10002144
409 Ga0307515_10016657
410 Ga0307515_10019977
411 Ga0307515_10049174
412 Ga0307515_10062143
413 Ga0307515_10148049
414 Ga0307515_10215030
415 Ga0265324_10003353
416 Ga0307512_10011191
417 Ga0307512_10034668
418 Ga0316182_1135129
419 Ga0307513_10028493
420 Ga0307513_10056883
421 Ga0307513_10208260
422 Ga0307509_10002279
423 Ga0307509_10006738
424 Ga0307509_10024396
425 Ga0307509_10105876
426 Ga0307508_10000143
427 Ga0307508_10000216
428 Ga0307508_10146440
429 Ga0307514_10006402
430 Ga0307514_10108122
431 Ga0307516_10000901
432 Ga0307516_10001560
433 Ga0307516_10007648
434 Ga0307516_10285988
435 Ga0307412_10292248
436 Ga0307507_10099984
437 Ga0307510_10003871
438 Ga0307510_10024947
439 Ga0307510_10040916
440 Ga0307510_10091678
441 Ga0307510_10201332
442 Ga0373931_0028881
443 Ga0373931_0051548
444 Ga0373927_0100511
445 Ga0395900_0625721
446 Ga0395898_0019412
447 Ga0395905_0019503
448 Ga0395905_0263872
449 Ga0395905_0284991
450 Ga0395905_0327498
451 Ga0436364_0693644
452 Ga0395901_0004699
453 Ga0395901_0014164
454 Ga0451800_0269633
455 Ga0451807_0219865
456 Ga0451843_1294181
457 Ga0451853_1570849
458 Ga0451577_0002254
459 Ga0451577_0015977
460 Ga0451577_0077181
461 Ga0466969_0094692
462 Ga0466965_0002259
463 Ga0466965_0014157
464 Ga0466965_0016931
465 Ga0466966_0001037
466 Ga0466966_0001053
467 Ga0466966_0019476
468 Ga0466963_0140188
469 Ga0466964_0000627
470 Ga0466964_0003127
471 Ga0466964_0032605
472 Ga0453684_0098874
473 Ga0453684_0167261
474 Ga0453684_0341686
475 Ga0466971_0026538
476 Ga0466971_0061759
477 Ga0466968_0061488
478 Ga0466970_0001967
479 Ga0466970_0002128
480 Ga0466957_0015906
481 Ga0466957_0066376
482 Ga0466957_0086211
483 Ga0466957_0135432
484 Ga0466959_0000306
485 Ga0466959_0002313
486 Ga0466959_0010623
487 Ga0466959_0219383
488 Ga0466958_0029530
489 Ga0466967_0050869
490 Ga0466967_0153539
491 Ga0466967_0476369
492 Ga0495592_0000517
493 Ga0495629_0074501
494 Ga0495651_0088904
495 Ga0495650_0013322
496 Ga0495585_0027614
497 Ga0495583_0000328
498 Ga0495606_0010644
499 Ga0495610_0010566
500 Ga0495610_0111400
501 Ga0495632_0002637
502 Ga0495632_0009553
503 Ga0495643_0011053
504 Ga0495644_0005844
505 Ga0495622_0122423
506 Ga0495668_0022047
507 Ga0495625_0003598
508 Ga0495661_0061029
509 Ga0495658_0072335
510 Ga0495613_0139213
511 Ga0495624_0058701
512 Ga0495649_0006602
513 Ga0495589_0087978
514 Ga0495604_0034603
515 Ga0495676_0132620
516 Ga0495680_0024253
517 Ga0495686_0005178
518 Ga0495686_0024153
519 Ga0495686_0080694
520 Ga0495593_0115945
521 Ga0495602_0015985
522 Ga0496102_0029506
523 Ga0496102_0398047
524 Ga0496106_0013873
525 Ga0496107_0009952
526 Ga0496115_0063607
527 Ga0496121_0123969
528 Ga0501035_0039026
529 Ga0501035_0192632
530 nmdc:mga0k408_18445_c1
531 nmdc:mga07m45_12435_c1
532 nmdc:mga07m45_18380_c1
533 nmdc:mga0sz30_142258_c1
534 Ga0500635_0000295
535 Ga0500635_0067211
536 Ga0500578_0000006
537 Ga0500578_0162413
538 Ga0500578_0167322
539 Ga0500644_0023359
540 Ga0500651_0028430
541 Ga0500651_0108418
542 Ga0500562_029278
543 Ga0500594_0003277
544 Ga0500614_050786
545 Ga0500642_0002612
546 Ga0500652_000046
547 Ga0500652_056667
548 Ga0500655_002561
549 Ga0500559_0000558
550 Ga0500559_0015547
551 Ga0500568_0046597
552 Ga0500604_0020501
553 Ga0500604_0078671
554 Ga0500622_0000415
555 Ga0500622_0002629
556 Ga0500622_0109431
557 Ga0500636_0007387
558 Ga0500587_000110
559 Ga0500587_002253
560 Ga0500661_020586
561 2587730766
562 2587736777
563 2588295755
564 2643966949
565 2644142682
566 2644273643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08386

Abhydrolase_4

TAP-like protein

202

284

0.85

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

31

268

0.84

PF12146

Hydrolase_4

Serine aminopeptidase, S33

28

268

0.75

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

33

274

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.8685 1 126
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8547 1 126
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8531 1 126
1xrp-assembly1.cif.gz_A crystal structure of active site f1-mutant e213q soaked with peptide pro-leu-gly-gly 0.8202 1 280
3wmr-assembly3.cif.gz_C crystal structure of vinj 0.8189 1 279
ID Description Score Start End Superfamily
3oosA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8538 7 279 3.40.50.1820
2dstB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8299 1 124 3.40.50.12270
1xrpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8202 1 280 3.40.50.1820
af_A0A0P0WIT7_2_163_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8184 12 138 3.40.50.1820
1xrpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8147 1 280 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A5C7V236-F1-model_v4 Alpha/beta hydrolase 0.9895 131 280 GO:0016787
AF-A0A2A4V437-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9796 1 281 GO:0006508
GO:0008233
GO:0016020
AF-A0A2A4V437-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9761 1 281 GO:0006508
GO:0008233
GO:0016020
AF-A0A6I3XAE8-F1-model_v4 Alpha/beta fold hydrolase 0.9756 1 279 GO:0006508
GO:0008233
AF-A0A7G5Z499-F1-model_v4 Alpha/beta hydrolase 0.9725 1 278 GO:0006508
GO:0008233
GO:0016020

Map