F385800

General Info

Members Datasets Scaffolds Average Seq Length
283 180 280 151

Family's Representative Sequence

Representative Sequence 3300047318|Ga0495636_0007931|Ga0495636_0007931_271_714
Length 147
Sequence MPGTVTLHRVVKAPAERVYRAFLDADAMAKWLPPHGFTGKVHEMDARVGGGYRMSFTNFSTGSSHSFDGTYLELVPGEKLRYNDRFPGMPGEMEVTVTLKPVMTGTELHVVQQGIPDAIPVEFCYLGWQESLALLAQLVEPNIPDNL

Samples

Sample ID Description Type Environment
1 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
2 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
3 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
97 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
121 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
122 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
123 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
124 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
125 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
128 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 0
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.42
Nodule 1.06
Rhizoplane 0.71
Rhizosphere 89.05
Stem 0
Stem Tuber 0
Unclassified 1.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055539_1000031 3300003752 Bacteria 241526
2 Ga0055533_1000041 3300003756 Bacteria 241526
3 Ga0055525_1000049 3300003759 Bacteria 241526
4 Ga0055537_1000416 3300003773 Bacteria 27832
5 Ga0055534_1000008 3300003784 Bacteria 211098
6 Ga0055528_1000831 3300003790 Bacteria 21133
7 Ga0055541_1000022 3300003841 Bacteria 241526
8 Ga0068869_100576198 3300005334 Bacteria 948
9 Ga0068869_101229526 3300005334 Bacteria 659
10 Ga0070680_101940933 3300005336 Bacteria 510
11 Ga0070689_100747236 3300005340 Bacteria 857
12 Ga0070668_100090801 3300005347 Bacteria 2407
13 Ga0070669_100149484 3300005353 Bacteria 1807
14 Ga0070669_100572608 3300005353 Bacteria 944
15 Ga0070675_100331705 3300005354 Bacteria 1346
16 Ga0070671_100153693 3300005355 Bacteria 1943
17 Ga0070671_100478352 3300005355 Unclassified 1070
18 Ga0070673_100142242 3300005364 Bacteria 2025
19 Ga0070673_100312625 3300005364 Bacteria 1386
20 Ga0070688_100043413 3300005365 Bacteria 2770
21 Ga0070667_100112964 3300005367 Bacteria 2357
22 Ga0070667_101710903 3300005367 Bacteria 592
23 Ga0070685_10458020 3300005466 Bacteria 895
24 Ga0070706_101106118 3300005467 Bacteria 729
25 Ga0070707_100005804 3300005468 Bacteria 11515
26 Ga0070707_100497222 3300005468 Bacteria 1181
27 Ga0070698_100011682 3300005471 Bacteria 9314
28 Ga0070698_100315049 3300005471 Bacteria 1495
29 Ga0070699_100389968 3300005518 Bacteria 1258
30 Ga0070679_100160620 3300005530 Unclassified 2222
31 Ga0070679_101203373 3300005530 Bacteria 703
32 Ga0070672_100127852 3300005543 Bacteria 2086
33 Ga0070686_100009380 3300005544 Bacteria 5501
34 Ga0070665_100163691 3300005548 Bacteria 2227
35 Ga0070665_101886140 3300005548 Bacteria 604
36 Ga0070702_100520425 3300005615 Bacteria 877
37 Ga0068859_100565916 3300005617 Bacteria 1231
38 Ga0068859_101298170 3300005617 Bacteria 802
39 Ga0068861_100687619 3300005719 Bacteria 949
40 Ga0068863_100010781 3300005841 Bacteria 8866
41 Ga0068863_100200995 3300005841 Bacteria 1917
42 Ga0068863_100334350 3300005841 Bacteria 1473
43 Ga0081455_10000079 3300005937 Bacteria 104277
44 Ga0081455_10316789 3300005937 Bacteria 1113
45 Ga0081538_10004838 3300005981 Bacteria 12274
46 Ga0081539_10041663 3300005985 Bacteria 2682
47 Ga0081539_10146641 3300005985 Bacteria 1140
48 Ga0075364_10102931 3300006051 Bacteria 1902
49 Ga0075370_10004353 3300006353 Bacteria 6864
50 Ga0075428_100001973 3300006844 Bacteria 22106
51 Ga0075428_100006648 3300006844 Bacteria 12857
52 Ga0075428_100023126 3300006844 Bacteria 6876
53 Ga0075428_100093110 3300006844 Bacteria 3285
54 Ga0075428_101080684 3300006844 Bacteria 848
55 Ga0075428_101453500 3300006844 Bacteria 719
56 Ga0075428_101642984 3300006844 Bacteria 671
57 Ga0075428_102113132 3300006844 Bacteria 582
58 Ga0075430_100177347 3300006846 Bacteria 1773
59 Ga0075430_100721169 3300006846 Bacteria 822
60 Ga0075431_100027747 3300006847 Bacteria 5811
61 Ga0075431_100089655 3300006847 Bacteria 3174
62 Ga0075431_100097790 3300006847 Bacteria 3031
63 Ga0075431_100137498 3300006847 Bacteria 2519
64 Ga0075431_100170843 3300006847 Bacteria 2234
65 Ga0075431_101153133 3300006847 Bacteria 739
66 Ga0075431_101248320 3300006847 Bacteria 705
67 Ga0075431_101596526 3300006847 Bacteria 610
68 Ga0075433_10064208 3300006852 Bacteria 3218
69 Ga0075434_100041006 3300006871 Bacteria 4584
70 Ga0075429_100016608 3300006880 Bacteria 6377
71 Ga0075429_100040230 3300006880 Bacteria 4069
72 Ga0075429_100396515 3300006880 Bacteria 1208
73 Ga0075429_100399953 3300006880 Bacteria 1203
74 Ga0075429_100976678 3300006880 Bacteria 741
75 Ga0097620_100565912 3300006931 Bacteria 1231
76 Ga0097620_101298041 3300006931 Bacteria 802
77 Ga0097620_101322671 3300006931 Bacteria 794
78 Ga0075435_100045810 3300007076 Bacteria 3507
79 Ga0105240_10025759 3300009093 Bacteria 7724
80 Ga0105240_10032590 3300009093 Bacteria 6745
81 Ga0111539_10005482 3300009094 Bacteria 16409
82 Ga0111539_10124402 3300009094 Bacteria 3022
83 Ga0114129_10007173 3300009147 Bacteria 15864
84 Ga0114129_10039467 3300009147 Bacteria 6655
85 Ga0114129_10061961 3300009147 Bacteria 5227
86 Ga0114129_11313315 3300009147 Bacteria 896
87 Ga0114129_11413991 3300009147 Bacteria 858
88 Ga0114129_11955542 3300009147 Bacteria 710
89 Ga0105248_11097846 3300009177 Bacteria 899
90 Ga0105237_10867971 3300009545 Bacteria 909
91 Ga0105239_10073151 3300010375 Bacteria 3768
92 Ga0157378_10514554 3300013297 Bacteria 1197
93 Ga0163162_10828900 3300013306 Bacteria 1041
94 Ga0163162_10857841 3300013306 Bacteria 1023
95 Ga0157375_10117457 3300013308 Bacteria 2765
96 Ga0157375_10154987 3300013308 Bacteria 2429
97 Ga0157375_11124923 3300013308 Bacteria 920
98 Ga0163163_11127467 3300014325 Bacteria 847
99 Ga0157380_11507863 3300014326 Bacteria 726
100 Ga0157376_11557194 3300014969 Bacteria 695
101 Ga0209784_100018 3300025224 Bacteria 456816
102 Ga0209566_100016 3300025225 Bacteria 456824
103 Ga0209674_100030 3300025226 Bacteria 456824
104 Ga0209563_100034 3300025230 Bacteria 456824
105 Ga0209677_100019 3300025253 Bacteria 456824
106 Ga0209565_1000042 3300025263 Bacteria 239712
107 Ga0209673_1000071 3300025273 Bacteria 239966
108 Ga0209675_1000041 3300025291 Bacteria 239712
109 Ga0209025_1014423 3300025294 Bacteria 4857
110 Ga0209564_1050483 3300025295 Bacteria 1018
111 Ga0209051_1038823 3300025303 Bacteria 1728
112 Ga0207645_10063412 3300025907 Bacteria 2361
113 Ga0207654_11292635 3300025911 Bacteria 532
114 Ga0207695_10040777 3300025913 Bacteria 4973
115 Ga0207695_10093038 3300025913 Bacteria 3024
116 Ga0207671_10610733 3300025914 Bacteria 869
117 Ga0207652_10199372 3300025921 Bacteria 1801
118 Ga0207652_10607438 3300025921 Bacteria 980
119 Ga0207646_10018972 3300025922 Bacteria 6403
120 Ga0207646_10879671 3300025922 Bacteria 795
121 Ga0207681_10186126 3300025923 Bacteria 1585
122 Ga0207650_10336274 3300025925 Bacteria 1239
123 Ga0207659_10194904 3300025926 Bacteria 1614
124 Ga0207659_10648408 3300025926 Bacteria 902
125 Ga0207644_10520090 3300025931 Bacteria 983
126 Ga0207644_11664433 3300025931 Unclassified 535
127 Ga0207670_10669195 3300025936 Bacteria 857
128 Ga0207704_11168539 3300025938 Bacteria 655
129 Ga0207691_10420059 3300025940 Bacteria 1140
130 Ga0207691_11580722 3300025940 Bacteria 534
131 Ga0207651_10073606 3300025960 Bacteria 2430
132 Ga0207651_11261252 3300025960 Bacteria 664
133 Ga0207712_10637826 3300025961 Bacteria 925
134 Ga0207668_10076273 3300025972 Bacteria 2413
135 Ga0207658_10382350 3300025986 Bacteria 1233
136 Ga0207658_11919144 3300025986 Bacteria 539
137 Ga0207677_10005298 3300026023 Bacteria 6994
138 Ga0207703_11156603 3300026035 Bacteria 744
139 Ga0207678_10130735 3300026067 Bacteria 2141
140 Ga0207678_10584475 3300026067 Bacteria 978
141 Ga0207708_10038481 3300026075 Bacteria 3644
142 Ga0207641_10049767 3300026088 Bacteria 3542
143 Ga0207641_10244615 3300026088 Bacteria 1673
144 Ga0207641_10534548 3300026088 Bacteria 1142
145 Ga0207676_10392087 3300026095 Bacteria 1295
146 Ga0207676_10422855 3300026095 Bacteria 1250
147 Ga0207675_100215828 3300026118 Bacteria 1847
148 Ga0207675_101790550 3300026118 Bacteria 633
149 Ga0209996_1036665 3300027395 Bacteria 722
150 Ga0209983_1048889 3300027665 Bacteria 923
151 Ga0209282_1021535 3300027666 Bacteria 4073
152 Ga0209974_10033982 3300027876 Bacteria 1693
153 Ga0207428_10054235 3300027907 Bacteria 3193
154 Ga0207428_10139249 3300027907 Bacteria 1853
155 Ga0207428_10147480 3300027907 Bacteria 1792
156 Ga0268266_10665893 3300028379 Bacteria 1002
157 Ga0268264_11330479 3300028381 Bacteria 729
158 Ga0265323_10077573 3300028653 Bacteria 1126
159 Ga0265327_10087341 3300031251 Bacteria 1528
160 Ga0265316_10013182 3300031344 Bacteria 7362
161 Ga0307408_100013107 3300031548 Bacteria 5503
162 Ga0307408_100103155 3300031548 Bacteria 2177
163 Ga0307408_100158169 3300031548 Bacteria 1797
164 Ga0265314_10002958 3300031711 Bacteria 16836
165 Ga0265342_10010112 3300031712 Bacteria 6577
166 Ga0307516_10142922 3300031730 Bacteria 2160
167 Ga0307405_10764675 3300031731 Bacteria 806
168 Ga0307405_11197360 3300031731 Bacteria 657
169 Ga0307413_10068592 3300031824 Bacteria 2222
170 Ga0307413_10264192 3300031824 Bacteria 1285
171 Ga0307407_10282790 3300031903 Bacteria 1150
172 Ga0307407_10739090 3300031903 Bacteria 744
173 Ga0307412_10025693 3300031911 Bacteria 3651
174 Ga0307412_10134812 3300031911 Bacteria 1800
175 Ga0307416_100579939 3300032002 Bacteria 1199
176 Ga0307416_100603774 3300032002 Bacteria 1177
177 Ga0307416_100724604 3300032002 Bacteria 1085
178 Ga0307411_10169142 3300032005 Bacteria 1646
179 Ga0307415_100570389 3300032126 Bacteria 1002
180 Ga0307415_100645823 3300032126 Bacteria 948
181 Ga0373935_0010073 3300035692 Bacteria 5662
182 Ga0373947_0022108 3300035725 Bacteria 3686
183 Ga0373925_0007664 3300037068 Bacteria 7864
184 Ga0395898_0770571 3300037466 Bacteria 903
185 Ga0395901_0033971 3300038443 Bacteria 5266
186 Ga0439466_0284783 3300041411 Bacteria 501
187 Ga0439465_0378086 3300041413 Bacteria 537
188 Ga0451797_1542476 3300041453 Bacteria 1076
189 Ga0451798_0201168 3300041458 Bacteria 817
190 Ga0451835_1220062 3300041492 Bacteria 609
191 Ga0451849_1044736 3300041505 Bacteria 609
192 Ga0451853_1243571 3300041512 Bacteria 4922
193 Ga0439431_0111644 3300041997 Bacteria 757
194 Ga0439449_0021853 3300042007 Bacteria 2394
195 Ga0451577_0021732 3300042876 Bacteria 5868
196 Ga0451577_0151943 3300042876 Bacteria 2083
197 Ga0451577_0490845 3300042876 Bacteria 1115
198 Ga0466969_0013732 3300044656 Bacteria 4264
199 Ga0453683_0068683 3300044673 Bacteria 2216
200 Ga0466965_0054652 3300044683 Bacteria 1986
201 Ga0466966_0007204 3300044684 Bacteria 7373
202 Ga0466961_0013520 3300044693 Bacteria 5226
203 Ga0453684_0330745 3300044712 Bacteria 1723
204 Ga0453684_0543690 3300044712 Bacteria 1280
205 Ga0453684_1077240 3300044712 Bacteria 850
206 Ga0466971_0008489 3300044719 Bacteria 4479
207 Ga0466959_0009884 3300045049 Bacteria 6799
208 Ga0451576_0002683 3300045051 Bacteria 25918
209 Ga0451576_0025774 3300045051 Bacteria 6333
210 Ga0451576_0545148 3300045051 Bacteria 1219
211 Ga0466958_0087184 3300045836 Bacteria 1927
212 Ga0495580_0001232 3300046472 Bacteria 22569
213 Ga0495664_0430593 3300046477 Bacteria 791
214 Ga0495628_0007342 3300046516 Bacteria 9539
215 Ga0495630_0059206 3300046517 Bacteria 2873
216 Ga0495586_0029099 3300046535 Unclassified 2957
217 Ga0495633_0440259 3300046558 Bacteria 589
218 Ga0495636_0007931 3300047318 Bacteria 4180
219 Ga0495636_0014815 3300047318 Bacteria 3102
220 Ga0495674_0409321 3300047319 Bacteria 1094
221 Ga0495684_0565264 3300047471 Bacteria 772
222 Ga0495686_0009195 3300047472 Bacteria 7153
223 Ga0501299_108228 3300049522 Bacteria 654
224 Ga0501034_0017569 3300049571 Bacteria 7335
225 Ga0501034_0491316 3300049571 Bacteria 1142
226 Ga0501036_1323511 3300049572 Bacteria 585
227 Ga0501039_1333536 3300049575 Bacteria 553
228 Ga0501043_0352081 3300049579 Bacteria 1119
229 Ga0501046_0298912 3300049580 Bacteria 1176
230 Ga0501047_0082661 3300049581 Bacteria 3087
231 Ga0501068_0213651 3300049584 Bacteria 1225
232 Ga0501070_0706934 3300049586 Bacteria 797
233 Ga0501071_0122369 3300049587 Bacteria 1929
234 Ga0501072_0194362 3300049588 Bacteria 1618
235 Ga0501075_0059570 3300049591 Bacteria 2876
236 Ga0501075_0293314 3300049591 Bacteria 1239
237 Ga0501075_0366031 3300049591 Bacteria 1099
238 Ga0501076_0015382 3300049592 Bacteria 5782
239 Ga0501076_1179635 3300049592 Bacteria 630
240 Ga0501077_0076135 3300049593 Bacteria 2125
241 Ga0501077_0160755 3300049593 Bacteria 1426
242 Ga0501080_0128653 3300049742 Bacteria 2345
243 Ga0501081_0078014 3300049743 Bacteria 2315
244 Ga0501083_0396628 3300049744 Bacteria 898
245 Ga0501045_1041118 3300049824 Bacteria 599
246 nmdc:mga07m45_27137_c1 3300050496 Bacteria 3152
247 nmdc:mga05p37_101264_c1 3300050507 Bacteria 3548
248 nmdc:mga05p37_1164214_c1 3300050507 Bacteria 801
249 nmdc:mga05p37_124324_c1 3300050507 Bacteria 3169
250 nmdc:mga05p37_1252879_c1 3300050507 Bacteria 761
251 nmdc:mga05p37_1847_c1 3300050507 Bacteria 24673
252 nmdc:mga05p37_42123_c2 3300050507 Bacteria 4098
253 nmdc:mga05p37_45354_c1 3300050507 Bacteria 5408
254 nmdc:mga09592_21168_c1 3300050508 Bacteria 5358
255 nmdc:mga09592_24555_c1 3300050508 Bacteria 4985
256 nmdc:mga09592_285524_c1 3300050508 Bacteria 1431
257 nmdc:mga09592_750738_c1 3300050508 Bacteria 828
258 nmdc:mga0qj67_167661_c1 3300050509 Bacteria 1783
259 nmdc:mga0qj67_533384_c1 3300050509 Bacteria 942
260 nmdc:mga0qj67_793772_c1 3300050509 Bacteria 750
261 nmdc:mga06r32_1156065_c1 3300050510 Bacteria 721
262 nmdc:mga06r32_1259293_c1 3300050510 Bacteria 684
263 nmdc:mga06r32_136684_c1 3300050510 Bacteria 2425
264 nmdc:mga06r32_15796_c1 3300050510 Bacteria 6864
265 nmdc:mga06r32_58243_c1 3300050510 Bacteria 3713
266 nmdc:mga06r32_662489_c1 3300050510 Bacteria 1011
267 nmdc:mga06r32_676457_c1 3300050510 Bacteria 999
268 nmdc:mga08y16_15899_c1 3300050511 Bacteria 7909
269 nmdc:mga08y16_3531_c1 3300050511 Bacteria 16232
270 nmdc:mga08y16_55333_c1 3300050511 Bacteria 4146
271 nmdc:mga0n895_100764_c1 3300050512 Bacteria 2897
272 nmdc:mga0n895_321683_c1 3300050512 Bacteria 1568
273 nmdc:mga0rr50_1427019_c1 3300050513 Bacteria 586
274 nmdc:mga0rr50_40217_c1 3300050513 Bacteria 3399
275 nmdc:mga0a205_369098_c1 3300050515 Bacteria 1301
276 nmdc:mga0a205_60199_c1 3300050515 Bacteria 3667
277 Ga0495601_0004675 3300053077 Bacteria 7927
278 Ga0501084_0115472 3300054114 Bacteria 2256
279 Ga0466962_0021447 3300061719 Bacteria 3101
280 Ga0530510_0170012 3300061734 Bacteria 1614

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2510065045 2510247327 144
2 iso_pu_bacteria 2718217991 2719638499 144
3 3300049575 Ga0501039_1333536 Ga0501039_1333536_11_448 145
4 3300049744 Ga0501083_0396628 Ga0501083_0396628_433_870 145
5 3300006844 Ga0075428_100001973 Ga0075428_1000019732 146
6 3300006847 Ga0075431_100170843 Ga0075431_1001708431 146
7 3300014969 Ga0157376_11557194 Ga0157376_115571941 146
8 3300041505 Ga0451849_1044736 Ga0451849_1044736_26_535 146
9 3300050510 nmdc:mga06r32_136684_c1 nmdc:mga06r32_136684_c1_1883_2323 146
10 3300005336 Ga0070680_101940933 Ga0070680_1019409331 147
11 3300005340 Ga0070689_100747236 Ga0070689_1007472362 147
12 3300005347 Ga0070668_100090801 Ga0070668_1000908012 147
13 3300005841 Ga0068863_100010781 Ga0068863_10001078111 147
14 3300006844 Ga0075428_101080684 Ga0075428_1010806842 147
15 3300006844 Ga0075428_101453500 Ga0075428_1014535002 147
16 3300006847 Ga0075431_100097790 Ga0075431_1000977902 147
17 3300009093 Ga0105240_10032590 Ga0105240_100325903 147
18 3300009094 Ga0111539_10005482 Ga0111539_100054825 147
19 3300010375 Ga0105239_10073151 Ga0105239_100731515 147
20 3300025913 Ga0207695_10093038 Ga0207695_100930384 147
21 3300025921 Ga0207652_10199372 Ga0207652_101993723 147
22 3300025926 Ga0207659_10648408 Ga0207659_106484082 147
23 3300025960 Ga0207651_11261252 Ga0207651_112612522 147
24 3300025972 Ga0207668_10076273 Ga0207668_100762733 147
25 3300026067 Ga0207678_10130735 Ga0207678_101307352 147
26 3300026088 Ga0207641_10049767 Ga0207641_100497673 147
27 3300026095 Ga0207676_10392087 Ga0207676_103920871 147
28 3300026118 Ga0207675_100215828 Ga0207675_1002158282 147
29 3300027395 Ga0209996_1036665 Ga0209996_10366651 147
30 3300027907 Ga0207428_10054235 Ga0207428_100542352 147
31 3300027907 Ga0207428_10139249 Ga0207428_101392492 147
32 3300031548 Ga0307408_100013107 Ga0307408_1000131078 147
33 3300031731 Ga0307405_11197360 Ga0307405_111973601 147
34 3300031824 Ga0307413_10068592 Ga0307413_100685925 147
35 3300031903 Ga0307407_10739090 Ga0307407_107390901 147
36 3300032002 Ga0307416_100724604 Ga0307416_1007246042 147
37 3300032005 Ga0307411_10169142 Ga0307411_101691421 147
38 3300038443 Ga0395901_0033971 Ga0395901_0033971_1101_1544 147
39 3300047318 Ga0495636_0007931 Ga0495636_0007931_271_714 147
40 3300049522 Ga0501299_108228 Ga0501299_108228_125_568 147
41 3300050507 nmdc:mga05p37_124324_c1 nmdc:mga05p37_124324_c1_62_505 147
42 3300050511 nmdc:mga08y16_15899_c1 nmdc:mga08y16_15899_c1_3832_4275 147
43 3300050511 nmdc:mga08y16_3531_c1 nmdc:mga08y16_3531_c1_13545_13988 147
44 3300050511 nmdc:mga08y16_55333_c1 nmdc:mga08y16_55333_c1_1382_1825 147
45 3300050512 nmdc:mga0n895_321683_c1 nmdc:mga0n895_321683_c1_1079_1522 147
46 3300050513 nmdc:mga0rr50_1427019_c1 nmdc:mga0rr50_1427019_c1_58_501 147
47 iso_pu_bacteria 2919046199 2919048672 147
48 3300003773 Ga0055537_1000416 Ga0055537_100041629 148
49 3300003784 Ga0055534_1000008 Ga0055534_100000829 148
50 3300003790 Ga0055528_1000831 Ga0055528_100083122 148
51 3300005334 Ga0068869_100576198 Ga0068869_1005761981 148
52 3300005353 Ga0070669_100149484 Ga0070669_1001494842 148
53 3300005354 Ga0070675_100331705 Ga0070675_1003317053 148
54 3300005355 Ga0070671_100153693 Ga0070671_1001536933 148
55 3300005364 Ga0070673_100142242 Ga0070673_1001422422 148
56 3300005365 Ga0070688_100043413 Ga0070688_1000434132 148
57 3300005367 Ga0070667_100112964 Ga0070667_1001129643 148
58 3300005466 Ga0070685_10458020 Ga0070685_104580202 148
59 3300005467 Ga0070706_101106118 Ga0070706_1011061182 148
60 3300005468 Ga0070707_100497222 Ga0070707_1004972222 148
61 3300005471 Ga0070698_100315049 Ga0070698_1003150492 148
62 3300005530 Ga0070679_100160620 Ga0070679_1001606203 148
63 3300005530 Ga0070679_101203373 Ga0070679_1012033731 148
64 3300005543 Ga0070672_100127852 Ga0070672_1001278525 148
65 3300005544 Ga0070686_100009380 Ga0070686_1000093803 148
66 3300005548 Ga0070665_100163691 Ga0070665_1001636914 148
67 3300005615 Ga0070702_100520425 Ga0070702_1005204251 148
68 3300005617 Ga0068859_100565916 Ga0068859_1005659163 148
69 3300005719 Ga0068861_100687619 Ga0068861_1006876191 148
70 3300006051 Ga0075364_10102931 Ga0075364_101029312 148
71 3300006353 Ga0075370_10004353 Ga0075370_100043534 148
72 3300006931 Ga0097620_100565912 Ga0097620_1005659123 148
73 3300009093 Ga0105240_10025759 Ga0105240_100257597 148
74 3300013308 Ga0157375_10154987 Ga0157375_101549874 148
75 3300025263 Ga0209565_1000042 Ga0209565_100004229 148
76 3300025273 Ga0209673_1000071 Ga0209673_1000071198 148
77 3300025291 Ga0209675_1000041 Ga0209675_1000041197 148
78 3300025294 Ga0209025_1014423 Ga0209025_10144232 148
79 3300025295 Ga0209564_1050483 Ga0209564_10504832 148
80 3300025303 Ga0209051_1038823 Ga0209051_10388232 148
81 3300025907 Ga0207645_10063412 Ga0207645_100634123 148
82 3300025913 Ga0207695_10040777 Ga0207695_100407775 148
83 3300025921 Ga0207652_10607438 Ga0207652_106074382 148
84 3300025922 Ga0207646_10879671 Ga0207646_108796711 148
85 3300025923 Ga0207681_10186126 Ga0207681_101861264 148
86 3300025925 Ga0207650_10336274 Ga0207650_103362742 148
87 3300025926 Ga0207659_10194904 Ga0207659_101949043 148
88 3300025931 Ga0207644_10520090 Ga0207644_105200902 148
89 3300025936 Ga0207670_10669195 Ga0207670_106691951 148
90 3300025940 Ga0207691_10420059 Ga0207691_104200592 148
91 3300025940 Ga0207691_11580722 Ga0207691_115807221 148
92 3300025960 Ga0207651_10073606 Ga0207651_100736062 148
93 3300025986 Ga0207658_10382350 Ga0207658_103823502 148
94 3300026075 Ga0207708_10038481 Ga0207708_100384811 148
95 3300026088 Ga0207641_10534548 Ga0207641_105345482 148
96 3300026095 Ga0207676_10422855 Ga0207676_104228552 148
97 3300027666 Ga0209282_1021535 Ga0209282_10215358 148
98 3300028379 Ga0268266_10665893 Ga0268266_106658932 148
99 3300028381 Ga0268264_11330479 Ga0268264_113304791 148
100 3300028653 Ga0265323_10077573 Ga0265323_100775732 148
101 3300031344 Ga0265316_10013182 Ga0265316_100131824 148
102 3300031548 Ga0307408_100103155 Ga0307408_1001031553 148
103 3300031711 Ga0265314_10002958 Ga0265314_1000295814 148
104 3300031712 Ga0265342_10010112 Ga0265342_100101123 148
105 3300031731 Ga0307405_10764675 Ga0307405_107646751 148
106 3300031824 Ga0307413_10264192 Ga0307413_102641923 148
107 3300031911 Ga0307412_10025693 Ga0307412_100256935 148
108 3300031911 Ga0307412_10134812 Ga0307412_101348122 148
109 3300032002 Ga0307416_100579939 Ga0307416_1005799392 148
110 3300032002 Ga0307416_100603774 Ga0307416_1006037741 148
111 3300032126 Ga0307415_100570389 Ga0307415_1005703892 148
112 3300032126 Ga0307415_100645823 Ga0307415_1006458231 148
113 3300042876 Ga0451577_0151943 Ga0451577_0151943_884_1330 148
114 3300042876 Ga0451577_0490845 Ga0451577_0490845_48_494 148
115 3300044712 Ga0453684_0330745 Ga0453684_0330745_786_1232 148
116 3300044712 Ga0453684_0543690 Ga0453684_0543690_737_1183 148
117 3300045051 Ga0451576_0025774 Ga0451576_0025774_5302_5748 148
118 3300046477 Ga0495664_0430593 Ga0495664_0430593_273_719 148
119 3300046516 Ga0495628_0007342 Ga0495628_0007342_2341_2787 148
120 3300046517 Ga0495630_0059206 Ga0495630_0059206_2136_2582 148
121 3300046535 Ga0495586_0029099 Ga0495586_0029099_1239_1685 148
122 3300047319 Ga0495674_0409321 Ga0495674_0409321_429_875 148
123 3300047471 Ga0495684_0565264 Ga0495684_0565264_43_489 148
124 3300050496 nmdc:mga07m45_27137_c1 nmdc:mga07m45_27137_c1_639_1085 148
125 3300050507 nmdc:mga05p37_42123_c2 nmdc:mga05p37_42123_c2_3170_3616 148
126 3300053077 Ga0495601_0004675 Ga0495601_0004675_608_1054 148
127 3300005334 Ga0068869_101229526 Ga0068869_1012295262 149
128 3300005355 Ga0070671_100478352 Ga0070671_1004783521 149
129 3300005364 Ga0070673_100312625 Ga0070673_1003126252 149
130 3300005367 Ga0070667_101710903 Ga0070667_1017109031 149
131 3300005468 Ga0070707_100005804 Ga0070707_1000058045 149
132 3300005471 Ga0070698_100011682 Ga0070698_1000116825 149
133 3300005548 Ga0070665_101886140 Ga0070665_1018861401 149
134 3300005937 Ga0081455_10000079 Ga0081455_1000007915 149
135 3300006844 Ga0075428_100006648 Ga0075428_1000066483 149
136 3300006844 Ga0075428_101642984 Ga0075428_1016429841 149
137 3300006846 Ga0075430_100721169 Ga0075430_1007211691 149
138 3300006847 Ga0075431_100137498 Ga0075431_1001374981 149
139 3300006847 Ga0075431_101153133 Ga0075431_1011531331 149
140 3300006847 Ga0075431_101248320 Ga0075431_1012483201 149
141 3300006880 Ga0075429_100396515 Ga0075429_1003965152 149
142 3300006880 Ga0075429_100399953 Ga0075429_1003999532 149
143 3300006880 Ga0075429_100976678 Ga0075429_1009766781 149
144 3300006931 Ga0097620_101322671 Ga0097620_1013226712 149
145 3300009094 Ga0111539_10124402 Ga0111539_101244023 149
146 3300009147 Ga0114129_11313315 Ga0114129_113133151 149
147 3300009147 Ga0114129_11413991 Ga0114129_114139911 149
148 3300009147 Ga0114129_11955542 Ga0114129_119555422 149
149 3300009177 Ga0105248_11097846 Ga0105248_110978462 149
150 3300013306 Ga0163162_10828900 Ga0163162_108289001 149
151 3300013308 Ga0157375_10117457 Ga0157375_101174572 149
152 3300014326 Ga0157380_11507863 Ga0157380_115078631 149
153 3300025911 Ga0207654_11292635 Ga0207654_112926351 149
154 3300025922 Ga0207646_10018972 Ga0207646_100189724 149
155 3300025931 Ga0207644_11664433 Ga0207644_116644331 149
156 3300025961 Ga0207712_10637826 Ga0207712_106378262 149
157 3300025986 Ga0207658_11919144 Ga0207658_119191441 149
158 3300026118 Ga0207675_101790550 Ga0207675_1017905501 149
159 3300027907 Ga0207428_10147480 Ga0207428_101474801 149
160 3300037466 Ga0395898_0770571 Ga0395898_0770571_35_490 149
161 3300041411 Ga0439466_0284783 Ga0439466_0284783_14_463 149
162 3300041453 Ga0451797_1542476 Ga0451797_1542476_531_980 149
163 3300041458 Ga0451798_0201168 Ga0451798_0201168_131_580 149
164 3300041492 Ga0451835_1220062 Ga0451835_1220062_83_535 149
165 3300041512 Ga0451853_1243571 Ga0451853_1243571_3309_3758 149
166 3300041997 Ga0439431_0111644 Ga0439431_0111644_84_533 149
167 3300042876 Ga0451577_0021732 Ga0451577_0021732_1624_2073 149
168 3300044656 Ga0466969_0013732 Ga0466969_0013732_2958_3407 149
169 3300044673 Ga0453683_0068683 Ga0453683_0068683_369_818 149
170 3300044683 Ga0466965_0054652 Ga0466965_0054652_1401_1850 149
171 3300044684 Ga0466966_0007204 Ga0466966_0007204_2137_2586 149
172 3300044693 Ga0466961_0013520 Ga0466961_0013520_1707_2156 149
173 3300044712 Ga0453684_1077240 Ga0453684_1077240_253_702 149
174 3300044719 Ga0466971_0008489 Ga0466971_0008489_2842_3291 149
175 3300045049 Ga0466959_0009884 Ga0466959_0009884_5391_5840 149
176 3300045051 Ga0451576_0002683 Ga0451576_0002683_15075_15524 149
177 3300045836 Ga0466958_0087184 Ga0466958_0087184_950_1399 149
178 3300047318 Ga0495636_0014815 Ga0495636_0014815_2388_2837 149
179 3300049571 Ga0501034_0017569 Ga0501034_0017569_1101_1568 149
180 3300049571 Ga0501034_0491316 Ga0501034_0491316_518_967 149
181 3300050507 nmdc:mga05p37_1164214_c1 nmdc:mga05p37_1164214_c1_183_644 149
182 3300050509 nmdc:mga0qj67_533384_c1 nmdc:mga0qj67_533384_c1_432_884 149
183 3300050510 nmdc:mga06r32_1259293_c1 nmdc:mga06r32_1259293_c1_82_534 149
184 3300050510 nmdc:mga06r32_676457_c1 nmdc:mga06r32_676457_c1_21_473 149
185 3300061719 Ga0466962_0021447 Ga0466962_0021447_1465_1914 149
186 3300005518 Ga0070699_100389968 Ga0070699_1003899682 150
187 3300014325 Ga0163163_11127467 Ga0163163_111274672 150
188 3300026023 Ga0207677_10005298 Ga0207677_100052981 150
189 3300031730 Ga0307516_10142922 Ga0307516_101429222 150
190 3300049581 Ga0501047_0082661 Ga0501047_0082661_2590_3045 150
191 3300050507 nmdc:mga05p37_1252879_c1 nmdc:mga05p37_1252879_c1_226_681 150
192 3300050508 nmdc:mga09592_285524_c1 nmdc:mga09592_285524_c1_928_1383 150
193 3300050508 nmdc:mga09592_750738_c1 nmdc:mga09592_750738_c1_22_477 150
194 3300050509 nmdc:mga0qj67_793772_c1 nmdc:mga0qj67_793772_c1_209_664 150
195 3300003752 Ga0055539_1000031 Ga0055539_1000031190 151
196 3300003756 Ga0055533_1000041 Ga0055533_1000041190 151
197 3300003759 Ga0055525_1000049 Ga0055525_1000049190 151
198 3300003841 Ga0055541_1000022 Ga0055541_1000022190 151
199 3300005353 Ga0070669_100572608 Ga0070669_1005726081 151
200 3300005617 Ga0068859_101298170 Ga0068859_1012981701 151
201 3300005841 Ga0068863_100200995 Ga0068863_1002009952 151
202 3300005841 Ga0068863_100334350 Ga0068863_1003343502 151
203 3300005937 Ga0081455_10316789 Ga0081455_103167891 151
204 3300005981 Ga0081538_10004838 Ga0081538_100048384 151
205 3300005985 Ga0081539_10041663 Ga0081539_100416634 151
206 3300005985 Ga0081539_10146641 Ga0081539_101466412 151
207 3300006844 Ga0075428_100023126 Ga0075428_1000231268 151
208 3300006844 Ga0075428_100093110 Ga0075428_1000931105 151
209 3300006844 Ga0075428_102113132 Ga0075428_1021131321 151
210 3300006846 Ga0075430_100177347 Ga0075430_1001773471 151
211 3300006847 Ga0075431_100027747 Ga0075431_1000277474 151
212 3300006847 Ga0075431_100089655 Ga0075431_1000896551 151
213 3300006847 Ga0075431_101596526 Ga0075431_1015965261 151
214 3300006852 Ga0075433_10064208 Ga0075433_100642083 151
215 3300006871 Ga0075434_100041006 Ga0075434_1000410067 151
216 3300006880 Ga0075429_100016608 Ga0075429_1000166086 151
217 3300006880 Ga0075429_100040230 Ga0075429_1000402306 151
218 3300006931 Ga0097620_101298041 Ga0097620_1012980412 151
219 3300007076 Ga0075435_100045810 Ga0075435_1000458103 151
220 3300009147 Ga0114129_10007173 Ga0114129_100071734 151
221 3300009147 Ga0114129_10039467 Ga0114129_100394676 151
222 3300009147 Ga0114129_10061961 Ga0114129_100619613 151
223 3300009545 Ga0105237_10867971 Ga0105237_108679712 151
224 3300013297 Ga0157378_10514554 Ga0157378_105145541 151
225 3300013306 Ga0163162_10857841 Ga0163162_108578411 151
226 3300013308 Ga0157375_11124923 Ga0157375_111249231 151
227 3300025224 Ga0209784_100018 Ga0209784_100018188 151
228 3300025225 Ga0209566_100016 Ga0209566_100016188 151
229 3300025226 Ga0209674_100030 Ga0209674_100030188 151
230 3300025230 Ga0209563_100034 Ga0209563_100034188 151
231 3300025253 Ga0209677_100019 Ga0209677_100019188 151
232 3300025914 Ga0207671_10610733 Ga0207671_106107331 151
233 3300025938 Ga0207704_11168539 Ga0207704_111685391 151
234 3300026035 Ga0207703_11156603 Ga0207703_111566032 151
235 3300026067 Ga0207678_10584475 Ga0207678_105844752 151
236 3300026088 Ga0207641_10244615 Ga0207641_102446152 151
237 3300027665 Ga0209983_1048889 Ga0209983_10488891 151
238 3300027876 Ga0209974_10033982 Ga0209974_100339823 151
239 3300031251 Ga0265327_10087341 Ga0265327_100873412 151
240 3300031548 Ga0307408_100158169 Ga0307408_1001581692 151
241 3300031903 Ga0307407_10282790 Ga0307407_102827902 151
242 3300035692 Ga0373935_0010073 Ga0373935_0010073_1439_1897 151
243 3300035725 Ga0373947_0022108 Ga0373947_0022108_2457_2915 151
244 3300037068 Ga0373925_0007664 Ga0373925_0007664_5328_5786 151
245 3300041413 Ga0439465_0378086 Ga0439465_0378086_28_516 151
246 3300042007 Ga0439449_0021853 Ga0439449_0021853_744_1208 151
247 3300045051 Ga0451576_0545148 Ga0451576_0545148_614_1108 151
248 3300046472 Ga0495580_0001232 Ga0495580_0001232_10672_11130 151
249 3300046558 Ga0495633_0440259 Ga0495633_0440259_40_498 151
250 3300047472 Ga0495686_0009195 Ga0495686_0009195_3451_3918 151
251 3300049572 Ga0501036_1323511 Ga0501036_1323511_65_568 151
252 3300049579 Ga0501043_0352081 Ga0501043_0352081_445_909 151
253 3300049580 Ga0501046_0298912 Ga0501046_0298912_634_1098 151
254 3300049584 Ga0501068_0213651 Ga0501068_0213651_121_585 151
255 3300049586 Ga0501070_0706934 Ga0501070_0706934_57_518 151
256 3300049587 Ga0501071_0122369 Ga0501071_0122369_265_729 151
257 3300049588 Ga0501072_0194362 Ga0501072_0194362_146_610 151
258 3300049591 Ga0501075_0059570 Ga0501075_0059570_1004_1468 151
259 3300049591 Ga0501075_0293314 Ga0501075_0293314_412_876 151
260 3300049591 Ga0501075_0366031 Ga0501075_0366031_69_611 151
261 3300049592 Ga0501076_0015382 Ga0501076_0015382_4643_5107 151
262 3300049592 Ga0501076_1179635 Ga0501076_1179635_86_592 151
263 3300049593 Ga0501077_0076135 Ga0501077_0076135_1354_1818 151
264 3300049593 Ga0501077_0160755 Ga0501077_0160755_196_738 151
265 3300049742 Ga0501080_0128653 Ga0501080_0128653_1327_1791 151
266 3300049743 Ga0501081_0078014 Ga0501081_0078014_491_955 151
267 3300049824 Ga0501045_1041118 Ga0501045_1041118_55_519 151
268 3300050507 nmdc:mga05p37_101264_c1 nmdc:mga05p37_101264_c1_145_603 151
269 3300050507 nmdc:mga05p37_1847_c1 nmdc:mga05p37_1847_c1_12540_13049 151
270 3300050507 nmdc:mga05p37_45354_c1 nmdc:mga05p37_45354_c1_3551_4009 151
271 3300050508 nmdc:mga09592_21168_c1 nmdc:mga09592_21168_c1_841_1299 151
272 3300050508 nmdc:mga09592_24555_c1 nmdc:mga09592_24555_c1_1992_2450 151
273 3300050509 nmdc:mga0qj67_167661_c1 nmdc:mga0qj67_167661_c1_1284_1742 151
274 3300050510 nmdc:mga06r32_1156065_c1 nmdc:mga06r32_1156065_c1_231_689 151
275 3300050510 nmdc:mga06r32_15796_c1 nmdc:mga06r32_15796_c1_2689_3147 151
276 3300050510 nmdc:mga06r32_58243_c1 nmdc:mga06r32_58243_c1_720_1178 151
277 3300050510 nmdc:mga06r32_662489_c1 nmdc:mga06r32_662489_c1_284_790 151
278 3300050512 nmdc:mga0n895_100764_c1 nmdc:mga0n895_100764_c1_646_1104 151
279 3300050513 nmdc:mga0rr50_40217_c1 nmdc:mga0rr50_40217_c1_2124_2615 151
280 3300050515 nmdc:mga0a205_369098_c1 nmdc:mga0a205_369098_c1_494_952 151
281 3300050515 nmdc:mga0a205_60199_c1 nmdc:mga0a205_60199_c1_1767_2276 151
282 3300054114 Ga0501084_0115472 Ga0501084_0115472_1624_2088 151
283 3300061734 Ga0530510_0170012 Ga0530510_0170012_347_811 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

12

140

0.97

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

2

139

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9891 5 146
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9871 4 146
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9813 4 146
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9801 4 146
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9745 4 146
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9868 4 146 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9796 4 146 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8641 4 143 3.30.530.20
3eliA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8579 6 142 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.849 4 142 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7V9MUU5-F1-model_v4 SRPBCC family protein 0.9942 6 149
AF-A0A7Y2S1H6-F1-model_v4 deleted 0.9926 4 149
AF-A0A419EKS9-F1-model_v4 Polyketide cyclase 0.9922 6 149
AF-A0A0Q6VIA6-F1-model_v4 Toxin 0.9919 4 148
AF-A0A7U2MC15-F1-model_v4 ATPase 0.9916 6 148

Feature Viewer

pLDDT pTM Quality
94.46 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map