F385578

General Info

Members Datasets Scaffolds Average Seq Length
283 185 566 195

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10356225|Ga0157375_103562252
Length 213
Sequence MRAGSIGRHDAAEFAPRGSDMSNLLVMESLSLDGVMQAPGRADEDTRGGFAHGGWALPYNDQVMGQAMGAGMASVGPLLFGRRTYEDFYSVWPKRKESPFSAVLDNADKYVASTTLAESLPWQNSTLLKGDASETVARLKKQAGKDILVMGSGELVRTLMRYNLVDIYKLLIHPLVLGSGRRLFPDDGSLAALKLVDSVTTTTGVMIATYRVA

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
142 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
143 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
144 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
145 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
146 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
147 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
148 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
149 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
152 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
182 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
183 2808606372 Agromyces sp. 23-23 Isolate Unclassified
184 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
185 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 0
Isolates 1.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.53
Nodule 0
Rhizoplane 3.53
Rhizosphere 90.81
Stem 0
Stem Tuber 0
Unclassified 9.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10356225 3300013308 Bacteria 1629
2 rootH1_10303437 3300003323 Unclassified 2373
3 JGI25407J50210_10000561 3300003373 Bacteria 7471
4 JGI25407J50210_10001727 3300003373 Bacteria 5011
5 JGI25407J50210_10091301 3300003373 Unclassified 753
6 Ga0065704_10236431 3300005289 Bacteria 1028
7 Ga0065712_10164288 3300005290 Bacteria 1282
8 Ga0065707_10123981 3300005295 Bacteria 2054
9 Ga0065707_10158986 3300005295 Bacteria 1581
10 Ga0070658_10004053 3300005327 Bacteria 12009
11 Ga0070658_10038643 3300005327 Unclassified 3848
12 Ga0070683_100185406 3300005329 Bacteria 1975
13 Ga0070690_100175594 3300005330 Bacteria 1477
14 Ga0070670_100062166 3300005331 Bacteria 3206
15 Ga0070666_10117345 3300005335 Bacteria 1843
16 Ga0070680_100036319 3300005336 Bacteria 3980
17 Ga0068868_100153114 3300005338 Bacteria 1900
18 Ga0068868_100244633 3300005338 Bacteria 1508
19 Ga0068868_100516897 3300005338 Bacteria 1048
20 Ga0070660_100024655 3300005339 Bacteria 4463
21 Ga0070661_100055186 3300005344 Bacteria 2909
22 Ga0070668_100002674 3300005347 Bacteria 13102
23 Ga0070669_100032491 3300005353 Bacteria 3769
24 Ga0070671_100044854 3300005355 Bacteria 3674
25 Ga0070671_100057443 3300005355 Bacteria 3238
26 Ga0070671_100130248 3300005355 Bacteria 2119
27 Ga0070671_100313757 3300005355 Bacteria 1336
28 Ga0070674_100170617 3300005356 Bacteria 1658
29 Ga0070674_100207293 3300005356 Bacteria 1517
30 Ga0070659_100012230 3300005366 Bacteria 6362
31 Ga0070667_100224053 3300005367 Bacteria 1674
32 Ga0070667_100970794 3300005367 Bacteria 792
33 Ga0070714_100016168 3300005435 Bacteria 6019
34 Ga0070714_100091197 3300005435 Bacteria 2670
35 Ga0070714_100102618 3300005435 Bacteria 2522
36 Ga0070713_100005043 3300005436 Bacteria 8979
37 Ga0070705_100327239 3300005440 Bacteria 1109
38 Ga0070681_10205746 3300005458 Bacteria 1885
39 Ga0070681_10530280 3300005458 Bacteria 1091
40 Ga0070685_10472007 3300005466 Bacteria 883
41 Ga0070706_100222001 3300005467 Bacteria 1764
42 Ga0070707_100019581 3300005468 Bacteria 6378
43 Ga0070707_100376167 3300005468 Bacteria 1380
44 Ga0070698_100033623 3300005471 Bacteria 5312
45 Ga0070698_100103327 3300005471 Bacteria 2820
46 Ga0070698_100218968 3300005471 Bacteria 1837
47 Ga0070698_100402108 3300005471 Bacteria 1303
48 Ga0070698_100812947 3300005471 Bacteria 879
49 Ga0070699_100002321 3300005518 Bacteria 17083
50 Ga0070699_100007136 3300005518 Bacteria 9709
51 Ga0070699_100007571 3300005518 Bacteria 9441
52 Ga0070699_100587988 3300005518 Bacteria 1015
53 Ga0070679_100199714 3300005530 Bacteria 1966
54 Ga0070679_100371939 3300005530 Bacteria 1376
55 Ga0070684_100302151 3300005535 Bacteria 1469
56 Ga0070697_100029156 3300005536 Bacteria 4423
57 Ga0070697_100334378 3300005536 Bacteria 1306
58 Ga0068853_100018945 3300005539 Bacteria 5700
59 Ga0070672_100033738 3300005543 Bacteria 3879
60 Ga0070686_100765072 3300005544 Unclassified 776
61 Ga0070665_100254984 3300005548 Bacteria 1755
62 Ga0070665_100603038 3300005548 Bacteria 1111
63 Ga0068855_100076048 3300005563 Bacteria 3897
64 Ga0068857_100217635 3300005577 Bacteria 1744
65 Ga0068857_100534678 3300005577 Bacteria 1103
66 Ga0068856_100032838 3300005614 Bacteria 5082
67 Ga0068852_100008648 3300005616 Bacteria 7522
68 Ga0068859_100013395 3300005617 Bacteria 8224
69 Ga0068864_100051511 3300005618 Bacteria 3547
70 Ga0068864_100227314 3300005618 Bacteria 1724
71 Ga0068863_100025582 3300005841 Bacteria 5628
72 Ga0068863_100055964 3300005841 Bacteria 3734
73 Ga0068863_100058124 3300005841 Bacteria 3660
74 Ga0068863_100302724 3300005841 Bacteria 1551
75 Ga0068858_100000023 3300005842 Bacteria 167824
76 Ga0068858_100118931 3300005842 Bacteria 2470
77 Ga0068858_100360747 3300005842 Bacteria 1393
78 Ga0068860_100003558 3300005843 Bacteria 16020
79 Ga0068860_100557009 3300005843 Bacteria 1149
80 Ga0068860_101151012 3300005843 Unclassified 796
81 Ga0068862_101349223 3300005844 Bacteria 715
82 Ga0068862_101571069 3300005844 Bacteria 664
83 Ga0081455_10005528 3300005937 Bacteria 13843
84 Ga0081455_10062310 3300005937 Bacteria 3135
85 Ga0081455_10244886 3300005937 Bacteria 1315
86 Ga0081538_10000169 3300005981 Bacteria 69684
87 Ga0081538_10000570 3300005981 Bacteria 40862
88 Ga0081538_10004615 3300005981 Bacteria 12649
89 Ga0081538_10005153 3300005981 Bacteria 11844
90 Ga0081538_10016002 3300005981 Bacteria 5773
91 Ga0075368_10098944 3300006042 Bacteria 1196
92 Ga0075368_10126626 3300006042 Unclassified 1060
93 Ga0075363_100078935 3300006048 Bacteria 1798
94 Ga0075364_10435762 3300006051 Unclassified 895
95 Ga0070712_100661882 3300006175 Bacteria 888
96 Ga0075367_10067210 3300006178 Bacteria 2149
97 Ga0075367_10612440 3300006178 Unclassified 692
98 Ga0068871_100142503 3300006358 Bacteria 2039
99 Ga0075428_100462749 3300006844 Bacteria 1358
100 Ga0075433_10078742 3300006852 Bacteria 2904
101 Ga0068865_100248934 3300006881 Unclassified 1402
102 Ga0097620_100013395 3300006931 Bacteria 8224
103 Ga0105240_10006683 3300009093 Bacteria 16911
104 Ga0105240_10110731 3300009093 Bacteria 3323
105 Ga0105245_10038146 3300009098 Bacteria 4274
106 Ga0105245_10043337 3300009098 Bacteria 4013
107 Ga0114129_10073795 3300009147 Bacteria 4753
108 Ga0114129_10569255 3300009147 Bacteria 1471
109 Ga0105241_10020083 3300009174 Bacteria 4935
110 Ga0105241_10098414 3300009174 Bacteria 2321
111 Ga0105248_10000492 3300009177 Bacteria 44904
112 Ga0105248_10555567 3300009177 Bacteria 1295
113 Ga0105248_10700434 3300009177 Bacteria 1143
114 Ga0105237_10013801 3300009545 Bacteria 8455
115 Ga0105237_10052662 3300009545 Bacteria 4084
116 Ga0105237_10244386 3300009545 Bacteria 1796
117 Ga0105237_10474434 3300009545 Bacteria 1257
118 Ga0105238_10000043 3300009551 Bacteria 154120
119 Ga0105238_10010998 3300009551 Bacteria 9101
120 Ga0105238_10154729 3300009551 Bacteria 2268
121 Ga0105238_10173272 3300009551 Bacteria 2134
122 Ga0105249_10234878 3300009553 Bacteria 1810
123 Ga0105239_10049355 3300010375 Bacteria 4615
124 Ga0105246_10034556 3300011119 Bacteria 3371
125 Ga0157373_10040766 3300013100 Bacteria 3322
126 Ga0157370_10004113 3300013104 Bacteria 16859
127 Ga0157370_10057477 3300013104 Bacteria 3699
128 Ga0157370_10205286 3300013104 Bacteria 1827
129 Ga0157369_10065937 3300013105 Bacteria 3896
130 Ga0157374_11229617 3300013296 Unclassified 770
131 Ga0157372_10573846 3300013307 Bacteria 1315
132 Ga0157375_10381784 3300013308 Bacteria 1575
133 Ga0163163_10026835 3300014325 Bacteria 5510
134 Ga0182008_10364838 3300014497 Bacteria 769
135 Ga0157379_10006501 3300014968 Bacteria 10074
136 Ga0157376_10722322 3300014969 Unclassified 1003
137 Ga0157376_11128132 3300014969 Unclassified 811
138 Ga0209148_1001025 3300025254 Bacteria 17563
139 Ga0207688_10426955 3300025901 Bacteria 824
140 Ga0207680_10022627 3300025903 Bacteria 3422
141 Ga0207705_10011905 3300025909 Bacteria 6285
142 Ga0207705_10037868 3300025909 Bacteria 3451
143 Ga0207684_10553875 3300025910 Bacteria 984
144 Ga0207654_10000001 3300025911 Bacteria 1816198
145 Ga0207654_10057619 3300025911 Bacteria 2259
146 Ga0207695_10003163 3300025913 Bacteria 23477
147 Ga0207695_10583911 3300025913 Bacteria 999
148 Ga0207671_10006151 3300025914 Bacteria 10787
149 Ga0207671_10159448 3300025914 Bacteria 1746
150 Ga0207671_10389296 3300025914 Bacteria 1108
151 Ga0207660_10009676 3300025917 Bacteria 6239
152 Ga0207657_10000610 3300025919 Bacteria 37898
153 Ga0207657_10024098 3300025919 Bacteria 5650
154 Ga0207657_10669913 3300025919 Bacteria 807
155 Ga0207652_10583636 3300025921 Bacteria 1003
156 Ga0207646_10014834 3300025922 Bacteria 7381
157 Ga0207681_10490590 3300025923 Bacteria 1004
158 Ga0207694_10000013 3300025924 Bacteria 384823
159 Ga0207694_10138641 3300025924 Bacteria 1955
160 Ga0207694_10355803 3300025924 Bacteria 1213
161 Ga0207694_10513088 3300025924 Bacteria 1004
162 Ga0207650_10064770 3300025925 Bacteria 2737
163 Ga0207687_10014314 3300025927 Bacteria 5190
164 Ga0207687_10040019 3300025927 Bacteria 3211
165 Ga0207664_10014989 3300025929 Bacteria 5614
166 Ga0207664_10099518 3300025929 Bacteria 2400
167 Ga0207664_11239835 3300025929 Bacteria 664
168 Ga0207644_10032329 3300025931 Bacteria 3650
169 Ga0207644_10091390 3300025931 Bacteria 2270
170 Ga0207644_10100996 3300025931 Bacteria 2167
171 Ga0207644_10275897 3300025931 Bacteria 1349
172 Ga0207690_10005966 3300025932 Bacteria 7214
173 Ga0207706_10089538 3300025933 Bacteria 2705
174 Ga0207709_10347043 3300025935 Bacteria 1119
175 Ga0207669_10036140 3300025937 Bacteria 2820
176 Ga0207691_10039769 3300025940 Bacteria 4349
177 Ga0207711_10001560 3300025941 Bacteria 21176
178 Ga0207711_10092122 3300025941 Bacteria 2667
179 Ga0207661_10098496 3300025944 Bacteria 2450
180 Ga0207679_10152156 3300025945 Bacteria 1885
181 Ga0207667_10030835 3300025949 Bacteria 5795
182 Ga0207667_10130043 3300025949 Unclassified 2593
183 Ga0207667_11014400 3300025949 Unclassified 817
184 Ga0207712_10148021 3300025961 Bacteria 1810
185 Ga0207668_10010295 3300025972 Bacteria 5647
186 Ga0207658_10013815 3300025986 Bacteria 5524
187 Ga0207677_10152237 3300026023 Bacteria 1786
188 Ga0207703_10000570 3300026035 Bacteria 37836
189 Ga0207703_10149647 3300026035 Bacteria 2034
190 Ga0207703_10292465 3300026035 Bacteria 1483
191 Ga0207639_10005675 3300026041 Bacteria 8444
192 Ga0207639_10287411 3300026041 Bacteria 1448
193 Ga0207639_10642070 3300026041 Bacteria 981
194 Ga0207708_10421854 3300026075 Bacteria 1106
195 Ga0207702_10018141 3300026078 Bacteria 5822
196 Ga0207702_10324394 3300026078 Bacteria 1467
197 Ga0207641_10044770 3300026088 Bacteria 3722
198 Ga0207641_10089719 3300026088 Bacteria 2687
199 Ga0207648_10602604 3300026089 Bacteria 1012
200 Ga0207676_10019738 3300026095 Bacteria 4923
201 Ga0207676_10058388 3300026095 Bacteria 3043
202 Ga0207674_10190728 3300026116 Bacteria 1999
203 Ga0207675_100122354 3300026118 Bacteria 2463
204 Ga0207683_10328990 3300026121 Unclassified 1400
205 Ga0207698_10003582 3300026142 Bacteria 9373
206 Ga0207698_10836416 3300026142 Unclassified 925
207 Ga0268266_10279882 3300028379 Bacteria 1551
208 Ga0268265_10030974 3300028380 Bacteria 3859
209 Ga0265318_10111857 3300028577 Bacteria 1004
210 Ga0265320_10011246 3300031240 Bacteria 5278
211 Ga0307408_100312921 3300031548 Bacteria 1320
212 Ga0307408_100491215 3300031548 Unclassified 1073
213 Ga0265314_10063360 3300031711 Bacteria 2508
214 Ga0307405_10048313 3300031731 Bacteria 2623
215 Ga0307413_10478559 3300031824 Bacteria 995
216 Ga0326468_10035082 3300031889 Bacteria 687
217 Ga0307406_10152352 3300031901 Bacteria 1651
218 Ga0307407_10184134 3300031903 Bacteria 1386
219 Ga0307409_100191793 3300031995 Bacteria 1819
220 Ga0307409_100374701 3300031995 Bacteria 1351
221 Ga0307409_100460328 3300031995 Bacteria 1230
222 Ga0307409_100685961 3300031995 Bacteria 1022
223 Ga0307416_100065431 3300032002 Bacteria 2987
224 Ga0307416_100255374 3300032002 Bacteria 1709
225 Ga0307416_100352053 3300032002 Bacteria 1491
226 Ga0307415_100056482 3300032126 Bacteria 2691
227 Ga0373943_0230092 3300035170 Bacteria 1035
228 Ga0395900_0141571 3300037418 Bacteria 2463
229 Ga0395900_0724055 3300037418 Bacteria 927
230 Ga0436364_0802103 3300037853 Bacteria 2253
231 Ga0436364_1201627 3300037853 Bacteria 2200
232 Ga0395901_0626124 3300038443 Bacteria 1082
233 Ga0395901_0985375 3300038443 Bacteria 820
234 Ga0451791_1819175 3300041451 Unclassified 616
235 Ga0451807_1539504 3300041486 Bacteria 853
236 Ga0451837_1856388 3300041494 Bacteria 1062
237 Ga0439448_0000439 3300042005 Bacteria 9561
238 Ga0439454_000293 3300042011 Bacteria 3698
239 Ga0439455_0031565 3300042012 Bacteria 1319
240 Ga0439463_001394 3300042016 Bacteria 6425
241 Ga0450914_004766 3300042118 Bacteria 1119
242 Ga0450900_002519 3300042136 Bacteria 1951
243 Ga0450902_001590 3300042137 Bacteria 3117
244 Ga0439444_0000868 3300042437 Bacteria 3672
245 Ga0439464_0000097 3300042439 Bacteria 12959
246 Ga0439460_0000221 3300042461 Bacteria 11405
247 Ga0439440_0000634 3300042993 Bacteria 5978
248 Ga0466972_0392734 3300044658 Unclassified 650
249 Ga0466963_0152129 3300044694 Bacteria 1607
250 Ga0466967_0260773 3300045976 Bacteria 1658
251 Ga0495603_0186193 3300046455 Bacteria 1201
252 Ga0495638_0027068 3300046460 Bacteria 3713
253 Ga0495653_0387424 3300046463 Unclassified 891
254 Ga0495594_0225536 3300046499 Bacteria 1068
255 Ga0495656_0018800 3300046615 Bacteria 2660
256 Ga0495635_0113700 3300046663 Unclassified 1848
257 Ga0495657_0288407 3300046675 Unclassified 981
258 Ga0496104_0494737 3300048907 Bacteria 1134
259 Ga0496104_0528405 3300048907 Bacteria 1091
260 Ga0496105_0022194 3300048908 Bacteria 5141
261 Ga0496105_0668274 3300048908 Unclassified 800
262 Ga0496106_0033993 3300048909 Bacteria 3807
263 Ga0496112_1015327 3300048915 Unclassified 749
264 Ga0496113_0001890 3300048916 Bacteria 11946
265 Ga0496114_0226785 3300048917 Bacteria 1641
266 Ga0496120_0021441 3300048923 Bacteria 4084
267 Ga0501033_0010990 3300049570 Bacteria 6936
268 Ga0501047_0161957 3300049581 Bacteria 2109
269 Ga0501067_0071466 3300049583 Unclassified 1922
270 Ga0501069_0026964 3300049585 Bacteria 3148
271 Ga0501044_0001520 3300049823 Bacteria 27213
272 nmdc:mga00v17_212674_c1 3300050491 Bacteria 1251
273 nmdc:mga06z11_133033_c1 3300050494 Bacteria 1398
274 nmdc:mga05p37_1076142_c1 3300050507 Unclassified 845
275 nmdc:mga05p37_420766_c1 3300050507 Bacteria 1555
276 nmdc:mga09592_1022428_c1 3300050508 Bacteria 690
277 nmdc:mga08y16_459555_c1 3300050511 Bacteria 1297
278 nmdc:mga0a205_249442_c1 3300050515 Bacteria 1655
279 Ga0500620_000430 3300053155 Bacteria 7619
280 2676485614 2675903059 Bacteria 8644972
281 2808903520 2808606372 Bacteria 4649509
282 2816423761 2816332119 Bacteria 8120218
283 2919719763 2919713450 Bacteria 7431245
284 Ga0157375_10356225
285 rootH1_10303437
286 JGI25407J50210_10000561
287 JGI25407J50210_10001727
288 JGI25407J50210_10091301
289 Ga0065704_10236431
290 Ga0065712_10164288
291 Ga0065707_10123981
292 Ga0065707_10158986
293 Ga0070658_10004053
294 Ga0070658_10038643
295 Ga0070683_100185406
296 Ga0070690_100175594
297 Ga0070670_100062166
298 Ga0070666_10117345
299 Ga0070680_100036319
300 Ga0068868_100153114
301 Ga0068868_100244633
302 Ga0068868_100516897
303 Ga0070660_100024655
304 Ga0070661_100055186
305 Ga0070668_100002674
306 Ga0070669_100032491
307 Ga0070671_100044854
308 Ga0070671_100057443
309 Ga0070671_100130248
310 Ga0070671_100313757
311 Ga0070674_100170617
312 Ga0070674_100207293
313 Ga0070659_100012230
314 Ga0070667_100224053
315 Ga0070667_100970794
316 Ga0070714_100016168
317 Ga0070714_100091197
318 Ga0070714_100102618
319 Ga0070713_100005043
320 Ga0070705_100327239
321 Ga0070681_10205746
322 Ga0070681_10530280
323 Ga0070685_10472007
324 Ga0070706_100222001
325 Ga0070707_100019581
326 Ga0070707_100376167
327 Ga0070698_100033623
328 Ga0070698_100103327
329 Ga0070698_100218968
330 Ga0070698_100402108
331 Ga0070698_100812947
332 Ga0070699_100002321
333 Ga0070699_100007136
334 Ga0070699_100007571
335 Ga0070699_100587988
336 Ga0070679_100199714
337 Ga0070679_100371939
338 Ga0070684_100302151
339 Ga0070697_100029156
340 Ga0070697_100334378
341 Ga0068853_100018945
342 Ga0070672_100033738
343 Ga0070686_100765072
344 Ga0070665_100254984
345 Ga0070665_100603038
346 Ga0068855_100076048
347 Ga0068857_100217635
348 Ga0068857_100534678
349 Ga0068856_100032838
350 Ga0068852_100008648
351 Ga0068859_100013395
352 Ga0068864_100051511
353 Ga0068864_100227314
354 Ga0068863_100025582
355 Ga0068863_100055964
356 Ga0068863_100058124
357 Ga0068863_100302724
358 Ga0068858_100000023
359 Ga0068858_100118931
360 Ga0068858_100360747
361 Ga0068860_100003558
362 Ga0068860_100557009
363 Ga0068860_101151012
364 Ga0068862_101349223
365 Ga0068862_101571069
366 Ga0081455_10005528
367 Ga0081455_10062310
368 Ga0081455_10244886
369 Ga0081538_10000169
370 Ga0081538_10000570
371 Ga0081538_10004615
372 Ga0081538_10005153
373 Ga0081538_10016002
374 Ga0075368_10098944
375 Ga0075368_10126626
376 Ga0075363_100078935
377 Ga0075364_10435762
378 Ga0070712_100661882
379 Ga0075367_10067210
380 Ga0075367_10612440
381 Ga0068871_100142503
382 Ga0075428_100462749
383 Ga0075433_10078742
384 Ga0068865_100248934
385 Ga0097620_100013395
386 Ga0105240_10006683
387 Ga0105240_10110731
388 Ga0105245_10038146
389 Ga0105245_10043337
390 Ga0114129_10073795
391 Ga0114129_10569255
392 Ga0105241_10020083
393 Ga0105241_10098414
394 Ga0105248_10000492
395 Ga0105248_10555567
396 Ga0105248_10700434
397 Ga0105237_10013801
398 Ga0105237_10052662
399 Ga0105237_10244386
400 Ga0105237_10474434
401 Ga0105238_10000043
402 Ga0105238_10010998
403 Ga0105238_10154729
404 Ga0105238_10173272
405 Ga0105249_10234878
406 Ga0105239_10049355
407 Ga0105246_10034556
408 Ga0157373_10040766
409 Ga0157370_10004113
410 Ga0157370_10057477
411 Ga0157370_10205286
412 Ga0157369_10065937
413 Ga0157374_11229617
414 Ga0157372_10573846
415 Ga0157375_10381784
416 Ga0163163_10026835
417 Ga0182008_10364838
418 Ga0157379_10006501
419 Ga0157376_10722322
420 Ga0157376_11128132
421 Ga0209148_1001025
422 Ga0207688_10426955
423 Ga0207680_10022627
424 Ga0207705_10011905
425 Ga0207705_10037868
426 Ga0207684_10553875
427 Ga0207654_10000001
428 Ga0207654_10057619
429 Ga0207695_10003163
430 Ga0207695_10583911
431 Ga0207671_10006151
432 Ga0207671_10159448
433 Ga0207671_10389296
434 Ga0207660_10009676
435 Ga0207657_10000610
436 Ga0207657_10024098
437 Ga0207657_10669913
438 Ga0207652_10583636
439 Ga0207646_10014834
440 Ga0207681_10490590
441 Ga0207694_10000013
442 Ga0207694_10138641
443 Ga0207694_10355803
444 Ga0207694_10513088
445 Ga0207650_10064770
446 Ga0207687_10014314
447 Ga0207687_10040019
448 Ga0207664_10014989
449 Ga0207664_10099518
450 Ga0207664_11239835
451 Ga0207644_10032329
452 Ga0207644_10091390
453 Ga0207644_10100996
454 Ga0207644_10275897
455 Ga0207690_10005966
456 Ga0207706_10089538
457 Ga0207709_10347043
458 Ga0207669_10036140
459 Ga0207691_10039769
460 Ga0207711_10001560
461 Ga0207711_10092122
462 Ga0207661_10098496
463 Ga0207679_10152156
464 Ga0207667_10030835
465 Ga0207667_10130043
466 Ga0207667_11014400
467 Ga0207712_10148021
468 Ga0207668_10010295
469 Ga0207658_10013815
470 Ga0207677_10152237
471 Ga0207703_10000570
472 Ga0207703_10149647
473 Ga0207703_10292465
474 Ga0207639_10005675
475 Ga0207639_10287411
476 Ga0207639_10642070
477 Ga0207708_10421854
478 Ga0207702_10018141
479 Ga0207702_10324394
480 Ga0207641_10044770
481 Ga0207641_10089719
482 Ga0207648_10602604
483 Ga0207676_10019738
484 Ga0207676_10058388
485 Ga0207674_10190728
486 Ga0207675_100122354
487 Ga0207683_10328990
488 Ga0207698_10003582
489 Ga0207698_10836416
490 Ga0268266_10279882
491 Ga0268265_10030974
492 Ga0265318_10111857
493 Ga0265320_10011246
494 Ga0307408_100312921
495 Ga0307408_100491215
496 Ga0265314_10063360
497 Ga0307405_10048313
498 Ga0307413_10478559
499 Ga0326468_10035082
500 Ga0307406_10152352
501 Ga0307407_10184134
502 Ga0307409_100191793
503 Ga0307409_100374701
504 Ga0307409_100460328
505 Ga0307409_100685961
506 Ga0307416_100065431
507 Ga0307416_100255374
508 Ga0307416_100352053
509 Ga0307415_100056482
510 Ga0373943_0230092
511 Ga0395900_0141571
512 Ga0395900_0724055
513 Ga0436364_0802103
514 Ga0436364_1201627
515 Ga0395901_0626124
516 Ga0395901_0985375
517 Ga0451791_1819175
518 Ga0451807_1539504
519 Ga0451837_1856388
520 Ga0439448_0000439
521 Ga0439454_000293
522 Ga0439455_0031565
523 Ga0439463_001394
524 Ga0450914_004766
525 Ga0450900_002519
526 Ga0450902_001590
527 Ga0439444_0000868
528 Ga0439464_0000097
529 Ga0439460_0000221
530 Ga0439440_0000634
531 Ga0466972_0392734
532 Ga0466963_0152129
533 Ga0466967_0260773
534 Ga0495603_0186193
535 Ga0495638_0027068
536 Ga0495653_0387424
537 Ga0495594_0225536
538 Ga0495656_0018800
539 Ga0495635_0113700
540 Ga0495657_0288407
541 Ga0496104_0494737
542 Ga0496104_0528405
543 Ga0496105_0022194
544 Ga0496105_0668274
545 Ga0496106_0033993
546 Ga0496112_1015327
547 Ga0496113_0001890
548 Ga0496114_0226785
549 Ga0496120_0021441
550 Ga0501033_0010990
551 Ga0501047_0161957
552 Ga0501067_0071466
553 Ga0501069_0026964
554 Ga0501044_0001520
555 nmdc:mga00v17_212674_c1
556 nmdc:mga06z11_133033_c1
557 nmdc:mga05p37_1076142_c1
558 nmdc:mga05p37_420766_c1
559 nmdc:mga09592_1022428_c1
560 nmdc:mga08y16_459555_c1
561 nmdc:mga0a205_249442_c1
562 Ga0500620_000430
563 2676485614
564 2808903520
565 2816423761
566 2919719763

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

23

207

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7914 2 186
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7881 1 186
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7839 1 186
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7792 2 186
7myl-assembly2.cif.gz_C crystal structure of dfra1 dihydrofolate reductase in complex with trimethoprim 0.7767 1 185
ID Description Score Start End Superfamily
af_Q54JK7_720_839_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8136 164 186 3.30.70.240
af_A0A1X7YGG3_447_560_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8129 164 185 3.30.70.240
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7797 1 188 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7677 1 188 3.40.430.10
af_A0A0R0JU28_444_549_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7676 166 190 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A1S6RUW9-F1-model_v4 deleted 0.9133 47 187
AF-A0A3N5K9Y5-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9073 52 187 GO:0008703
GO:0009231
AF-A0A530GKI4-F1-model_v4 Dihydrofolate reductase 0.8996 48 183 GO:0008703
GO:0009231
AF-A0A536A8N9-F1-model_v4 Dihydrofolate reductase 0.8984 69 187 GO:0008703
GO:0009231
AF-A0A1S6RUW9-F1-model_v4 deleted 0.8953 47 187

Map