F385181

General Info

Members Datasets Scaffolds Average Seq Length
282 198 564 196

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_0736798|Ga0496113_0736798_65_751
Length 228
Sequence MAPAIREPSISSARVAFSVARAVALTDLSAISLPVTEQRDGLPVLAFRTAESFEEWLDRQPADAAGAWLKLPKKSASTPGLTKAEAIDAALCYGWIDGQLDKYDDEYWLVRFTPRKRRSRWSQVNKSRATELLAEGRMRKSGLAQIEAAKADGRWAAAYAPASSAKVPTDLQDALNANPRAATFFATLKGANRYAILYRIGSVKRPETRARKIAEYVAMLERGETIHG

Samples

Sample ID Description Type Environment
1 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
126 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
127 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
128 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
129 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
130 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
131 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
132 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
190 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
192 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
193 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
194 2643221583 Caulobacter sp. Root655 Isolate Unclassified
195 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
196 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
197 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
198 2857504554 Caulobacter sp. R-72291 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.52
Metatranscriptomes 0
Isolates 2.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 0.35
Rhizoplane 7.8
Rhizosphere 85.46
Stem 0
Stem Tuber 0
Unclassified 11.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496113_0736798 3300048916 Bacteria 785
2 JGI24741J21665_1000745 3300001915 Bacteria 9780
3 JGI24740J21852_10009358 3300001979 Bacteria 3842
4 Ga0055524_1007741 3300003775 Bacteria 4535
5 Ga0065165_1001007 3300005262 Bacteria 34394
6 Ga0070658_10030244 3300005327 Bacteria 4352
7 Ga0070670_100115956 3300005331 Bacteria 2310
8 Ga0070677_10029445 3300005333 Bacteria 2082
9 Ga0070666_10007778 3300005335 Bacteria 6620
10 Ga0070680_100065681 3300005336 Bacteria 2974
11 Ga0070680_100072524 3300005336 Bacteria 2830
12 Ga0070682_100015750 3300005337 Bacteria 4386
13 Ga0070661_100027466 3300005344 Bacteria 4098
14 Ga0070661_100129508 3300005344 Bacteria 1894
15 Ga0070692_10228580 3300005345 Unclassified 1103
16 Ga0070668_100094991 3300005347 Bacteria 2354
17 Ga0070669_100151233 3300005353 Bacteria 1797
18 Ga0070675_100051842 3300005354 Bacteria 3372
19 Ga0070671_100291938 3300005355 Bacteria 1388
20 Ga0070659_100034386 3300005366 Bacteria 3942
21 Ga0070659_100052228 3300005366 Bacteria 3214
22 Ga0070659_100140692 3300005366 Bacteria 1965
23 Ga0070667_100006201 3300005367 Bacteria 9946
24 Ga0070667_100227945 3300005367 Bacteria 1660
25 Ga0070713_101160380 3300005436 Unclassified 747
26 Ga0070701_10377802 3300005438 Unclassified 892
27 Ga0070663_100246495 3300005455 Bacteria 1412
28 Ga0070663_100572414 3300005455 Bacteria 947
29 Ga0070678_100035936 3300005456 Bacteria 3464
30 Ga0070662_100017103 3300005457 Bacteria 4881
31 Ga0070662_100117483 3300005457 Bacteria 2034
32 Ga0070681_10031603 3300005458 Bacteria 5314
33 Ga0070699_100355607 3300005518 Bacteria 1320
34 Ga0070679_100100115 3300005530 Bacteria 2885
35 Ga0068853_100048123 3300005539 Bacteria 3661
36 Ga0068853_100369098 3300005539 Unclassified 1338
37 Ga0070665_100261066 3300005548 Bacteria 1733
38 Ga0070665_101555550 3300005548 Bacteria 669
39 Ga0068855_100607158 3300005563 Bacteria 1179
40 Ga0070664_100012901 3300005564 Bacteria 6799
41 Ga0070664_100027208 3300005564 Bacteria 4751
42 Ga0070664_100113142 3300005564 Unclassified 2370
43 Ga0070664_100482803 3300005564 Bacteria 1140
44 Ga0068857_100033214 3300005577 Bacteria 4563
45 Ga0068857_100041760 3300005577 Bacteria 4067
46 Ga0068856_100273179 3300005614 Bacteria 1706
47 Ga0068852_100034682 3300005616 Bacteria 4201
48 Ga0068859_100000260 3300005617 Bacteria 52671
49 Ga0068864_100000152 3300005618 Bacteria 64211
50 Ga0068851_10010588 3300005834 Bacteria 4306
51 Ga0068863_100001305 3300005841 Bacteria 24885
52 Ga0068863_100114152 3300005841 Bacteria 2573
53 Ga0068858_100004976 3300005842 Bacteria 13017
54 Ga0068858_100008530 3300005842 Bacteria 9848
55 Ga0068860_100006264 3300005843 Bacteria 11945
56 Ga0070716_100390170 3300006173 Bacteria 998
57 Ga0068871_100075667 3300006358 Bacteria 2780
58 Ga0068871_100345664 3300006358 Bacteria 1314
59 Ga0097620_100000260 3300006931 Bacteria 52671
60 Ga0099794_10142679 3300007265 Bacteria 1213
61 Ga0099795_10002180 3300007788 Plasmid 4525
62 Ga0099795_10148032 3300007788 Bacteria 960
63 Ga0105250_10032887 3300009092 Bacteria 2082
64 Ga0105245_10432796 3300009098 Unclassified 1321
65 Ga0105242_10417177 3300009176 Bacteria 1257
66 Ga0105248_10000649 3300009177 Bacteria 39478
67 Ga0105248_10008090 3300009177 Bacteria 11542
68 Ga0105248_10195434 3300009177 Bacteria 2279
69 Ga0105248_10300175 3300009177 Bacteria 1808
70 Ga0105249_10042092 3300009553 Bacteria 4153
71 Ga0099796_10106885 3300010159 Bacteria 1060
72 Ga0157327_1008818 3300012512 Bacteria 913
73 Ga0157373_10021458 3300013100 Bacteria 4691
74 Ga0157373_10051438 3300013100 Unclassified 2934
75 Ga0157371_10022396 3300013102 Bacteria 4631
76 Ga0157371_10122373 3300013102 Bacteria 1850
77 Ga0157370_10072808 3300013104 Bacteria 3242
78 Ga0157369_10013841 3300013105 Bacteria 9117
79 Ga0157374_10802606 3300013296 Unclassified 957
80 Ga0163162_10089141 3300013306 Bacteria 3165
81 Ga0163162_10105965 3300013306 Bacteria 2906
82 Ga0163162_10607375 3300013306 Bacteria 1220
83 Ga0157372_10198075 3300013307 Bacteria 2326
84 Ga0157375_10020854 3300013308 Bacteria 5997
85 Ga0157375_10319184 3300013308 Bacteria 1718
86 Ga0163163_10000823 3300014325 Bacteria 26428
87 Ga0163163_10094476 3300014325 Bacteria 3008
88 Ga0182008_10287652 3300014497 Unclassified 857
89 Ga0157379_10001722 3300014968 Bacteria 18112
90 Ga0157379_10526625 3300014968 Unclassified 1098
91 Ga0157376_10184372 3300014969 Bacteria 1910
92 Ga0182007_10197016 3300015262 Unclassified 703
93 Ga0213871_10011352 3300021441 Bacteria 2044
94 Ga0209564_1020739 3300025295 Bacteria 2395
95 Ga0209256_1008779 3300025299 Bacteria 4596
96 Ga0207680_10243879 3300025903 Bacteria 1239
97 Ga0207680_10355383 3300025903 Bacteria 1030
98 Ga0207699_10457585 3300025906 Bacteria 916
99 Ga0207705_10018717 3300025909 Bacteria 4955
100 Ga0207705_10027097 3300025909 Bacteria 4085
101 Ga0207707_10016129 3300025912 Bacteria 6515
102 Ga0207663_10221740 3300025916 Bacteria 1376
103 Ga0207660_10009931 3300025917 Bacteria 6166
104 Ga0207660_10072170 3300025917 Bacteria 2514
105 Ga0207657_10047679 3300025919 Bacteria 3744
106 Ga0207657_10053819 3300025919 Bacteria 3484
107 Ga0207649_10014577 3300025920 Bacteria 4403
108 Ga0207649_10052566 3300025920 Bacteria 2528
109 Ga0207649_10089986 3300025920 Bacteria 2007
110 Ga0207652_10004287 3300025921 Bacteria 11634
111 Ga0207652_10166458 3300025921 Bacteria 1977
112 Ga0207681_10063385 3300025923 Bacteria 2549
113 Ga0207650_10460370 3300025925 Bacteria 1059
114 Ga0207659_10251605 3300025926 Bacteria 1434
115 Ga0207687_10332263 3300025927 Unclassified 1233
116 Ga0207644_10043031 3300025931 Bacteria 3203
117 Ga0207690_10007679 3300025932 Bacteria 6399
118 Ga0207690_10016066 3300025932 Bacteria 4551
119 Ga0207690_10050583 3300025932 Bacteria 2775
120 Ga0207690_10211633 3300025932 Unclassified 1478
121 Ga0207706_10036174 3300025933 Bacteria 4387
122 Ga0207706_10083135 3300025933 Bacteria 2814
123 Ga0207686_10272978 3300025934 Bacteria 1245
124 Ga0207665_10224024 3300025939 Bacteria 1379
125 Ga0207691_10004225 3300025940 Bacteria 13949
126 Ga0207711_10000051 3300025941 Bacteria 140854
127 Ga0207711_10033297 3300025941 Bacteria 4359
128 Ga0207711_11158817 3300025941 Bacteria 714
129 Ga0207661_10359935 3300025944 Unclassified 1314
130 Ga0207661_10416033 3300025944 Unclassified 1221
131 Ga0207679_10021502 3300025945 Bacteria 4375
132 Ga0207679_10081388 3300025945 Unclassified 2476
133 Ga0207667_10078551 3300025949 Bacteria 3420
134 Ga0207651_10002807 3300025960 Bacteria 8374
135 Ga0207712_10016848 3300025961 Bacteria 4738
136 Ga0207668_10010803 3300025972 Bacteria 5530
137 Ga0207658_10000823 3300025986 Bacteria 25936
138 Ga0207658_10201810 3300025986 Bacteria 1661
139 Ga0207703_10004004 3300026035 Bacteria 12199
140 Ga0207703_10021078 3300026035 Bacteria 5099
141 Ga0207639_10016352 3300026041 Bacteria 5247
142 Ga0207678_10075089 3300026067 Bacteria 2896
143 Ga0207702_10008463 3300026078 Bacteria 8676
144 Ga0207641_10000847 3300026088 Bacteria 32515
145 Ga0207676_10009207 3300026095 Bacteria 7026
146 Ga0207674_10023151 3300026116 Bacteria 6659
147 Ga0207674_10096635 3300026116 Bacteria 2939
148 Ga0207683_10072010 3300026121 Bacteria 3056
149 Ga0207683_10271903 3300026121 Bacteria 1548
150 Ga0209588_1042840 3300027671 Bacteria 1462
151 Ga0268266_10268514 3300028379 Bacteria 1583
152 Ga0268266_11375592 3300028379 Bacteria 681
153 Ga0268264_10023759 3300028381 Bacteria 4999
154 Ga0307515_10025824 3300028794 Bacteria 10141
155 Ga0265332_10042068 3300031238 Bacteria 1976
156 Ga0307513_10269209 3300031456 Bacteria 1488
157 Ga0307513_10402947 3300031456 Bacteria 1102
158 Ga0307408_100191734 3300031548 Bacteria 1647
159 Ga0307413_10098646 3300031824 Bacteria 1924
160 Ga0307409_100462338 3300031995 Bacteria 1227
161 Ga0307416_100791939 3300032002 Bacteria 1043
162 Ga0373954_0086273 3300035118 Unclassified 1504
163 Ga0373927_0232607 3300035695 Bacteria 1211
164 Ga0373947_0274150 3300035725 Bacteria 1120
165 Ga0373937_0061469 3300036401 Unclassified 3453
166 Ga0373925_0034824 3300037068 Bacteria 3713
167 Ga0395899_0000505 3300037312 Bacteria 43367
168 Ga0395899_0081071 3300037312 Bacteria 2361
169 Ga0395900_0111407 3300037418 Bacteria 2811
170 Ga0395900_0382539 3300037418 Unclassified 1375
171 Ga0395900_0912453 3300037418 Bacteria 801
172 Ga0395898_0036770 3300037466 Bacteria 4860
173 Ga0395905_0000409 3300037471 Bacteria 60283
174 Ga0395905_0028242 3300037471 Bacteria 5288
175 Ga0395901_0299269 3300038443 Unclassified 1668
176 Ga0436360_0563129 3300039438 Bacteria 835
177 Ga0436360_1094577 3300039438 Bacteria 870
178 Ga0439466_0054455 3300041411 Bacteria 1303
179 Ga0439465_0003159 3300041413 Bacteria 5379
180 Ga0451789_0627727 3300041443 Bacteria 707
181 Ga0439432_015161 3300042006 Bacteria 2603
182 Ga0439449_0002402 3300042007 Bacteria 7326
183 Ga0439457_005864 3300042014 Bacteria 3046
184 Ga0439462_0006595 3300042015 Bacteria 2887
185 Ga0439446_0009133 3300042156 Bacteria 2647
186 Ga0439434_0038588 3300042435 Bacteria 1464
187 Ga0466969_0003665 3300044656 Bacteria 8176
188 Ga0466966_0007902 3300044684 Bacteria 7040
189 Ga0466966_0120547 3300044684 Bacteria 1611
190 Ga0466961_0164289 3300044693 Bacteria 1383
191 Ga0466961_0206556 3300044693 Bacteria 1213
192 Ga0466961_0352459 3300044693 Unclassified 896
193 Ga0466961_0384372 3300044693 Unclassified 852
194 Ga0466963_0007057 3300044694 Bacteria 6687
195 Ga0466963_0012245 3300044694 Bacteria 5245
196 Ga0466971_0004944 3300044719 Bacteria 5766
197 Ga0466971_0037018 3300044719 Bacteria 2188
198 Ga0466971_0115012 3300044719 Unclassified 1243
199 Ga0466971_0409030 3300044719 Bacteria 662
200 Ga0466970_0007982 3300044765 Bacteria 5316
201 Ga0466957_0029774 3300044842 Bacteria 3257
202 Ga0466957_0112964 3300044842 Bacteria 1724
203 Ga0466957_0124612 3300044842 Bacteria 1645
204 Ga0466957_0139949 3300044842 Bacteria 1558
205 Ga0466957_0826731 3300044842 Bacteria 659
206 Ga0466960_0022096 3300044901 Bacteria 2841
207 Ga0466959_0003179 3300045049 Bacteria 10664
208 Ga0466959_0183731 3300045049 Bacteria 1462
209 Ga0466959_0647349 3300045049 Unclassified 709
210 Ga0466958_0003649 3300045836 Bacteria 8031
211 Ga0466958_0103196 3300045836 Bacteria 1775
212 Ga0466958_0159639 3300045836 Bacteria 1424
213 Ga0466967_0208731 3300045976 Bacteria 1852
214 Ga0495627_000679 3300046453 Bacteria 26196
215 Ga0495603_0390463 3300046455 Unclassified 798
216 Ga0495629_0345217 3300046459 Bacteria 1016
217 Ga0495638_0000579 3300046460 Bacteria 41378
218 Ga0495639_0352092 3300046475 Bacteria 739
219 Ga0495662_0069968 3300046476 Bacteria 1700
220 Ga0495609_0278105 3300046538 Bacteria 685
221 Ga0495667_0163177 3300046559 Bacteria 1433
222 Ga0495647_0156796 3300046681 Bacteria 979
223 Ga0495658_0557932 3300046683 Bacteria 733
224 Ga0495589_0029499 3300046794 Bacteria 2765
225 Ga0495674_0205046 3300047319 Bacteria 1635
226 Ga0495680_0174910 3300047322 Unclassified 1553
227 Ga0495675_0324240 3300047444 Unclassified 911
228 Ga0495673_0000094 3300047469 Bacteria 183868
229 Ga0495681_0017622 3300047470 Bacteria 3958
230 Ga0495684_0237137 3300047471 Bacteria 1332
231 Ga0495686_0041638 3300047472 Bacteria 2923
232 Ga0496101_0033729 3300048904 Bacteria 3612
233 Ga0496101_0273431 3300048904 Unclassified 1319
234 Ga0496101_0445359 3300048904 Bacteria 1022
235 Ga0496104_0009744 3300048907 Bacteria 8564
236 Ga0496105_0022562 3300048908 Bacteria 5099
237 Ga0496105_0578688 3300048908 Bacteria 874
238 Ga0496108_0021883 3300048911 Bacteria 5256
239 Ga0496108_0657713 3300048911 Unclassified 911
240 Ga0496109_0133060 3300048912 Bacteria 2322
241 Ga0496110_0379212 3300048913 Bacteria 1289
242 Ga0496110_0506910 3300048913 Bacteria 1098
243 Ga0496111_0127175 3300048914 Bacteria 1884
244 Ga0496111_0203861 3300048914 Unclassified 1470
245 Ga0496112_0003355 3300048915 Bacteria 13213
246 Ga0496112_0422896 3300048915 Bacteria 1271
247 Ga0496113_0048479 3300048916 Bacteria 3160
248 Ga0496114_0021702 3300048917 Bacteria 5226
249 Ga0496114_0685307 3300048917 Unclassified 900
250 Ga0496115_0352899 3300048918 Bacteria 1199
251 Ga0496115_0869325 3300048918 Unclassified 697
252 Ga0496122_0197005 3300048925 Bacteria 1182
253 Ga0496124_0077097 3300048927 Bacteria 2750
254 Ga0496126_0004570 3300048929 Bacteria 16426
255 Ga0496126_0580899 3300048929 Bacteria 885
256 Ga0501033_0437280 3300049570 Bacteria 910
257 Ga0501034_0001512 3300049571 Bacteria 30545
258 Ga0501034_0252617 3300049571 Bacteria 1707
259 Ga0501037_0194329 3300049573 Bacteria 1436
260 Ga0501046_0087749 3300049580 Bacteria 2396
261 Ga0501047_0016794 3300049581 Bacteria 6994
262 Ga0501069_0020283 3300049585 Bacteria 3601
263 Ga0501070_0441362 3300049586 Bacteria 1050
264 Ga0501071_0941893 3300049587 Bacteria 667
265 Ga0501074_0082262 3300049590 Bacteria 2309
266 Ga0501080_0111308 3300049742 Bacteria 2538
267 Ga0501035_0177228 3300049822 Bacteria 1838
268 Ga0501035_0386061 3300049822 Bacteria 1167
269 Ga0501044_0011581 3300049823 Bacteria 9559
270 Ga0501044_0668673 3300049823 Bacteria 926
271 Ga0495619_0280443 3300053085 Bacteria 1155
272 Ga0500643_029717 3300053087 Bacteria 1679
273 Ga0500577_0030959 3300053142 Bacteria 1868
274 Ga0466962_0064589 3300061719 Unclassified 1747
275 Ga0466962_0154543 3300061719 Bacteria 1114
276 2509147901 2508501128 Bacteria 8613869
277 2643747918 2643221545 Bacteria 5083237
278 2643926159 2643221583 Bacteria 5218014
279 2644507978 2643221691 Bacteria 5093099
280 2809226613 2808606447 Bacteria 3572005
281 2852632830 2852632344 Bacteria 3463163
282 2857505514 2857504554 Bacteria 5369913
283 Ga0496113_0736798
284 JGI24741J21665_1000745
285 JGI24740J21852_10009358
286 Ga0055524_1007741
287 Ga0065165_1001007
288 Ga0070658_10030244
289 Ga0070670_100115956
290 Ga0070677_10029445
291 Ga0070666_10007778
292 Ga0070680_100065681
293 Ga0070680_100072524
294 Ga0070682_100015750
295 Ga0070661_100027466
296 Ga0070661_100129508
297 Ga0070692_10228580
298 Ga0070668_100094991
299 Ga0070669_100151233
300 Ga0070675_100051842
301 Ga0070671_100291938
302 Ga0070659_100034386
303 Ga0070659_100052228
304 Ga0070659_100140692
305 Ga0070667_100006201
306 Ga0070667_100227945
307 Ga0070713_101160380
308 Ga0070701_10377802
309 Ga0070663_100246495
310 Ga0070663_100572414
311 Ga0070678_100035936
312 Ga0070662_100017103
313 Ga0070662_100117483
314 Ga0070681_10031603
315 Ga0070699_100355607
316 Ga0070679_100100115
317 Ga0068853_100048123
318 Ga0068853_100369098
319 Ga0070665_100261066
320 Ga0070665_101555550
321 Ga0068855_100607158
322 Ga0070664_100012901
323 Ga0070664_100027208
324 Ga0070664_100113142
325 Ga0070664_100482803
326 Ga0068857_100033214
327 Ga0068857_100041760
328 Ga0068856_100273179
329 Ga0068852_100034682
330 Ga0068859_100000260
331 Ga0068864_100000152
332 Ga0068851_10010588
333 Ga0068863_100001305
334 Ga0068863_100114152
335 Ga0068858_100004976
336 Ga0068858_100008530
337 Ga0068860_100006264
338 Ga0070716_100390170
339 Ga0068871_100075667
340 Ga0068871_100345664
341 Ga0097620_100000260
342 Ga0099794_10142679
343 Ga0099795_10002180
344 Ga0099795_10148032
345 Ga0105250_10032887
346 Ga0105245_10432796
347 Ga0105242_10417177
348 Ga0105248_10000649
349 Ga0105248_10008090
350 Ga0105248_10195434
351 Ga0105248_10300175
352 Ga0105249_10042092
353 Ga0099796_10106885
354 Ga0157327_1008818
355 Ga0157373_10021458
356 Ga0157373_10051438
357 Ga0157371_10022396
358 Ga0157371_10122373
359 Ga0157370_10072808
360 Ga0157369_10013841
361 Ga0157374_10802606
362 Ga0163162_10089141
363 Ga0163162_10105965
364 Ga0163162_10607375
365 Ga0157372_10198075
366 Ga0157375_10020854
367 Ga0157375_10319184
368 Ga0163163_10000823
369 Ga0163163_10094476
370 Ga0182008_10287652
371 Ga0157379_10001722
372 Ga0157379_10526625
373 Ga0157376_10184372
374 Ga0182007_10197016
375 Ga0213871_10011352
376 Ga0209564_1020739
377 Ga0209256_1008779
378 Ga0207680_10243879
379 Ga0207680_10355383
380 Ga0207699_10457585
381 Ga0207705_10018717
382 Ga0207705_10027097
383 Ga0207707_10016129
384 Ga0207663_10221740
385 Ga0207660_10009931
386 Ga0207660_10072170
387 Ga0207657_10047679
388 Ga0207657_10053819
389 Ga0207649_10014577
390 Ga0207649_10052566
391 Ga0207649_10089986
392 Ga0207652_10004287
393 Ga0207652_10166458
394 Ga0207681_10063385
395 Ga0207650_10460370
396 Ga0207659_10251605
397 Ga0207687_10332263
398 Ga0207644_10043031
399 Ga0207690_10007679
400 Ga0207690_10016066
401 Ga0207690_10050583
402 Ga0207690_10211633
403 Ga0207706_10036174
404 Ga0207706_10083135
405 Ga0207686_10272978
406 Ga0207665_10224024
407 Ga0207691_10004225
408 Ga0207711_10000051
409 Ga0207711_10033297
410 Ga0207711_11158817
411 Ga0207661_10359935
412 Ga0207661_10416033
413 Ga0207679_10021502
414 Ga0207679_10081388
415 Ga0207667_10078551
416 Ga0207651_10002807
417 Ga0207712_10016848
418 Ga0207668_10010803
419 Ga0207658_10000823
420 Ga0207658_10201810
421 Ga0207703_10004004
422 Ga0207703_10021078
423 Ga0207639_10016352
424 Ga0207678_10075089
425 Ga0207702_10008463
426 Ga0207641_10000847
427 Ga0207676_10009207
428 Ga0207674_10023151
429 Ga0207674_10096635
430 Ga0207683_10072010
431 Ga0207683_10271903
432 Ga0209588_1042840
433 Ga0268266_10268514
434 Ga0268266_11375592
435 Ga0268264_10023759
436 Ga0307515_10025824
437 Ga0265332_10042068
438 Ga0307513_10269209
439 Ga0307513_10402947
440 Ga0307408_100191734
441 Ga0307413_10098646
442 Ga0307409_100462338
443 Ga0307416_100791939
444 Ga0373954_0086273
445 Ga0373927_0232607
446 Ga0373947_0274150
447 Ga0373937_0061469
448 Ga0373925_0034824
449 Ga0395899_0000505
450 Ga0395899_0081071
451 Ga0395900_0111407
452 Ga0395900_0382539
453 Ga0395900_0912453
454 Ga0395898_0036770
455 Ga0395905_0000409
456 Ga0395905_0028242
457 Ga0395901_0299269
458 Ga0436360_0563129
459 Ga0436360_1094577
460 Ga0439466_0054455
461 Ga0439465_0003159
462 Ga0451789_0627727
463 Ga0439432_015161
464 Ga0439449_0002402
465 Ga0439457_005864
466 Ga0439462_0006595
467 Ga0439446_0009133
468 Ga0439434_0038588
469 Ga0466969_0003665
470 Ga0466966_0007902
471 Ga0466966_0120547
472 Ga0466961_0164289
473 Ga0466961_0206556
474 Ga0466961_0352459
475 Ga0466961_0384372
476 Ga0466963_0007057
477 Ga0466963_0012245
478 Ga0466971_0004944
479 Ga0466971_0037018
480 Ga0466971_0115012
481 Ga0466971_0409030
482 Ga0466970_0007982
483 Ga0466957_0029774
484 Ga0466957_0112964
485 Ga0466957_0124612
486 Ga0466957_0139949
487 Ga0466957_0826731
488 Ga0466960_0022096
489 Ga0466959_0003179
490 Ga0466959_0183731
491 Ga0466959_0647349
492 Ga0466958_0003649
493 Ga0466958_0103196
494 Ga0466958_0159639
495 Ga0466967_0208731
496 Ga0495627_000679
497 Ga0495603_0390463
498 Ga0495629_0345217
499 Ga0495638_0000579
500 Ga0495639_0352092
501 Ga0495662_0069968
502 Ga0495609_0278105
503 Ga0495667_0163177
504 Ga0495647_0156796
505 Ga0495658_0557932
506 Ga0495589_0029499
507 Ga0495674_0205046
508 Ga0495680_0174910
509 Ga0495675_0324240
510 Ga0495673_0000094
511 Ga0495681_0017622
512 Ga0495684_0237137
513 Ga0495686_0041638
514 Ga0496101_0033729
515 Ga0496101_0273431
516 Ga0496101_0445359
517 Ga0496104_0009744
518 Ga0496105_0022562
519 Ga0496105_0578688
520 Ga0496108_0021883
521 Ga0496108_0657713
522 Ga0496109_0133060
523 Ga0496110_0379212
524 Ga0496110_0506910
525 Ga0496111_0127175
526 Ga0496111_0203861
527 Ga0496112_0003355
528 Ga0496112_0422896
529 Ga0496113_0048479
530 Ga0496114_0021702
531 Ga0496114_0685307
532 Ga0496115_0352899
533 Ga0496115_0869325
534 Ga0496122_0197005
535 Ga0496124_0077097
536 Ga0496126_0004570
537 Ga0496126_0580899
538 Ga0501033_0437280
539 Ga0501034_0001512
540 Ga0501034_0252617
541 Ga0501037_0194329
542 Ga0501046_0087749
543 Ga0501047_0016794
544 Ga0501069_0020283
545 Ga0501070_0441362
546 Ga0501071_0941893
547 Ga0501074_0082262
548 Ga0501080_0111308
549 Ga0501035_0177228
550 Ga0501035_0386061
551 Ga0501044_0011581
552 Ga0501044_0668673
553 Ga0495619_0280443
554 Ga0500643_029717
555 Ga0500577_0030959
556 Ga0466962_0064589
557 Ga0466962_0154543
558 2509147901
559 2643747918
560 2643926159
561 2644507978
562 2809226613
563 2852632830
564 2857505514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13376

OmdA

Bacteriocin-protection, YdeI or OmpD-Associated

164

223

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i9f-assembly1.cif.gz_B crystal structure of a putative type 11 methyltransferase from sulfolobus solfataricus 0.6982 10 85
4d7k-assembly3.cif.gz_E crystal structure of n,n-8-amino-8-demethyl-d-riboflavin dimethyltransferase (rosa) from streptomyces davawensis 0.6799 10 81
8bif-assembly2.cif.gz_C o-methyltransferase plu4892 in complex with sah 0.6742 19 81
3i58-assembly1.cif.gz_A crystal structure of an o-methyltransferase (ncsb1) from neocarzinostatin biosynthesis in complex with s-adenosyl-l-homocysteine (sah) and 2-hydroxy-7-methoxy-5-methyl naphthoic acid (na) 0.6718 29 81
8big-assembly4.cif.gz_G o-methyltransferase plu4895 in complex with sah 0.6711 8 81
ID Description Score Start End Superfamily
af_I1K6T6_92_324_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7063 16 81 3.40.50.150
3i9fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6921 19 85 3.40.50.150
af_P9WLG9_29_152_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6868 16 82 3.40.50.150
2lxrA00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.683 16 82 3.30.110.40
af_Q7ZVJ8_3_201_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6706 33 79 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A535GQA6-F1-model_v4 Bacteriocin-protection protein 0.9955 130 194
AF-A0A3D1Q5Y2-F1-model_v4 Bacteriocin-protection protein 0.9761 132 191
AF-A0A7W7PFG6-F1-model_v4 Uncharacterized protein YdeI (YjbR/CyaY-like superfamily) 0.9687 3 118
AF-A0A352S5L2-F1-model_v4 Bacteriocin-protection protein 0.9678 8 112
AF-A0A5S5DMY7-F1-model_v4 Bacteriocin resistance YdeI/OmpD-like protein 0.9621 30 119

Map