F385089

General Info

Members Datasets Scaffolds Average Seq Length
282 219 244 155

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0288414|Ga0436361_0288414_30_572
Length 180
Sequence MIMEFLASHYLVIKWLHILSATLMVGTGFGTAFYMFFVNRRGDVPAIAVVARLVVMADWLFTTPAVIFQPLSGWAMARVAGYPMTSTWILWSIALYALAGACWLPVVWLQLRMRDMATKAYARGEPLPKRYWRYERIWTVLGFPAFGGLMVVYWLMVSKPVWYQNYIIQLTIIPVCNSIC

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
3 2643221664 Massilia sp. Root418 Isolate Unclassified
4 2738541280 Massilia sp. GV090 Isolate Unclassified
5 2738541300 Massilia sp. GV016 Isolate Unclassified
6 2738543018 Massilia sp. GV045 Isolate Unclassified
7 2738543030 Massilia sp. GV097 Isolate Unclassified
8 2791355199
9 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
10 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
11 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
12 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
13 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
14 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
15 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
16 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
17 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
18 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
19 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
20 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
21 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
22 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
23 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
26 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
120 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
121 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
139 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
140 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
141 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
154 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
184 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
185 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
186 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
187 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
188 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
189 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
192 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
193 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
194 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
195 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
202 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
205 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
206 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
207 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
208 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
209 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
210 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
211 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
212 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
213 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
214 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
215 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
216 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
217 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
218 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
219 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.83
Metatranscriptomes 0
Isolates 13.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.26
Nodule 8.51
Rhizoplane 1.06
Rhizosphere 73.76
Stem 0
Stem Tuber 0
Unclassified 12.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10015763 3300001989 Bacteria 2745
2 JGI25156J39149_1002984 3300002705 Bacteria 5746
3 JGI25154J39366_1000925 3300002738 Bacteria 12344
4 rootL2_10007465 3300003322 Bacteria 30036
5 rootH1_10041479 3300003323 Bacteria 6061
6 Ga0055533_1001532 3300003756 Bacteria 6032
7 Ga0055543_1000763 3300004625 Bacteria 16094
8 Ga0065165_1000039 3300005262 Bacteria 208372
9 Ga0065714_10139935 3300005288 Bacteria 1166
10 Ga0068869_101246287 3300005334 Bacteria 655
11 Ga0068868_100725499 3300005338 Unclassified 891
12 Ga0070668_100006653 3300005347 Bacteria 8570
13 Ga0070669_100662556 3300005353 Bacteria 879
14 Ga0070675_100029435 3300005354 Bacteria 4429
15 Ga0070671_100837937 3300005355 Unclassified 802
16 Ga0070674_100109291 3300005356 Bacteria 2027
17 Ga0070673_100036012 3300005364 Bacteria 3757
18 Ga0070659_100389251 3300005366 Unclassified 1175
19 Ga0070659_101124196 3300005366 Bacteria 693
20 Ga0070667_100266748 3300005367 Unclassified 1534
21 Ga0070667_101037747 3300005367 Bacteria 765
22 Ga0070701_10099334 3300005438 Bacteria 1609
23 Ga0070700_100023099 3300005441 Bacteria 3636
24 Ga0070678_100293745 3300005456 Bacteria 1379
25 Ga0070662_100602573 3300005457 Bacteria 924
26 Ga0068867_100005936 3300005459 Bacteria 8662
27 Ga0068867_100304258 3300005459 Bacteria 1315
28 Ga0070685_10238460 3300005466 Unclassified 1199
29 Ga0068853_101100932 3300005539 Bacteria 766
30 Ga0070672_100000281 3300005543 Bacteria 28938
31 Ga0070672_101022347 3300005543 Bacteria 733
32 Ga0070665_100010013 3300005548 Bacteria 9589
33 Ga0070665_100252010 3300005548 Unclassified 1766
34 Ga0068855_100000094 3300005563 Bacteria 106906
35 Ga0070664_101127788 3300005564 Unclassified 739
36 Ga0068857_100334948 3300005577 Bacteria 1399
37 Ga0068857_100459500 3300005577 Bacteria 1191
38 Ga0068856_100884549 3300005614 Bacteria 912
39 Ga0068856_101332070 3300005614 Bacteria 733
40 Ga0068852_100864677 3300005616 Unclassified 920
41 Ga0068859_100483783 3300005617 Bacteria 1333
42 Ga0068864_100003129 3300005618 Bacteria 13671
43 Ga0068864_100053981 3300005618 Bacteria 3468
44 Ga0068861_100033192 3300005719 Plasmid 3806
45 Ga0068861_100076770 3300005719 Bacteria 2604
46 Ga0068861_100902147 3300005719 Bacteria 837
47 Ga0068870_10214278 3300005840 Unclassified 1175
48 Ga0068863_100001562 3300005841 Bacteria 22627
49 Ga0068863_100867924 3300005841 Unclassified 902
50 Ga0068858_100846831 3300005842 Bacteria 893
51 Ga0068860_100012883 3300005843 Bacteria 8220
52 Ga0068860_100409167 3300005843 Bacteria 1343
53 Ga0068862_100102089 3300005844 Bacteria 2510
54 Ga0068862_100146745 3300005844 Bacteria 2097
55 Ga0081455_10039881 3300005937 Bacteria 4145
56 Ga0075363_100198673 3300006048 Bacteria 1145
57 Ga0097621_100049747 3300006237 Bacteria 3407
58 Ga0075370_10086337 3300006353 Bacteria 1807
59 Ga0068871_100094359 3300006358 Bacteria 2498
60 Ga0068871_100224915 3300006358 Bacteria 1627
61 Ga0068865_100300206 3300006881 Bacteria 1285
62 Ga0068865_100958738 3300006881 Bacteria 747
63 Ga0075436_100388298 3300006914 Bacteria 1010
64 Ga0097620_100483824 3300006931 Bacteria 1333
65 Ga0099824_1026202 3300006942 Bacteria 3045
66 Ga0111539_12102756 3300009094 Bacteria 655
67 Ga0105243_10218333 3300009148 Bacteria 1683
68 Ga0105241_11365264 3300009174 Bacteria 677
69 Ga0105242_10149136 3300009176 Bacteria 2038
70 Ga0105248_10371999 3300009177 Unclassified 1609
71 Ga0105237_10500385 3300009545 Bacteria 1222
72 Ga0105249_10166621 3300009553 Bacteria 2133
73 Ga0157369_10025410 3300013105 Bacteria 6576
74 Ga0157374_10338960 3300013296 Bacteria 1492
75 Ga0163162_10104905 3300013306 Bacteria 2921
76 Ga0163162_10365825 3300013306 Bacteria 1575
77 Ga0157372_10328662 3300013307 Bacteria 1780
78 Ga0157375_10029425 3300013308 Bacteria 5165
79 Ga0157375_12256131 3300013308 Bacteria 649
80 Ga0163163_10002694 3300014325 Bacteria 15017
81 Ga0163163_11715451 3300014325 Unclassified 689
82 Ga0163163_11791275 3300014325 Bacteria 674
83 Ga0157380_10049200 3300014326 Bacteria 3323
84 Ga0157380_10249174 3300014326 Bacteria 1607
85 Ga0157380_10481938 3300014326 Bacteria 1200
86 Ga0157380_11254079 3300014326 Bacteria 787
87 Ga0157376_10153236 3300014969 Unclassified 2081
88 Ga0157376_10181906 3300014969 Bacteria 1922
89 Ga0163161_10174338 3300017792 Bacteria 1646
90 Ga0214542_1033180 3300021321 Bacteria 1761
91 Ga0213872_10003448 3300021361 Bacteria 8790
92 Ga0209435_100096 3300025206 Bacteria 38561
93 Ga0209674_100290 3300025226 Bacteria 36375
94 Ga0209646_1000093 3300025246 Bacteria 183840
95 Ga0209026_1006092 3300025250 Bacteria 3053
96 Ga0209759_1000053 3300025256 Bacteria 212789
97 Ga0209759_1000248 3300025256 Bacteria 80537
98 Ga0209130_1000207 3300025284 Bacteria 79051
99 Ga0207426_1011343 3300025302 Bacteria 3399
100 Ga0207650_10015075 3300025925 Bacteria 5378
101 Ga0207650_10022145 3300025925 Bacteria 4497
102 Ga0207659_10178042 3300025926 Unclassified 1682
103 Ga0207644_10752047 3300025931 Unclassified 814
104 Ga0207706_10311640 3300025933 Unclassified 1370
105 Ga0207709_10501517 3300025935 Bacteria 947
106 Ga0207709_10820165 3300025935 Unclassified 752
107 Ga0207704_10655643 3300025938 Bacteria 865
108 Ga0207691_10001087 3300025940 Bacteria 27045
109 Ga0207691_11163567 3300025940 Unclassified 640
110 Ga0207711_10122762 3300025941 Bacteria 2320
111 Ga0207679_10018061 3300025945 Bacteria 4717
112 Ga0207679_10641489 3300025945 Unclassified 960
113 Ga0207667_10000066 3300025949 Bacteria 185903
114 Ga0207651_10026990 3300025960 Bacteria 3599
115 Ga0207668_10001863 3300025972 Bacteria 12311
116 Ga0207658_10067385 3300025986 Bacteria 2696
117 Ga0207658_11249480 3300025986 Bacteria 679
118 Ga0207708_10036360 3300026075 Bacteria 3749
119 Ga0207708_10080259 3300026075 Unclassified 2507
120 Ga0207641_10109821 3300026088 Bacteria 2443
121 Ga0207641_10308110 3300026088 Bacteria 1498
122 Ga0207641_10365531 3300026088 Bacteria 1378
123 Ga0207648_10082562 3300026089 Unclassified 2802
124 Ga0207676_10040653 3300026095 Bacteria 3564
125 Ga0207676_10227988 3300026095 Bacteria 1663
126 Ga0207674_10323878 3300026116 Bacteria 1491
127 Ga0207674_11269500 3300026116 Bacteria 706
128 Ga0207674_11549803 3300026116 Bacteria 631
129 Ga0207675_100049743 3300026118 Plasmid 3911
130 Ga0207675_100057334 3300026118 Bacteria 3634
131 Ga0207675_100511761 3300026118 Bacteria 1196
132 Ga0207675_101738671 3300026118 Unclassified 643
133 Ga0207683_10018051 3300026121 Bacteria 6016
134 Ga0209389_1000072 3300027296 Bacteria 96795
135 Ga0209589_1000270 3300027357 Bacteria 65577
136 Ga0209489_100206 3300027361 Bacteria 96866
137 Ga0268266_10032875 3300028379 Bacteria 4408
138 Ga0268266_10216186 3300028379 Unclassified 1760
139 Ga0268265_10070157 3300028380 Bacteria 2724
140 Ga0268265_10338941 3300028380 Bacteria 1368
141 Ga0268265_10354417 3300028380 Bacteria 1341
142 Ga0268264_10009902 3300028381 Bacteria 7891
143 Ga0268264_11499923 3300028381 Bacteria 685
144 Ga0307408_100000029 3300031548 Bacteria 227806
145 Ga0307408_100000499 3300031548 Bacteria 34156
146 Ga0307408_100201698 3300031548 Bacteria 1610
147 Ga0307408_100411737 3300031548 Bacteria 1163
148 Ga0326468_10058683 3300031889 Bacteria 606
149 Ga0307406_11220716 3300031901 Bacteria 654
150 Ga0307412_11160556 3300031911 Bacteria 690
151 Ga0307409_100110955 3300031995 Bacteria 2300
152 Ga0307409_101579292 3300031995 Bacteria 684
153 Ga0307416_100117361 3300032002 Bacteria 2362
154 Ga0373937_1161911 3300036401 Bacteria 720
155 Ga0395898_0005411 3300037466 Bacteria 13796
156 Ga0395898_0372773 3300037466 Bacteria 1361
157 Ga0395905_0000156 3300037471 Bacteria 112215
158 Ga0395905_0069796 3300037471 Bacteria 3291
159 Ga0395901_0285274 3300038443 Bacteria 1715
160 Ga0395901_1070833 3300038443 Bacteria 778
161 Ga0400487_51234 3300039110 Bacteria 1208
162 Ga0436361_0182627 3300039447 Bacteria 5242
163 Ga0436361_0288414 3300039447 Bacteria 1062
164 Ga0436361_0789464 3300039447 Bacteria 2332
165 Ga0436361_1147633 3300039447 Bacteria 896
166 Ga0436363_1686792 3300039450 Bacteria 641
167 Ga0451800_0574820 3300041459 Unclassified 1674
168 Ga0451807_1314805 3300041486 Unclassified 1721
169 Ga0451807_1944391 3300041486 Bacteria 1264
170 Ga0451841_0997159 3300041498 Bacteria 757
171 Ga0451841_1155655 3300041498 Unclassified 1093
172 Ga0451843_1239499 3300041509 Unclassified 945
173 Ga0451853_3420413 3300041512 Unclassified 1283
174 Ga0451853_4045906 3300041512 Unclassified 1712
175 Ga0439449_0114218 3300042007 Bacteria 1001
176 Ga0451577_0000635 3300042876 Bacteria 56126
177 Ga0451577_0426665 3300042876 Bacteria 1204
178 Ga0466972_0000200 3300044658 Bacteria 43953
179 Ga0466972_0137949 3300044658 Bacteria 1148
180 Ga0466965_0041945 3300044683 Bacteria 2255
181 Ga0466966_0222519 3300044684 Bacteria 1139
182 Ga0453684_0000005 3300044712 Bacteria 1431632
183 Ga0466968_0026845 3300044735 Bacteria 2367
184 Ga0466970_0471565 3300044765 Bacteria 721
185 Ga0451576_0051390 3300045051 Bacteria 4322
186 Ga0451576_0280999 3300045051 Bacteria 1740
187 Ga0466967_1577174 3300045976 Bacteria 654
188 Ga0495590_0004551 3300046457 Bacteria 5588
189 Ga0495590_0098280 3300046457 Bacteria 1039
190 Ga0495607_0107603 3300046501 Bacteria 1483
191 Ga0495606_0120591 3300046507 Bacteria 1570
192 Ga0495610_0225268 3300046512 Bacteria 755
193 Ga0495642_0058153 3300046528 Bacteria 1600
194 Ga0495654_0007336 3300046530 Bacteria 6170
195 Ga0495598_0075694 3300046537 Bacteria 1070
196 Ga0495609_0005716 3300046538 Bacteria 6476
197 Ga0495621_0204180 3300046539 Bacteria 796
198 Ga0495597_0006300 3300046542 Bacteria 6146
199 Ga0495625_0039728 3300046660 Bacteria 3434
200 Ga0495625_0311753 3300046660 Bacteria 1004
201 Ga0495659_0000055 3300046664 Bacteria 49804
202 Ga0495623_0120582 3300046679 Bacteria 1579
203 Ga0495671_0000825 3300046692 Bacteria 22126
204 Ga0495660_0001397 3300046810 Bacteria 16572
205 Ga0495660_0005520 3300046810 Bacteria 7576
206 Ga0495672_0000591 3300047320 Bacteria 40983
207 Ga0495687_015025 3300047443 Bacteria 3953
208 Ga0495677_0173607 3300047445 Bacteria 834
209 Ga0495686_0025270 3300047472 Bacteria 3896
210 Ga0495678_049019 3300049459 Bacteria 1644
211 Ga0501036_1179230 3300049572 Bacteria 624
212 Ga0501037_0045554 3300049573 Bacteria 3220
213 Ga0501038_1107895 3300049574 Bacteria 578
214 Ga0501042_0096599 3300049578 Unclassified 2123
215 Ga0501043_0217255 3300049579 Bacteria 1480
216 Ga0501047_0902097 3300049581 Bacteria 697
217 Ga0501047_1188552 3300049581 Unclassified 576
218 Ga0501070_0145664 3300049586 Bacteria 1955
219 Ga0501073_0468625 3300049589 Bacteria 871
220 Ga0501074_0002229 3300049590 Bacteria 13449
221 Ga0501075_0608232 3300049591 Bacteria 834
222 Ga0501222_012150 3300049662 Bacteria 1135
223 Ga0501235_023422 3300049669 Bacteria 1376
224 Ga0501240_008054 3300049673 Bacteria 1341
225 Ga0501249_024587 3300049679 Bacteria 1327
226 Ga0501258_002527 3300049687 Bacteria 1614
227 Ga0501221_000087 3300049704 Bacteria 10722
228 Ga0501229_004650 3300049706 Bacteria 1670
229 Ga0501080_0003428 3300049742 Bacteria 13993
230 Ga0501263_002368 3300049760 Bacteria 1916
231 Ga0501263_026418 3300049760 Bacteria 803
232 Ga0501267_002961 3300049764 Bacteria 1526
233 Ga0501269_007080 3300049766 Bacteria 1353
234 Ga0501272_004375 3300049769 Bacteria 1466
235 Ga0501276_004959 3300049773 Bacteria 1012
236 Ga0501035_0007673 3300049822 Bacteria 10079
237 Ga0501044_0959298 3300049823 Bacteria 728
238 nmdc:mga03n38_53906_c1 3300050490 Bacteria 1805
239 nmdc:mga05p37_953850_c1 3300050507 Bacteria 917
240 nmdc:mga08x19_867756_c1 3300050514 Bacteria 641
241 Ga0500643_011108 3300053087 Bacteria 3307
242 Ga0500573_0499734 3300053140 Bacteria 550
243 Ga0500622_0001863 3300053156 Bacteria 15960
244 Ga0466962_0021865 3300061719 Bacteria 3071

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_1070833 Ga0395901_1070833_323_742 127
2 3300041498 Ga0451841_0997159 Ga0451841_0997159_196_621 141
3 3300042876 Ga0451577_0000635 Ga0451577_0000635_48731_49210 146
4 3300044712 Ga0453684_0000005 Ga0453684_0000005_1143272_1143751 146
5 3300046538 Ga0495609_0005716 Ga0495609_0005716_1983_2447 148
6 3300046501 Ga0495607_0107603 Ga0495607_0107603_134_598 149
7 3300046507 Ga0495606_0120591 Ga0495606_0120591_342_806 149
8 3300046810 Ga0495660_0001397 Ga0495660_0001397_8397_8861 149
9 3300047472 Ga0495686_0025270 Ga0495686_0025270_351_815 149
10 3300049459 Ga0495678_049019 Ga0495678_049019_572_1036 149
11 iso_pu_bacteria 2617270741 2617375034 150
12 iso_pu_bacteria 2643221664 2644360247 150
13 iso_pu_bacteria 2738541280 2738741841 150
14 iso_pu_bacteria 2738541300 2738845818 150
15 iso_pu_bacteria 2738543018 2739276715 150
16 iso_pu_bacteria 2738543030 2739345759 150
17 iso_pu_bacteria 2791355199 2793081360 150
18 iso_pu_bacteria 2824679649 2824683658 150
19 iso_pu_bacteria 2824732956 2824737234 150
20 iso_pu_bacteria 2824746037 2824751869 150
21 iso_pu_bacteria 2876808645 2876815459 150
22 iso_pu_bacteria 2879110137 2879115249 150
23 iso_pu_bacteria 2881364244 2881367332 150
24 iso_pu_bacteria 2881665667 2881668594 150
25 iso_pu_bacteria 2906643746 2906646112 150
26 iso_pu_bacteria 2908775508 2908777519 150
27 iso_pu_bacteria 2919046199 2919051127 150
28 iso_pu_bacteria 2922393267 2922398201 150
29 iso_pu_bacteria 2928130867 2928133079 150
30 iso_pu_bacteria 2935975950 2935983291 150
31 iso_pu_bacteria 3005483717 3005488404 150
32 iso_pu_bacteria 8016522445 8016524436 150
33 iso_pu_bacteria 8016530956 8016537989 150
34 iso_pu_bacteria 8016548790 8016551019 150
35 iso_pu_bacteria 8016557553 8016559420 150
36 iso_pu_bacteria 8016566248 8016567649 150
37 iso_pu_bacteria 8016575299 8016580348 150
38 iso_pu_bacteria 8016595262 8016597358 150
39 iso_pu_bacteria 8016622563 8016625118 150
40 iso_pu_bacteria 8019530166 8019537662 150
41 iso_pu_bacteria 8019547302 8019552156 150
42 iso_pu_bacteria 8019619141 8019621200 150
43 iso_pu_bacteria 8019638758 8019648563 150
44 iso_pu_bacteria 8019659431 8019659526 150
45 iso_pu_bacteria 8019668869 8019668954 150
46 iso_pu_bacteria 8055266321 8055266791 150
47 3300053087 Ga0500643_011108 Ga0500643_011108_2370_2858 151
48 iso_pu_bacteria 2526164512 2526212420 151
49 iso_pu_bacteria 2844533157 2844534713 151
50 3300013105 Ga0157369_10025410 Ga0157369_100254102 153
51 3300001989 JGI24739J22299_10015763 JGI24739J22299_100157633 154
52 3300002705 JGI25156J39149_1002984 JGI25156J39149_10029847 154
53 3300002738 JGI25154J39366_1000925 JGI25154J39366_100092512 154
54 3300003322 rootL2_10007465 rootL2_1000746517 154
55 3300003323 rootH1_10041479 rootH1_100414799 154
56 3300003756 Ga0055533_1001532 Ga0055533_10015327 154
57 3300004625 Ga0055543_1000763 Ga0055543_10007638 154
58 3300005262 Ga0065165_1000039 Ga0065165_1000039144 154
59 3300005288 Ga0065714_10139935 Ga0065714_101399352 154
60 3300005334 Ga0068869_101246287 Ga0068869_1012462871 154
61 3300005338 Ga0068868_100725499 Ga0068868_1007254992 154
62 3300005347 Ga0070668_100006653 Ga0070668_1000066533 154
63 3300005353 Ga0070669_100662556 Ga0070669_1006625562 154
64 3300005354 Ga0070675_100029435 Ga0070675_1000294353 154
65 3300005355 Ga0070671_100837937 Ga0070671_1008379371 154
66 3300005356 Ga0070674_100109291 Ga0070674_1001092911 154
67 3300005364 Ga0070673_100036012 Ga0070673_1000360123 154
68 3300005366 Ga0070659_100389251 Ga0070659_1003892512 154
69 3300005366 Ga0070659_101124196 Ga0070659_1011241962 154
70 3300005367 Ga0070667_100266748 Ga0070667_1002667482 154
71 3300005367 Ga0070667_101037747 Ga0070667_1010377472 154
72 3300005438 Ga0070701_10099334 Ga0070701_100993342 154
73 3300005441 Ga0070700_100023099 Ga0070700_1000230992 154
74 3300005456 Ga0070678_100293745 Ga0070678_1002937452 154
75 3300005457 Ga0070662_100602573 Ga0070662_1006025732 154
76 3300005459 Ga0068867_100005936 Ga0068867_1000059365 154
77 3300005459 Ga0068867_100304258 Ga0068867_1003042582 154
78 3300005466 Ga0070685_10238460 Ga0070685_102384602 154
79 3300005539 Ga0068853_101100932 Ga0068853_1011009322 154
80 3300005543 Ga0070672_100000281 Ga0070672_10000028121 154
81 3300005543 Ga0070672_101022347 Ga0070672_1010223471 154
82 3300005548 Ga0070665_100010013 Ga0070665_1000100138 154
83 3300005548 Ga0070665_100252010 Ga0070665_1002520102 154
84 3300005563 Ga0068855_100000094 Ga0068855_10000009472 154
85 3300005564 Ga0070664_101127788 Ga0070664_1011277881 154
86 3300005577 Ga0068857_100334948 Ga0068857_1003349482 154
87 3300005577 Ga0068857_100459500 Ga0068857_1004595002 154
88 3300005614 Ga0068856_100884549 Ga0068856_1008845492 154
89 3300005614 Ga0068856_101332070 Ga0068856_1013320702 154
90 3300005616 Ga0068852_100864677 Ga0068852_1008646772 154
91 3300005617 Ga0068859_100483783 Ga0068859_1004837832 154
92 3300005618 Ga0068864_100003129 Ga0068864_1000031299 154
93 3300005618 Ga0068864_100053981 Ga0068864_1000539812 154
94 3300005719 Ga0068861_100033192 Ga0068861_1000331922 154
95 3300005719 Ga0068861_100076770 Ga0068861_1000767702 154
96 3300005719 Ga0068861_100902147 Ga0068861_1009021471 154
97 3300005840 Ga0068870_10214278 Ga0068870_102142782 154
98 3300005841 Ga0068863_100001562 Ga0068863_10000156212 154
99 3300005841 Ga0068863_100867924 Ga0068863_1008679242 154
100 3300005842 Ga0068858_100846831 Ga0068858_1008468312 154
101 3300005843 Ga0068860_100012883 Ga0068860_1000128836 154
102 3300005843 Ga0068860_100409167 Ga0068860_1004091672 154
103 3300005844 Ga0068862_100102089 Ga0068862_1001020893 154
104 3300005844 Ga0068862_100146745 Ga0068862_1001467452 154
105 3300005937 Ga0081455_10039881 Ga0081455_100398815 154
106 3300006048 Ga0075363_100198673 Ga0075363_1001986732 154
107 3300006237 Ga0097621_100049747 Ga0097621_1000497472 154
108 3300006353 Ga0075370_10086337 Ga0075370_100863372 154
109 3300006358 Ga0068871_100094359 Ga0068871_1000943592 154
110 3300006358 Ga0068871_100224915 Ga0068871_1002249152 154
111 3300006881 Ga0068865_100300206 Ga0068865_1003002062 154
112 3300006881 Ga0068865_100958738 Ga0068865_1009587382 154
113 3300006914 Ga0075436_100388298 Ga0075436_1003882981 154
114 3300006931 Ga0097620_100483824 Ga0097620_1004838242 154
115 3300006942 Ga0099824_1026202 Ga0099824_10262022 154
116 3300009094 Ga0111539_12102756 Ga0111539_121027561 154
117 3300009148 Ga0105243_10218333 Ga0105243_102183331 154
118 3300009174 Ga0105241_11365264 Ga0105241_113652641 154
119 3300009176 Ga0105242_10149136 Ga0105242_101491362 154
120 3300009177 Ga0105248_10371999 Ga0105248_103719992 154
121 3300009545 Ga0105237_10500385 Ga0105237_105003852 154
122 3300009553 Ga0105249_10166621 Ga0105249_101666213 154
123 3300013296 Ga0157374_10338960 Ga0157374_103389601 154
124 3300013306 Ga0163162_10104905 Ga0163162_101049052 154
125 3300013306 Ga0163162_10365825 Ga0163162_103658252 154
126 3300013307 Ga0157372_10328662 Ga0157372_103286622 154
127 3300013308 Ga0157375_10029425 Ga0157375_100294255 154
128 3300013308 Ga0157375_12256131 Ga0157375_122561312 154
129 3300014325 Ga0163163_10002694 Ga0163163_100026947 154
130 3300014325 Ga0163163_11715451 Ga0163163_117154512 154
131 3300014325 Ga0163163_11791275 Ga0163163_117912751 154
132 3300014326 Ga0157380_10049200 Ga0157380_100492004 154
133 3300014326 Ga0157380_10249174 Ga0157380_102491742 154
134 3300014326 Ga0157380_10481938 Ga0157380_104819381 154
135 3300014326 Ga0157380_11254079 Ga0157380_112540792 154
136 3300014969 Ga0157376_10153236 Ga0157376_101532362 154
137 3300014969 Ga0157376_10181906 Ga0157376_101819062 154
138 3300017792 Ga0163161_10174338 Ga0163161_101743382 154
139 3300021321 Ga0214542_1033180 Ga0214542_10331803 154
140 3300021361 Ga0213872_10003448 Ga0213872_100034484 154
141 3300025206 Ga0209435_100096 Ga0209435_10009629 154
142 3300025226 Ga0209674_100290 Ga0209674_1002907 154
143 3300025246 Ga0209646_1000093 Ga0209646_100009318 154
144 3300025250 Ga0209026_1006092 Ga0209026_10060922 154
145 3300025256 Ga0209759_1000053 Ga0209759_1000053183 154
146 3300025256 Ga0209759_1000248 Ga0209759_100024824 154
147 3300025284 Ga0209130_1000207 Ga0209130_100020742 154
148 3300025302 Ga0207426_1011343 Ga0207426_10113433 154
149 3300025925 Ga0207650_10015075 Ga0207650_100150753 154
150 3300025925 Ga0207650_10022145 Ga0207650_100221455 154
151 3300025926 Ga0207659_10178042 Ga0207659_101780422 154
152 3300025931 Ga0207644_10752047 Ga0207644_107520472 154
153 3300025933 Ga0207706_10311640 Ga0207706_103116401 154
154 3300025935 Ga0207709_10501517 Ga0207709_105015171 154
155 3300025935 Ga0207709_10820165 Ga0207709_108201652 154
156 3300025938 Ga0207704_10655643 Ga0207704_106556432 154
157 3300025940 Ga0207691_10001087 Ga0207691_1000108724 154
158 3300025940 Ga0207691_11163567 Ga0207691_111635671 154
159 3300025941 Ga0207711_10122762 Ga0207711_101227622 154
160 3300025945 Ga0207679_10018061 Ga0207679_100180616 154
161 3300025945 Ga0207679_10641489 Ga0207679_106414891 154
162 3300025949 Ga0207667_10000066 Ga0207667_1000006679 154
163 3300025960 Ga0207651_10026990 Ga0207651_100269903 154
164 3300025972 Ga0207668_10001863 Ga0207668_100018633 154
165 3300025986 Ga0207658_10067385 Ga0207658_100673853 154
166 3300025986 Ga0207658_11249480 Ga0207658_112494801 154
167 3300026075 Ga0207708_10036360 Ga0207708_100363602 154
168 3300026075 Ga0207708_10080259 Ga0207708_100802593 154
169 3300026088 Ga0207641_10109821 Ga0207641_101098212 154
170 3300026088 Ga0207641_10308110 Ga0207641_103081101 154
171 3300026088 Ga0207641_10365531 Ga0207641_103655312 154
172 3300026089 Ga0207648_10082562 Ga0207648_100825622 154
173 3300026095 Ga0207676_10040653 Ga0207676_100406532 154
174 3300026095 Ga0207676_10227988 Ga0207676_102279882 154
175 3300026116 Ga0207674_10323878 Ga0207674_103238782 154
176 3300026116 Ga0207674_11269500 Ga0207674_112695002 154
177 3300026116 Ga0207674_11549803 Ga0207674_115498031 154
178 3300026118 Ga0207675_100049743 Ga0207675_1000497435 154
179 3300026118 Ga0207675_100057334 Ga0207675_1000573344 154
180 3300026118 Ga0207675_100511761 Ga0207675_1005117612 154
181 3300026118 Ga0207675_101738671 Ga0207675_1017386711 154
182 3300026121 Ga0207683_10018051 Ga0207683_100180512 154
183 3300027296 Ga0209389_1000072 Ga0209389_100007263 154
184 3300027357 Ga0209589_1000270 Ga0209589_10002705 154
185 3300027361 Ga0209489_100206 Ga0209489_10020663 154
186 3300028379 Ga0268266_10032875 Ga0268266_100328752 154
187 3300028379 Ga0268266_10216186 Ga0268266_102161862 154
188 3300028380 Ga0268265_10070157 Ga0268265_100701572 154
189 3300028380 Ga0268265_10338941 Ga0268265_103389412 154
190 3300028380 Ga0268265_10354417 Ga0268265_103544172 154
191 3300028381 Ga0268264_10009902 Ga0268264_100099026 154
192 3300028381 Ga0268264_11499923 Ga0268264_114999231 154
193 3300031548 Ga0307408_100000029 Ga0307408_10000002949 154
194 3300031548 Ga0307408_100000499 Ga0307408_10000049930 154
195 3300031548 Ga0307408_100201698 Ga0307408_1002016982 154
196 3300031548 Ga0307408_100411737 Ga0307408_1004117372 154
197 3300031889 Ga0326468_10058683 Ga0326468_100586832 154
198 3300031901 Ga0307406_11220716 Ga0307406_112207162 154
199 3300031911 Ga0307412_11160556 Ga0307412_111605562 154
200 3300031995 Ga0307409_100110955 Ga0307409_1001109552 154
201 3300031995 Ga0307409_101579292 Ga0307409_1015792921 154
202 3300032002 Ga0307416_100117361 Ga0307416_1001173612 154
203 3300036401 Ga0373937_1161911 Ga0373937_1161911_10_486 154
204 3300037466 Ga0395898_0005411 Ga0395898_0005411_2098_2565 154
205 3300037466 Ga0395898_0372773 Ga0395898_0372773_667_1146 154
206 3300037471 Ga0395905_0000156 Ga0395905_0000156_84701_85165 154
207 3300037471 Ga0395905_0069796 Ga0395905_0069796_2588_3067 154
208 3300038443 Ga0395901_0285274 Ga0395901_0285274_1221_1700 154
209 3300039110 Ga0400487_51234 Ga0400487_51234_441_920 154
210 3300039447 Ga0436361_0182627 Ga0436361_0182627_431_895 154
211 3300039447 Ga0436361_0288414 Ga0436361_0288414_30_572 154
212 3300039447 Ga0436361_0789464 Ga0436361_0789464_1005_1484 154
213 3300039447 Ga0436361_1147633 Ga0436361_1147633_41_526 154
214 3300039450 Ga0436363_1686792 Ga0436363_1686792_113_580 154
215 3300041459 Ga0451800_0574820 Ga0451800_0574820_1030_1494 154
216 3300041486 Ga0451807_1314805 Ga0451807_1314805_616_1080 154
217 3300041486 Ga0451807_1944391 Ga0451807_1944391_205_675 154
218 3300041498 Ga0451841_1155655 Ga0451841_1155655_312_776 154
219 3300041509 Ga0451843_1239499 Ga0451843_1239499_210_674 154
220 3300041512 Ga0451853_3420413 Ga0451853_3420413_36_500 154
221 3300041512 Ga0451853_4045906 Ga0451853_4045906_457_921 154
222 3300042007 Ga0439449_0114218 Ga0439449_0114218_422_889 154
223 3300042876 Ga0451577_0426665 Ga0451577_0426665_455_922 154
224 3300044658 Ga0466972_0000200 Ga0466972_0000200_37508_37987 154
225 3300044658 Ga0466972_0137949 Ga0466972_0137949_414_893 154
226 3300044683 Ga0466965_0041945 Ga0466965_0041945_183_749 154
227 3300044684 Ga0466966_0222519 Ga0466966_0222519_345_863 154
228 3300044735 Ga0466968_0026845 Ga0466968_0026845_978_1457 154
229 3300044765 Ga0466970_0471565 Ga0466970_0471565_214_693 154
230 3300045051 Ga0451576_0051390 Ga0451576_0051390_2863_3327 154
231 3300045051 Ga0451576_0280999 Ga0451576_0280999_811_1275 154
232 3300045976 Ga0466967_1577174 Ga0466967_1577174_71_538 154
233 3300046457 Ga0495590_0004551 Ga0495590_0004551_4704_5168 154
234 3300046457 Ga0495590_0098280 Ga0495590_0098280_126_590 154
235 3300046512 Ga0495610_0225268 Ga0495610_0225268_198_662 154
236 3300046528 Ga0495642_0058153 Ga0495642_0058153_1015_1479 154
237 3300046530 Ga0495654_0007336 Ga0495654_0007336_5293_5757 154
238 3300046537 Ga0495598_0075694 Ga0495598_0075694_195_659 154
239 3300046539 Ga0495621_0204180 Ga0495621_0204180_67_531 154
240 3300046542 Ga0495597_0006300 Ga0495597_0006300_5154_5618 154
241 3300046660 Ga0495625_0039728 Ga0495625_0039728_1268_1732 154
242 3300046660 Ga0495625_0311753 Ga0495625_0311753_74_538 154
243 3300046664 Ga0495659_0000055 Ga0495659_0000055_39360_39824 154
244 3300046679 Ga0495623_0120582 Ga0495623_0120582_163_627 154
245 3300046692 Ga0495671_0000825 Ga0495671_0000825_11083_11547 154
246 3300046810 Ga0495660_0005520 Ga0495660_0005520_6968_7432 154
247 3300047320 Ga0495672_0000591 Ga0495672_0000591_35210_35674 154
248 3300047443 Ga0495687_015025 Ga0495687_015025_1147_1611 154
249 3300047445 Ga0495677_0173607 Ga0495677_0173607_14_478 154
250 3300049572 Ga0501036_1179230 Ga0501036_1179230_99_566 154
251 3300049573 Ga0501037_0045554 Ga0501037_0045554_2011_2475 154
252 3300049574 Ga0501038_1107895 Ga0501038_1107895_75_539 154
253 3300049578 Ga0501042_0096599 Ga0501042_0096599_911_1375 154
254 3300049579 Ga0501043_0217255 Ga0501043_0217255_910_1374 154
255 3300049581 Ga0501047_0902097 Ga0501047_0902097_182_646 154
256 3300049581 Ga0501047_1188552 Ga0501047_1188552_89_553 154
257 3300049586 Ga0501070_0145664 Ga0501070_0145664_981_1445 154
258 3300049589 Ga0501073_0468625 Ga0501073_0468625_330_794 154
259 3300049590 Ga0501074_0002229 Ga0501074_0002229_12022_12486 154
260 3300049591 Ga0501075_0608232 Ga0501075_0608232_31_498 154
261 3300049662 Ga0501222_012150 Ga0501222_012150_149_658 154
262 3300049669 Ga0501235_023422 Ga0501235_023422_544_1053 154
263 3300049673 Ga0501240_008054 Ga0501240_008054_603_1067 154
264 3300049679 Ga0501249_024587 Ga0501249_024587_417_926 154
265 3300049687 Ga0501258_002527 Ga0501258_002527_498_1007 154
266 3300049704 Ga0501221_000087 Ga0501221_000087_4339_4848 154
267 3300049706 Ga0501229_004650 Ga0501229_004650_353_862 154
268 3300049742 Ga0501080_0003428 Ga0501080_0003428_11889_12353 154
269 3300049760 Ga0501263_002368 Ga0501263_002368_1046_1510 154
270 3300049760 Ga0501263_026418 Ga0501263_026418_114_578 154
271 3300049764 Ga0501267_002961 Ga0501267_002961_500_1009 154
272 3300049766 Ga0501269_007080 Ga0501269_007080_299_763 154
273 3300049769 Ga0501272_004375 Ga0501272_004375_244_753 154
274 3300049773 Ga0501276_004959 Ga0501276_004959_255_719 154
275 3300049822 Ga0501035_0007673 Ga0501035_0007673_151_615 154
276 3300049823 Ga0501044_0959298 Ga0501044_0959298_100_564 154
277 3300050490 nmdc:mga03n38_53906_c1 nmdc:mga03n38_53906_c1_855_1334 154
278 3300050507 nmdc:mga05p37_953850_c1 nmdc:mga05p37_953850_c1_50_523 154
279 3300050514 nmdc:mga08x19_867756_c1 nmdc:mga08x19_867756_c1_141_617 154
280 3300053140 Ga0500573_0499734 Ga0500573_0499734_53_517 154
281 3300053156 Ga0500622_0001863 Ga0500622_0001863_4390_4854 154
282 3300061719 Ga0466962_0021865 Ga0466962_0021865_2161_2625 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10027

DUF2269

Predicted integral membrane protein (DUF2269)

11

160

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b0h-assembly1.cif.gz_A solution structure of vbs3 fragment of talin 0.6571 10 154
7qhm-assembly1.cif.gz_S cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.6557 10 146
7rh5-assembly1.cif.gz_S mycobacterial ciii2civ2 supercomplex, inhibitor free 0.6443 4 146
7o3e-assembly1.cif.gz_c murine supercomplex ciii2civ in the intermediate locked conformation 0.615 11 145
7w56-assembly1.cif.gz_R cryo-em structure of the neuromedin s-bound neuromedin u receptor 1-gq protein complex 0.6061 41 138
ID Description Score Start End Superfamily
af_F4JXP4_437_551_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8436 77 151 1.20.140.150
af_K7K978_414_529_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8414 77 148 1.20.140.150
af_Q9FFM1_174_293_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8347 79 151 1.20.140.150
af_A0A0R0IJL1_639_753_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8274 77 151 1.20.140.150
af_K7M4Z9_552_665_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8202 78 148 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A5C8PHG4-F1-model_v4 DUF2269 domain-containing protein 0.994 3 152 GO:0016020
AF-A0A2V4KGX8-F1-model_v4 deleted 0.9915 1 152
AF-A0A1F8I4F4-F1-model_v4 deleted 0.991 1 152
AF-A0A4Q4L440-F1-model_v4 DUF2269 domain-containing protein 0.9896 1 152 GO:0016020
AF-A0A833ISB2-F1-model_v4 DUF2269 domain-containing protein 0.9893 2 152 GO:0016020

Feature Viewer

pLDDT pTM Quality
94.81 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map