F385066
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 282 | 183 | 280 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300035724|Ga0373933_0389504|Ga0373933_0389504_347_775 |
| Length | 142 |
| Sequence | MAWLLDTNILSELRRLKPEPKVLEFIANHPLEELYISAVTLAELRFGIELLSHGTSRRDELNSWLTQKIRPMFDRRVLPVTEDIMFRWRVAVEEGRKAGHTFSQPDLIIAATALHHGLTVVTRDRSDFEKTGAPVLNPWETT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 2 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 3 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 32 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 34 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 37 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 38 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 39 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 40 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 41 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 42 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 58 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 59 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 60 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 89 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 90 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 91 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 92 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 94 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 97 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 98 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 100 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 101 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 102 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 103 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 104 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 105 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 106 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 107 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 108 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 109 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 110 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 112 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 113 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 115 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 116 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 117 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 118 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 119 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 120 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 123 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 124 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 125 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 126 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 127 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 128 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 129 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 130 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 131 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 148 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 149 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 150 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 151 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 152 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 153 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 154 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 155 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 156 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 157 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 158 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 159 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 166 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 167 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 170 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 174 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 175 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 176 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 177 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 178 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 179 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 180 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 181 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 182 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.87 |
| Metatranscriptomes | 1.06 |
| Isolates | 1.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.16 |
| Nodule | 0.35 |
| Rhizoplane | 1.42 |
| Rhizosphere | 78.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10004496 | 3300003203 | Bacteria | 6491 |
| 2 | JGI25406J46586_10013538 | 3300003203 | Bacteria | 3498 |
| 3 | JGI25153J46596_10001821 | 3300003215 | Bacteria | 12633 |
| 4 | rootH1_10016292 | 3300003316 | Bacteria | 16501 |
| 5 | rootH1_10016292 | 3300003323 | Bacteria | 2576 |
| 6 | rootL2_10016825 | 3300003322 | Bacteria | 3803 |
| 7 | rootL2_10027282 | 3300003322 | Bacteria | 16821 |
| 8 | Ga0070690_100559669 | 3300005330 | Bacteria | 863 |
| 9 | Ga0070670_100108899 | 3300005331 | Bacteria | 2387 |
| 10 | Ga0070666_10012775 | 3300005335 | Bacteria | 5309 |
| 11 | Ga0070680_100537578 | 3300005336 | Bacteria | 1001 |
| 12 | Ga0070689_100000004 | 3300005340 | Bacteria | 497771 |
| 13 | Ga0070692_10014645 | 3300005345 | Bacteria | 3690 |
| 14 | Ga0070668_101371547 | 3300005347 | Unclassified | 644 |
| 15 | Ga0070671_100405575 | 3300005355 | Unclassified | 1166 |
| 16 | Ga0070688_100146955 | 3300005365 | Bacteria | 1607 |
| 17 | Ga0070708_101347198 | 3300005445 | Bacteria | 666 |
| 18 | Ga0070678_100042980 | 3300005456 | Unclassified | 3216 |
| 19 | Ga0070678_100226078 | 3300005456 | Bacteria | 1558 |
| 20 | Ga0070681_10028534 | 3300005458 | Bacteria | 5611 |
| 21 | Ga0070685_10093488 | 3300005466 | Bacteria | 1824 |
| 22 | Ga0070684_100046985 | 3300005535 | Bacteria | 3741 |
| 23 | Ga0070684_100143335 | 3300005535 | Bacteria | 2162 |
| 24 | Ga0068853_100090724 | 3300005539 | Bacteria | 2686 |
| 25 | Ga0068853_100386031 | 3300005539 | Bacteria | 1308 |
| 26 | Ga0068853_101479547 | 3300005539 | Unclassified | 657 |
| 27 | Ga0070686_100479605 | 3300005544 | Unclassified | 961 |
| 28 | Ga0070665_100005590 | 3300005548 | Bacteria | 12928 |
| 29 | Ga0070665_100199791 | 3300005548 | Unclassified | 2000 |
| 30 | Ga0070665_100287847 | 3300005548 | Unclassified | 1645 |
| 31 | Ga0070665_100638339 | 3300005548 | Bacteria | 1078 |
| 32 | Ga0070664_100636371 | 3300005564 | Bacteria | 991 |
| 33 | Ga0068854_100905636 | 3300005578 | Bacteria | 775 |
| 34 | Ga0068852_100171836 | 3300005616 | Unclassified | 2032 |
| 35 | Ga0068863_100128687 | 3300005841 | Bacteria | 2416 |
| 36 | Ga0068863_100484014 | 3300005841 | Bacteria | 1217 |
| 37 | Ga0068860_100691432 | 3300005843 | Unclassified | 1029 |
| 38 | Ga0068860_101177992 | 3300005843 | Bacteria | 786 |
| 39 | Ga0081455_10000463 | 3300005937 | Bacteria | 52989 |
| 40 | Ga0081540_1102492 | 3300005983 | Unclassified | 1229 |
| 41 | Ga0081539_10001091 | 3300005985 | Bacteria | 49336 |
| 42 | Ga0081539_10001513 | 3300005985 | Bacteria | 39170 |
| 43 | Ga0081539_10084293 | 3300005985 | Bacteria | 1661 |
| 44 | Ga0075363_100147322 | 3300006048 | Bacteria | 1327 |
| 45 | Ga0070715_10275805 | 3300006163 | Bacteria | 889 |
| 46 | Ga0070716_100002966 | 3300006173 | Bacteria | 7915 |
| 47 | Ga0075362_10065116 | 3300006177 | Bacteria | 1654 |
| 48 | Ga0075369_10096078 | 3300006186 | Bacteria | 1326 |
| 49 | Ga0075369_10368252 | 3300006186 | Unclassified | 675 |
| 50 | Ga0075366_10423131 | 3300006195 | Bacteria | 821 |
| 51 | Ga0075370_10080558 | 3300006353 | Bacteria | 1871 |
| 52 | Ga0075433_10179259 | 3300006852 | Bacteria | 1885 |
| 53 | Ga0099794_10146977 | 3300007265 | Bacteria | 1195 |
| 54 | Ga0099795_10000999 | 3300007788 | Bacteria | 5801 |
| 55 | Ga0099795_10094746 | 3300007788 | Bacteria | 1162 |
| 56 | Ga0105240_10001494 | 3300009093 | Bacteria | 39835 |
| 57 | Ga0105240_10003957 | 3300009093 | Bacteria | 22880 |
| 58 | Ga0105240_10102240 | 3300009093 | Bacteria | 3483 |
| 59 | Ga0105240_10212908 | 3300009093 | Bacteria | 2257 |
| 60 | Ga0105240_10690269 | 3300009093 | Unclassified | 1115 |
| 61 | Ga0105240_10770475 | 3300009093 | Unclassified | 1044 |
| 62 | Ga0105240_10838027 | 3300009093 | Bacteria | 993 |
| 63 | Ga0105247_10425974 | 3300009101 | Unclassified | 951 |
| 64 | Ga0105243_11204847 | 3300009148 | Bacteria | 770 |
| 65 | Ga0105241_10920652 | 3300009174 | Bacteria | 813 |
| 66 | Ga0105248_10652037 | 3300009177 | Bacteria | 1188 |
| 67 | Ga0105237_10001159 | 3300009545 | Bacteria | 35250 |
| 68 | Ga0105237_10090916 | 3300009545 | Bacteria | 3042 |
| 69 | Ga0105237_10205110 | 3300009545 | Bacteria | 1972 |
| 70 | Ga0105237_11035372 | 3300009545 | Bacteria | 828 |
| 71 | Ga0105237_11093048 | 3300009545 | Unclassified | 804 |
| 72 | Ga0105238_10006892 | 3300009551 | Bacteria | 11350 |
| 73 | Ga0105238_10055859 | 3300009551 | Plasmid | 3962 |
| 74 | Ga0105238_10444370 | 3300009551 | Unclassified | 1293 |
| 75 | Ga0105249_10085652 | 3300009553 | Bacteria | 2937 |
| 76 | Ga0105249_11772740 | 3300009553 | Bacteria | 690 |
| 77 | Ga0099796_10000518 | 3300010159 | Bacteria | 6572 |
| 78 | Ga0099796_10026021 | 3300010159 | Unclassified | 1854 |
| 79 | Ga0099796_10130454 | 3300010159 | Bacteria | 974 |
| 80 | Ga0099796_10198076 | 3300010159 | Bacteria | 814 |
| 81 | Ga0105239_10003776 | 3300010375 | Bacteria | 18431 |
| 82 | Ga0105239_10071485 | 3300010375 | Bacteria | 3812 |
| 83 | Ga0105239_10162142 | 3300010375 | Bacteria | 2498 |
| 84 | Ga0105239_10685801 | 3300010375 | Bacteria | 1171 |
| 85 | Ga0157369_10135960 | 3300013105 | Bacteria | 2603 |
| 86 | Ga0157369_10180456 | 3300013105 | Bacteria | 2221 |
| 87 | Ga0157369_10332678 | 3300013105 | Bacteria | 1578 |
| 88 | Ga0157369_11361065 | 3300013105 | Bacteria | 723 |
| 89 | Ga0157372_10090289 | 3300013307 | Bacteria | 3483 |
| 90 | Ga0163163_10022248 | 3300014325 | Bacteria | 5999 |
| 91 | Ga0157379_10181238 | 3300014968 | Unclassified | 1903 |
| 92 | Ga0157379_10265954 | 3300014968 | Unclassified | 1559 |
| 93 | Ga0157379_12664334 | 3300014968 | Unclassified | 501 |
| 94 | Ga0213874_10175411 | 3300021377 | Bacteria | 760 |
| 95 | Ga0213875_10028488 | 3300021388 | Bacteria | 2652 |
| 96 | Ga0213875_10108831 | 3300021388 | Unclassified | 1293 |
| 97 | Ga0213875_10539454 | 3300021388 | Unclassified | 562 |
| 98 | Ga0228598_1046001 | 3300024227 | Bacteria | 864 |
| 99 | Ga0209129_1034676 | 3300025258 | Unclassified | 825 |
| 100 | Ga0209025_1000325 | 3300025294 | Bacteria | 106131 |
| 101 | Ga0209758_1000204 | 3300025297 | Bacteria | 131754 |
| 102 | Ga0207710_10478710 | 3300025900 | Unclassified | 645 |
| 103 | Ga0207680_10064144 | 3300025903 | Bacteria | 2251 |
| 104 | Ga0207685_10191254 | 3300025905 | Bacteria | 955 |
| 105 | Ga0207654_10878260 | 3300025911 | Bacteria | 650 |
| 106 | Ga0207707_10058721 | 3300025912 | Bacteria | 3347 |
| 107 | Ga0207695_10002185 | 3300025913 | Bacteria | 29540 |
| 108 | Ga0207695_10006094 | 3300025913 | Bacteria | 15732 |
| 109 | Ga0207695_10104270 | 3300025913 | Bacteria | 2825 |
| 110 | Ga0207695_10175918 | 3300025913 | Bacteria | 2063 |
| 111 | Ga0207695_10471228 | 3300025913 | Bacteria | 1138 |
| 112 | Ga0207671_10006050 | 3300025914 | Bacteria | 10915 |
| 113 | Ga0207671_10099043 | 3300025914 | Bacteria | 2206 |
| 114 | Ga0207671_10122713 | 3300025914 | Bacteria | 1987 |
| 115 | Ga0207671_10126683 | 3300025914 | Bacteria | 1957 |
| 116 | Ga0207671_10354692 | 3300025914 | Unclassified | 1163 |
| 117 | Ga0207660_10442888 | 3300025917 | Bacteria | 1050 |
| 118 | Ga0207694_10035096 | 3300025924 | Bacteria | 3846 |
| 119 | Ga0207694_10342520 | 3300025924 | Bacteria | 1236 |
| 120 | Ga0207694_10389810 | 3300025924 | Unclassified | 1157 |
| 121 | Ga0207650_10565477 | 3300025925 | Unclassified | 954 |
| 122 | Ga0207706_10715193 | 3300025933 | Bacteria | 855 |
| 123 | Ga0207665_10062040 | 3300025939 | Bacteria | 2535 |
| 124 | Ga0207711_10600414 | 3300025941 | Bacteria | 1027 |
| 125 | Ga0207661_10287361 | 3300025944 | Bacteria | 1471 |
| 126 | Ga0207679_10541185 | 3300025945 | Bacteria | 1044 |
| 127 | Ga0207677_10434899 | 3300026023 | Bacteria | 1121 |
| 128 | Ga0207703_10335236 | 3300026035 | Unclassified | 1389 |
| 129 | Ga0207703_11038141 | 3300026035 | Bacteria | 787 |
| 130 | Ga0207639_10071359 | 3300026041 | Bacteria | 2716 |
| 131 | Ga0207678_10268059 | 3300026067 | Bacteria | 1464 |
| 132 | Ga0207641_10112184 | 3300026088 | Bacteria | 2419 |
| 133 | Ga0207641_10574446 | 3300026088 | Bacteria | 1102 |
| 134 | Ga0207683_10064061 | 3300026121 | Unclassified | 3239 |
| 135 | Ga0207683_10139652 | 3300026121 | Bacteria | 2182 |
| 136 | Ga0209179_1071995 | 3300027512 | Bacteria | 758 |
| 137 | Ga0209588_1065360 | 3300027671 | Bacteria | 1175 |
| 138 | Ga0268266_10057853 | 3300028379 | Bacteria | 3337 |
| 139 | Ga0268266_10113341 | 3300028379 | Unclassified | 2405 |
| 140 | Ga0268266_10235974 | 3300028379 | Bacteria | 1686 |
| 141 | Ga0268266_10469397 | 3300028379 | Bacteria | 1198 |
| 142 | Ga0268264_11018966 | 3300028381 | Bacteria | 835 |
| 143 | Ga0265337_1204649 | 3300028556 | Unclassified | 536 |
| 144 | Ga0265334_10052129 | 3300028573 | Unclassified | 1566 |
| 145 | Ga0265334_10071155 | 3300028573 | Bacteria | 1295 |
| 146 | Ga0265318_10000170 | 3300028577 | Bacteria | 57549 |
| 147 | Ga0265318_10016540 | 3300028577 | Bacteria | 3048 |
| 148 | Ga0265318_10029323 | 3300028577 | Bacteria | 2146 |
| 149 | Ga0265318_10061303 | 3300028577 | Bacteria | 1401 |
| 150 | Ga0307515_10132188 | 3300028794 | Bacteria | 2739 |
| 151 | Ga0307515_10202347 | 3300028794 | Bacteria | 1857 |
| 152 | Ga0265338_10033652 | 3300028800 | Bacteria | 4969 |
| 153 | Ga0265338_10069091 | 3300028800 | Unclassified | 3038 |
| 154 | Ga0265338_10251103 | 3300028800 | Bacteria | 1305 |
| 155 | Ga0265338_10289303 | 3300028800 | Bacteria | 1194 |
| 156 | Ga0265324_10268893 | 3300029957 | Unclassified | 579 |
| 157 | Ga0265762_1080230 | 3300030760 | Bacteria | 698 |
| 158 | Ga0265763_1021150 | 3300030763 | Bacteria | 685 |
| 159 | Ga0265760_10011146 | 3300031090 | Bacteria | 2569 |
| 160 | Ga0265330_10000017 | 3300031235 | Bacteria | 166302 |
| 161 | Ga0265332_10000249 | 3300031238 | Bacteria | 43066 |
| 162 | Ga0265328_10000075 | 3300031239 | Bacteria | 52301 |
| 163 | Ga0265328_10003239 | 3300031239 | Bacteria | 7216 |
| 164 | Ga0265320_10000005 | 3300031240 | Bacteria | 354422 |
| 165 | Ga0265325_10007195 | 3300031241 | Bacteria | 6692 |
| 166 | Ga0265325_10018919 | 3300031241 | Bacteria | 3815 |
| 167 | Ga0265329_10006371 | 3300031242 | Bacteria | 4685 |
| 168 | Ga0265340_10027984 | 3300031247 | Bacteria | 2838 |
| 169 | Ga0265340_10156842 | 3300031247 | Bacteria | 1036 |
| 170 | Ga0265339_10014338 | 3300031249 | Bacteria | 4778 |
| 171 | Ga0265339_10084638 | 3300031249 | Bacteria | 1671 |
| 172 | Ga0265339_10200959 | 3300031249 | Bacteria | 983 |
| 173 | Ga0265331_10000013 | 3300031250 | Bacteria | 296011 |
| 174 | Ga0265331_10115879 | 3300031250 | Bacteria | 1227 |
| 175 | Ga0265331_10354834 | 3300031250 | Bacteria | 657 |
| 176 | Ga0265316_10007252 | 3300031344 | Bacteria | 10472 |
| 177 | Ga0265316_10011048 | 3300031344 | Bacteria | 8181 |
| 178 | Ga0265316_10028616 | 3300031344 | Bacteria | 4594 |
| 179 | Ga0265316_10347634 | 3300031344 | Unclassified | 1074 |
| 180 | Ga0307513_10003220 | 3300031456 | Bacteria | 22271 |
| 181 | Ga0307513_10003325 | 3300031456 | Bacteria | 21887 |
| 182 | Ga0307513_10771285 | 3300031456 | Bacteria | 667 |
| 183 | Ga0265313_10000809 | 3300031595 | Bacteria | 31583 |
| 184 | Ga0265313_10072401 | 3300031595 | Unclassified | 1584 |
| 185 | Ga0265313_10164408 | 3300031595 | Unclassified | 941 |
| 186 | Ga0307514_10013324 | 3300031649 | Bacteria | 6822 |
| 187 | Ga0265314_10000024 | 3300031711 | Bacteria | 295216 |
| 188 | Ga0265342_10018365 | 3300031712 | Bacteria | 4532 |
| 189 | Ga0265342_10372104 | 3300031712 | Bacteria | 741 |
| 190 | Ga0307414_11447225 | 3300032004 | Bacteria | 639 |
| 191 | Ga0373923_0183539 | 3300035111 | Bacteria | 962 |
| 192 | Ga0373953_0088955 | 3300035117 | Bacteria | 1290 |
| 193 | Ga0373954_0245862 | 3300035118 | Bacteria | 880 |
| 194 | Ga0373957_0105574 | 3300035120 | Bacteria | 1131 |
| 195 | Ga0373957_0273014 | 3300035120 | Unclassified | 714 |
| 196 | Ga0373924_0254028 | 3300035410 | Bacteria | 778 |
| 197 | Ga0373927_0000072 | 3300035695 | Bacteria | 73717 |
| 198 | Ga0373933_0002118 | 3300035724 | Bacteria | 11400 |
| 199 | Ga0373933_0389504 | 3300035724 | Unclassified | 908 |
| 200 | Ga0373937_0001506 | 3300036401 | Bacteria | 19564 |
| 201 | Ga0373937_0052574 | 3300036401 | Plasmid | 3735 |
| 202 | Ga0373925_0018090 | 3300037068 | Bacteria | 5118 |
| 203 | Ga0436364_0009932 | 3300037853 | Unclassified | 861 |
| 204 | Ga0436364_0022146 | 3300037853 | Unclassified | 548 |
| 205 | Ga0436364_0280617 | 3300037853 | Bacteria | 2798 |
| 206 | Ga0436364_0537517 | 3300037853 | Plasmid | 2814 |
| 207 | Ga0436364_0690966 | 3300037853 | Unclassified | 1387 |
| 208 | Ga0436364_1073147 | 3300037853 | Bacteria | 4396 |
| 209 | Ga0436365_0371398 | 3300039437 | Bacteria | 1490 |
| 210 | Ga0436365_1612656 | 3300039437 | Unclassified | 1884 |
| 211 | Ga0436360_0876030 | 3300039438 | Unclassified | 1880 |
| 212 | Ga0436361_0014990 | 3300039447 | Bacteria | 2325 |
| 213 | Ga0436361_0373700 | 3300039447 | Bacteria | 30841 |
| 214 | Ga0436361_0555756 | 3300039447 | Bacteria | 895 |
| 215 | Ga0436362_0010202 | 3300039453 | Unclassified | 1549 |
| 216 | Ga0439465_0298617 | 3300041413 | Unclassified | 602 |
| 217 | Ga0466961_0191132 | 3300044693 | Bacteria | 1269 |
| 218 | Ga0466963_0783930 | 3300044694 | Bacteria | 672 |
| 219 | Ga0466957_0666980 | 3300044842 | Unclassified | 732 |
| 220 | Ga0495583_0082370 | 3300046506 | Bacteria | 1396 |
| 221 | Ga0495606_0000992 | 3300046507 | Bacteria | 41375 |
| 222 | Ga0495608_0330220 | 3300046511 | Bacteria | 941 |
| 223 | Ga0495610_0082001 | 3300046512 | Bacteria | 1479 |
| 224 | Ga0495618_0100011 | 3300046514 | Bacteria | 1856 |
| 225 | Ga0495628_0100507 | 3300046516 | Unclassified | 2233 |
| 226 | Ga0495643_0183928 | 3300046522 | Bacteria | 1014 |
| 227 | Ga0495648_0128438 | 3300046524 | Bacteria | 1351 |
| 228 | Ga0495652_0553860 | 3300046529 | Bacteria | 790 |
| 229 | Ga0495587_0821761 | 3300046536 | Unclassified | 507 |
| 230 | Ga0495667_0122322 | 3300046559 | Bacteria | 1680 |
| 231 | Ga0495668_0078296 | 3300046616 | Bacteria | 1815 |
| 232 | Ga0495634_0165043 | 3300046642 | Bacteria | 1394 |
| 233 | Ga0495635_0266376 | 3300046663 | Bacteria | 1153 |
| 234 | Ga0495600_0073866 | 3300046809 | Bacteria | 2227 |
| 235 | Ga0495680_0154728 | 3300047322 | Unclassified | 1669 |
| 236 | Ga0495680_0198772 | 3300047322 | Bacteria | 1439 |
| 237 | Ga0496103_0373790 | 3300048906 | Unclassified | 916 |
| 238 | Ga0496106_0026025 | 3300048909 | Bacteria | 4354 |
| 239 | Ga0496112_0000059 | 3300048915 | Bacteria | 74946 |
| 240 | Ga0496114_0454148 | 3300048917 | Bacteria | 1135 |
| 241 | Ga0496117_0026817 | 3300048920 | Bacteria | 4501 |
| 242 | Ga0496118_0002618 | 3300048921 | Bacteria | 23874 |
| 243 | Ga0496119_0001037 | 3300048922 | Bacteria | 35545 |
| 244 | Ga0496120_0000843 | 3300048923 | Bacteria | 43594 |
| 245 | Ga0496121_0001522 | 3300048924 | Bacteria | 38904 |
| 246 | Ga0496124_0002388 | 3300048927 | Bacteria | 24716 |
| 247 | Ga0496125_0090729 | 3300048928 | Bacteria | 2292 |
| 248 | Ga0496125_0141859 | 3300048928 | Bacteria | 1669 |
| 249 | Ga0496125_0563186 | 3300048928 | Unclassified | 629 |
| 250 | Ga0496126_0002018 | 3300048929 | Bacteria | 28703 |
| 251 | Ga0496126_0011470 | 3300048929 | Bacteria | 9168 |
| 252 | Ga0496126_0170593 | 3300048929 | Bacteria | 1854 |
| 253 | Ga0501036_0269952 | 3300049572 | Bacteria | 1424 |
| 254 | Ga0501040_0463673 | 3300049576 | Unclassified | 912 |
| 255 | Ga0501047_0698180 | 3300049581 | Unclassified | 832 |
| 256 | Ga0501073_0014308 | 3300049589 | Bacteria | 5764 |
| 257 | Ga0501080_0010723 | 3300049742 | Bacteria | 8384 |
| 258 | Ga0501083_0508840 | 3300049744 | Bacteria | 784 |
| 259 | nmdc:mga0k408_223013_c1 | 3300050493 | Bacteria | 1125 |
| 260 | nmdc:mga07m45_184651_c1 | 3300050496 | Bacteria | 1212 |
| 261 | nmdc:mga0n895_2226060_c1 | 3300050512 | Unclassified | 503 |
| 262 | nmdc:mga0a205_450536_c1 | 3300050515 | Bacteria | 1147 |
| 263 | nmdc:mga0sz30_125225_c1 | 3300050516 | Bacteria | 1130 |
| 264 | Ga0495601_0378297 | 3300053077 | Bacteria | 919 |
| 265 | Ga0495595_0008003 | 3300053084 | Bacteria | 4329 |
| 266 | Ga0495595_0691298 | 3300053084 | Unclassified | 523 |
| 267 | Ga0495619_0015974 | 3300053085 | Bacteria | 4752 |
| 268 | Ga0495619_0180476 | 3300053085 | Bacteria | 1460 |
| 269 | Ga0500646_0093402 | 3300053090 | Bacteria | 935 |
| 270 | Ga0500651_0147937 | 3300053093 | Bacteria | 1412 |
| 271 | Ga0500569_206450 | 3300053109 | Unclassified | 668 |
| 272 | Ga0500572_001893 | 3300053111 | Bacteria | 5272 |
| 273 | Ga0500614_266196 | 3300053123 | Unclassified | 536 |
| 274 | Ga0500568_0015830 | 3300053139 | Bacteria | 3366 |
| 275 | Ga0500568_0120466 | 3300053139 | Unclassified | 978 |
| 276 | Ga0500604_0107862 | 3300053151 | Unclassified | 923 |
| 277 | Ga0500636_0471679 | 3300053177 | Bacteria | 562 |
| 278 | Ga0500596_006335 | 3300053735 | Unclassified | 2013 |
| 279 | Ga0501084_0210821 | 3300054114 | Bacteria | 1639 |
| 280 | Ga0501082_1386217 | 3300060353 | Unclassified | 614 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053093 | Ga0500651_0147937 | Ga0500651_0147937_14_427 | 137 |
| 2 | iso_pu_bacteria | 2909042592 | 2909046761 | 138 |
| 3 | 3300014325 | Ga0163163_10022248 | Ga0163163_100222484 | 139 |
| 4 | 3300039437 | Ga0436365_0371398 | Ga0436365_0371398_826_1260 | 139 |
| 5 | 3300005330 | Ga0070690_100559669 | Ga0070690_1005596691 | 140 |
| 6 | 3300005340 | Ga0070689_100000004 | Ga0070689_100000004371 | 140 |
| 7 | 3300005365 | Ga0070688_100146955 | Ga0070688_1001469554 | 140 |
| 8 | 3300005983 | Ga0081540_1102492 | Ga0081540_11024923 | 140 |
| 9 | 3300009093 | Ga0105240_10690269 | Ga0105240_106902691 | 140 |
| 10 | 3300009093 | Ga0105240_10838027 | Ga0105240_108380272 | 140 |
| 11 | 3300009551 | Ga0105238_10444370 | Ga0105238_104443702 | 140 |
| 12 | 3300025913 | Ga0207695_10471228 | Ga0207695_104712282 | 140 |
| 13 | 3300025924 | Ga0207694_10389810 | Ga0207694_103898102 | 140 |
| 14 | 3300028556 | Ga0265337_1204649 | Ga0265337_12046491 | 140 |
| 15 | 3300028573 | Ga0265334_10052129 | Ga0265334_100521292 | 140 |
| 16 | 3300028577 | Ga0265318_10000170 | Ga0265318_1000017018 | 140 |
| 17 | 3300028577 | Ga0265318_10016540 | Ga0265318_100165405 | 140 |
| 18 | 3300028800 | Ga0265338_10069091 | Ga0265338_100690914 | 140 |
| 19 | 3300029957 | Ga0265324_10268893 | Ga0265324_102688931 | 140 |
| 20 | 3300031235 | Ga0265330_10000017 | Ga0265330_100000173 | 140 |
| 21 | 3300031238 | Ga0265332_10000249 | Ga0265332_1000024934 | 140 |
| 22 | 3300031239 | Ga0265328_10000075 | Ga0265328_1000007558 | 140 |
| 23 | 3300031239 | Ga0265328_10003239 | Ga0265328_100032398 | 140 |
| 24 | 3300031240 | Ga0265320_10000005 | Ga0265320_1000000534 | 140 |
| 25 | 3300031242 | Ga0265329_10006371 | Ga0265329_100063713 | 140 |
| 26 | 3300031250 | Ga0265331_10000013 | Ga0265331_10000013225 | 140 |
| 27 | 3300031250 | Ga0265331_10354834 | Ga0265331_103548341 | 140 |
| 28 | 3300031344 | Ga0265316_10011048 | Ga0265316_100110484 | 140 |
| 29 | 3300031595 | Ga0265313_10000809 | Ga0265313_100008092 | 140 |
| 30 | 3300031595 | Ga0265313_10072401 | Ga0265313_100724014 | 140 |
| 31 | 3300031595 | Ga0265313_10164408 | Ga0265313_101644082 | 140 |
| 32 | 3300031711 | Ga0265314_10000024 | Ga0265314_1000002435 | 140 |
| 33 | 3300031712 | Ga0265342_10018365 | Ga0265342_100183653 | 140 |
| 34 | 3300031712 | Ga0265342_10372104 | Ga0265342_103721041 | 140 |
| 35 | 3300046511 | Ga0495608_0330220 | Ga0495608_0330220_97_519 | 140 |
| 36 | 3300046514 | Ga0495618_0100011 | Ga0495618_0100011_201_623 | 140 |
| 37 | 3300046516 | Ga0495628_0100507 | Ga0495628_0100507_589_1011 | 140 |
| 38 | 3300046529 | Ga0495652_0553860 | Ga0495652_0553860_237_659 | 140 |
| 39 | 3300046536 | Ga0495587_0821761 | Ga0495587_0821761_24_446 | 140 |
| 40 | 3300046663 | Ga0495635_0266376 | Ga0495635_0266376_144_566 | 140 |
| 41 | 3300046809 | Ga0495600_0073866 | Ga0495600_0073866_1627_2049 | 140 |
| 42 | 3300047322 | Ga0495680_0154728 | Ga0495680_0154728_844_1266 | 140 |
| 43 | 3300053084 | Ga0495595_0008003 | Ga0495595_0008003_3127_3549 | 140 |
| 44 | 3300053085 | Ga0495619_0015974 | Ga0495619_0015974_2936_3358 | 140 |
| 45 | 3300053123 | Ga0500614_266196 | Ga0500614_266196_104_526 | 140 |
| 46 | 3300003215 | JGI25153J46596_10001821 | JGI25153J46596_1000182111 | 141 |
| 47 | 3300005548 | Ga0070665_100005590 | Ga0070665_1000055909 | 141 |
| 48 | 3300005578 | Ga0068854_100905636 | Ga0068854_1009056362 | 141 |
| 49 | 3300006173 | Ga0070716_100002966 | Ga0070716_1000029663 | 141 |
| 50 | 3300009545 | Ga0105237_10205110 | Ga0105237_102051102 | 141 |
| 51 | 3300009553 | Ga0105249_10085652 | Ga0105249_100856524 | 141 |
| 52 | 3300010375 | Ga0105239_10071485 | Ga0105239_100714853 | 141 |
| 53 | 3300021388 | Ga0213875_10028488 | Ga0213875_100284884 | 141 |
| 54 | 3300025258 | Ga0209129_1034676 | Ga0209129_10346762 | 141 |
| 55 | 3300025294 | Ga0209025_1000325 | Ga0209025_100032541 | 141 |
| 56 | 3300025297 | Ga0209758_1000204 | Ga0209758_1000204103 | 141 |
| 57 | 3300025914 | Ga0207671_10099043 | Ga0207671_100990432 | 141 |
| 58 | 3300025914 | Ga0207671_10122713 | Ga0207671_101227132 | 141 |
| 59 | 3300025939 | Ga0207665_10062040 | Ga0207665_100620404 | 141 |
| 60 | 3300026067 | Ga0207678_10268059 | Ga0207678_102680592 | 141 |
| 61 | 3300028379 | Ga0268266_10057853 | Ga0268266_100578533 | 141 |
| 62 | 3300028800 | Ga0265338_10289303 | Ga0265338_102893033 | 141 |
| 63 | 3300031344 | Ga0265316_10347634 | Ga0265316_103476341 | 141 |
| 64 | 3300035120 | Ga0373957_0273014 | Ga0373957_0273014_159_587 | 141 |
| 65 | 3300035724 | Ga0373933_0389504 | Ga0373933_0389504_347_775 | 141 |
| 66 | 3300037853 | Ga0436364_1073147 | Ga0436364_1073147_190_615 | 141 |
| 67 | 3300048922 | Ga0496119_0001037 | Ga0496119_0001037_2586_3014 | 141 |
| 68 | 3300048923 | Ga0496120_0000843 | Ga0496120_0000843_33290_33718 | 141 |
| 69 | 3300048928 | Ga0496125_0141859 | Ga0496125_0141859_518_952 | 141 |
| 70 | 3300049589 | Ga0501073_0014308 | Ga0501073_0014308_1738_2163 | 141 |
| 71 | 3300049742 | Ga0501080_0010723 | Ga0501080_0010723_4057_4482 | 141 |
| 72 | iso_pu_bacteria | 2904541872 | 2904548950 | 141 |
| 73 | iso_pu_bacteria | 2929160207 | 2929160931 | 141 |
| 74 | 3300005345 | Ga0070692_10014645 | Ga0070692_100146454 | 142 |
| 75 | 3300005347 | Ga0070668_101371547 | Ga0070668_1013715471 | 142 |
| 76 | 3300005548 | Ga0070665_100638339 | Ga0070665_1006383392 | 142 |
| 77 | 3300006048 | Ga0075363_100147322 | Ga0075363_1001473222 | 142 |
| 78 | 3300006177 | Ga0075362_10065116 | Ga0075362_100651162 | 142 |
| 79 | 3300006186 | Ga0075369_10096078 | Ga0075369_100960782 | 142 |
| 80 | 3300006195 | Ga0075366_10423131 | Ga0075366_104231312 | 142 |
| 81 | 3300006353 | Ga0075370_10080558 | Ga0075370_100805582 | 142 |
| 82 | 3300007788 | Ga0099795_10094746 | Ga0099795_100947463 | 142 |
| 83 | 3300009148 | Ga0105243_11204847 | Ga0105243_112048472 | 142 |
| 84 | 3300014968 | Ga0157379_12664334 | Ga0157379_126643341 | 142 |
| 85 | 3300021388 | Ga0213875_10539454 | Ga0213875_105394542 | 142 |
| 86 | 3300028379 | Ga0268266_10469397 | Ga0268266_104693972 | 142 |
| 87 | 3300028573 | Ga0265334_10071155 | Ga0265334_100711553 | 142 |
| 88 | 3300028577 | Ga0265318_10029323 | Ga0265318_100293234 | 142 |
| 89 | 3300028800 | Ga0265338_10251103 | Ga0265338_102511032 | 142 |
| 90 | 3300030763 | Ga0265763_1021150 | Ga0265763_10211501 | 142 |
| 91 | 3300031241 | Ga0265325_10018919 | Ga0265325_100189193 | 142 |
| 92 | 3300031249 | Ga0265339_10014338 | Ga0265339_100143383 | 142 |
| 93 | 3300031250 | Ga0265331_10115879 | Ga0265331_101158793 | 142 |
| 94 | 3300031344 | Ga0265316_10028616 | Ga0265316_100286163 | 142 |
| 95 | 3300031649 | Ga0307514_10013324 | Ga0307514_100133242 | 142 |
| 96 | 3300037853 | Ga0436364_0690966 | Ga0436364_0690966_222_653 | 142 |
| 97 | 3300049581 | Ga0501047_0698180 | Ga0501047_0698180_277_705 | 142 |
| 98 | 3300050493 | nmdc:mga0k408_223013_c1 | nmdc:mga0k408_223013_c1_314_742 | 142 |
| 99 | 3300050496 | nmdc:mga07m45_184651_c1 | nmdc:mga07m45_184651_c1_100_528 | 142 |
| 100 | 3300050512 | nmdc:mga0n895_2226060_c1 | nmdc:mga0n895_2226060_c1_17_445 | 142 |
| 101 | 3300050516 | nmdc:mga0sz30_125225_c1 | nmdc:mga0sz30_125225_c1_525_953 | 142 |
| 102 | 3300053139 | Ga0500568_0120466 | Ga0500568_0120466_359_787 | 142 |
| 103 | 3300053151 | Ga0500604_0107862 | Ga0500604_0107862_337_765 | 142 |
| 104 | 3300003203 | JGI25406J46586_10004496 | JGI25406J46586_100044963 | 143 |
| 105 | 3300003203 | JGI25406J46586_10013538 | JGI25406J46586_100135384 | 143 |
| 106 | 3300003316 | rootH1_10016292 | rootH1_1001629211 | 143 |
| 107 | 3300003322 | rootL2_10016825 | rootL2_100168253 | 143 |
| 108 | 3300003322 | rootL2_10027282 | rootL2_1002728216 | 143 |
| 109 | 3300005331 | Ga0070670_100108899 | Ga0070670_1001088992 | 143 |
| 110 | 3300005335 | Ga0070666_10012775 | Ga0070666_100127754 | 143 |
| 111 | 3300005336 | Ga0070680_100537578 | Ga0070680_1005375781 | 143 |
| 112 | 3300005355 | Ga0070671_100405575 | Ga0070671_1004055752 | 143 |
| 113 | 3300005445 | Ga0070708_101347198 | Ga0070708_1013471981 | 143 |
| 114 | 3300005456 | Ga0070678_100042980 | Ga0070678_1000429803 | 143 |
| 115 | 3300005456 | Ga0070678_100226078 | Ga0070678_1002260783 | 143 |
| 116 | 3300005458 | Ga0070681_10028534 | Ga0070681_100285344 | 143 |
| 117 | 3300005466 | Ga0070685_10093488 | Ga0070685_100934882 | 143 |
| 118 | 3300005535 | Ga0070684_100046985 | Ga0070684_1000469854 | 143 |
| 119 | 3300005535 | Ga0070684_100143335 | Ga0070684_1001433353 | 143 |
| 120 | 3300005539 | Ga0068853_100090724 | Ga0068853_1000907243 | 143 |
| 121 | 3300005539 | Ga0068853_100386031 | Ga0068853_1003860312 | 143 |
| 122 | 3300005539 | Ga0068853_101479547 | Ga0068853_1014795471 | 143 |
| 123 | 3300005544 | Ga0070686_100479605 | Ga0070686_1004796051 | 143 |
| 124 | 3300005548 | Ga0070665_100199791 | Ga0070665_1001997912 | 143 |
| 125 | 3300005548 | Ga0070665_100287847 | Ga0070665_1002878471 | 143 |
| 126 | 3300005564 | Ga0070664_100636371 | Ga0070664_1006363712 | 143 |
| 127 | 3300005616 | Ga0068852_100171836 | Ga0068852_1001718362 | 143 |
| 128 | 3300005841 | Ga0068863_100128687 | Ga0068863_1001286873 | 143 |
| 129 | 3300005841 | Ga0068863_100484014 | Ga0068863_1004840141 | 143 |
| 130 | 3300005843 | Ga0068860_100691432 | Ga0068860_1006914321 | 143 |
| 131 | 3300005843 | Ga0068860_101177992 | Ga0068860_1011779921 | 143 |
| 132 | 3300005937 | Ga0081455_10000463 | Ga0081455_1000046312 | 143 |
| 133 | 3300005985 | Ga0081539_10001091 | Ga0081539_100010919 | 143 |
| 134 | 3300005985 | Ga0081539_10001513 | Ga0081539_1000151326 | 143 |
| 135 | 3300005985 | Ga0081539_10084293 | Ga0081539_100842933 | 143 |
| 136 | 3300006163 | Ga0070715_10275805 | Ga0070715_102758052 | 143 |
| 137 | 3300006186 | Ga0075369_10368252 | Ga0075369_103682522 | 143 |
| 138 | 3300006852 | Ga0075433_10179259 | Ga0075433_101792592 | 143 |
| 139 | 3300007265 | Ga0099794_10146977 | Ga0099794_101469772 | 143 |
| 140 | 3300007788 | Ga0099795_10000999 | Ga0099795_100009995 | 143 |
| 141 | 3300009093 | Ga0105240_10001494 | Ga0105240_1000149412 | 143 |
| 142 | 3300009093 | Ga0105240_10003957 | Ga0105240_1000395710 | 143 |
| 143 | 3300009093 | Ga0105240_10102240 | Ga0105240_101022405 | 143 |
| 144 | 3300009093 | Ga0105240_10212908 | Ga0105240_102129083 | 143 |
| 145 | 3300009093 | Ga0105240_10770475 | Ga0105240_107704752 | 143 |
| 146 | 3300009101 | Ga0105247_10425974 | Ga0105247_104259742 | 143 |
| 147 | 3300009174 | Ga0105241_10920652 | Ga0105241_109206522 | 143 |
| 148 | 3300009177 | Ga0105248_10652037 | Ga0105248_106520371 | 143 |
| 149 | 3300009545 | Ga0105237_10001159 | Ga0105237_1000115912 | 143 |
| 150 | 3300009545 | Ga0105237_10090916 | Ga0105237_100909166 | 143 |
| 151 | 3300009545 | Ga0105237_11035372 | Ga0105237_110353722 | 143 |
| 152 | 3300009545 | Ga0105237_11093048 | Ga0105237_110930482 | 143 |
| 153 | 3300009551 | Ga0105238_10006892 | Ga0105238_100068924 | 143 |
| 154 | 3300009551 | Ga0105238_10055859 | Ga0105238_100558592 | 143 |
| 155 | 3300009553 | Ga0105249_11772740 | Ga0105249_117727401 | 143 |
| 156 | 3300010159 | Ga0099796_10000518 | Ga0099796_100005186 | 143 |
| 157 | 3300010159 | Ga0099796_10026021 | Ga0099796_100260212 | 143 |
| 158 | 3300010159 | Ga0099796_10130454 | Ga0099796_101304542 | 143 |
| 159 | 3300010159 | Ga0099796_10198076 | Ga0099796_101980762 | 143 |
| 160 | 3300010375 | Ga0105239_10003776 | Ga0105239_100037765 | 143 |
| 161 | 3300010375 | Ga0105239_10162142 | Ga0105239_101621423 | 143 |
| 162 | 3300010375 | Ga0105239_10685801 | Ga0105239_106858012 | 143 |
| 163 | 3300013105 | Ga0157369_10135960 | Ga0157369_101359603 | 143 |
| 164 | 3300013105 | Ga0157369_10180456 | Ga0157369_101804562 | 143 |
| 165 | 3300013105 | Ga0157369_10332678 | Ga0157369_103326782 | 143 |
| 166 | 3300013105 | Ga0157369_11361065 | Ga0157369_113610652 | 143 |
| 167 | 3300013307 | Ga0157372_10090289 | Ga0157372_100902893 | 143 |
| 168 | 3300014968 | Ga0157379_10181238 | Ga0157379_101812384 | 143 |
| 169 | 3300014968 | Ga0157379_10265954 | Ga0157379_102659542 | 143 |
| 170 | 3300021377 | Ga0213874_10175411 | Ga0213874_101754111 | 143 |
| 171 | 3300021388 | Ga0213875_10108831 | Ga0213875_101088313 | 143 |
| 172 | 3300024227 | Ga0228598_1046001 | Ga0228598_10460012 | 143 |
| 173 | 3300025900 | Ga0207710_10478710 | Ga0207710_104787101 | 143 |
| 174 | 3300025903 | Ga0207680_10064144 | Ga0207680_100641442 | 143 |
| 175 | 3300025905 | Ga0207685_10191254 | Ga0207685_101912542 | 143 |
| 176 | 3300025911 | Ga0207654_10878260 | Ga0207654_108782601 | 143 |
| 177 | 3300025912 | Ga0207707_10058721 | Ga0207707_100587213 | 143 |
| 178 | 3300025913 | Ga0207695_10002185 | Ga0207695_1000218512 | 143 |
| 179 | 3300025913 | Ga0207695_10006094 | Ga0207695_100060948 | 143 |
| 180 | 3300025913 | Ga0207695_10104270 | Ga0207695_101042704 | 143 |
| 181 | 3300025913 | Ga0207695_10175918 | Ga0207695_101759182 | 143 |
| 182 | 3300025914 | Ga0207671_10006050 | Ga0207671_100060505 | 143 |
| 183 | 3300025914 | Ga0207671_10126683 | Ga0207671_101266833 | 143 |
| 184 | 3300025914 | Ga0207671_10354692 | Ga0207671_103546922 | 143 |
| 185 | 3300025917 | Ga0207660_10442888 | Ga0207660_104428882 | 143 |
| 186 | 3300025924 | Ga0207694_10035096 | Ga0207694_100350963 | 143 |
| 187 | 3300025924 | Ga0207694_10342520 | Ga0207694_103425201 | 143 |
| 188 | 3300025925 | Ga0207650_10565477 | Ga0207650_105654772 | 143 |
| 189 | 3300025933 | Ga0207706_10715193 | Ga0207706_107151932 | 143 |
| 190 | 3300025941 | Ga0207711_10600414 | Ga0207711_106004141 | 143 |
| 191 | 3300025944 | Ga0207661_10287361 | Ga0207661_102873613 | 143 |
| 192 | 3300025945 | Ga0207679_10541185 | Ga0207679_105411851 | 143 |
| 193 | 3300026023 | Ga0207677_10434899 | Ga0207677_104348991 | 143 |
| 194 | 3300026035 | Ga0207703_10335236 | Ga0207703_103352362 | 143 |
| 195 | 3300026035 | Ga0207703_11038141 | Ga0207703_110381412 | 143 |
| 196 | 3300026041 | Ga0207639_10071359 | Ga0207639_100713593 | 143 |
| 197 | 3300026088 | Ga0207641_10112184 | Ga0207641_101121842 | 143 |
| 198 | 3300026088 | Ga0207641_10574446 | Ga0207641_105744462 | 143 |
| 199 | 3300026121 | Ga0207683_10064061 | Ga0207683_100640613 | 143 |
| 200 | 3300026121 | Ga0207683_10139652 | Ga0207683_101396522 | 143 |
| 201 | 3300027512 | Ga0209179_1071995 | Ga0209179_10719951 | 143 |
| 202 | 3300027671 | Ga0209588_1065360 | Ga0209588_10653602 | 143 |
| 203 | 3300028379 | Ga0268266_10113341 | Ga0268266_101133412 | 143 |
| 204 | 3300028379 | Ga0268266_10235974 | Ga0268266_102359741 | 143 |
| 205 | 3300028381 | Ga0268264_11018966 | Ga0268264_110189662 | 143 |
| 206 | 3300028577 | Ga0265318_10061303 | Ga0265318_100613032 | 143 |
| 207 | 3300028794 | Ga0307515_10132188 | Ga0307515_101321882 | 143 |
| 208 | 3300028794 | Ga0307515_10202347 | Ga0307515_102023472 | 143 |
| 209 | 3300028800 | Ga0265338_10033652 | Ga0265338_100336523 | 143 |
| 210 | 3300030760 | Ga0265762_1080230 | Ga0265762_10802302 | 143 |
| 211 | 3300031090 | Ga0265760_10011146 | Ga0265760_100111464 | 143 |
| 212 | 3300031241 | Ga0265325_10007195 | Ga0265325_1000719512 | 143 |
| 213 | 3300031247 | Ga0265340_10027984 | Ga0265340_100279842 | 143 |
| 214 | 3300031247 | Ga0265340_10156842 | Ga0265340_101568422 | 143 |
| 215 | 3300031249 | Ga0265339_10084638 | Ga0265339_100846382 | 143 |
| 216 | 3300031249 | Ga0265339_10200959 | Ga0265339_102009592 | 143 |
| 217 | 3300031344 | Ga0265316_10007252 | Ga0265316_1000725212 | 143 |
| 218 | 3300031456 | Ga0307513_10003220 | Ga0307513_1000322026 | 143 |
| 219 | 3300031456 | Ga0307513_10003325 | Ga0307513_100033253 | 143 |
| 220 | 3300031456 | Ga0307513_10771285 | Ga0307513_107712852 | 143 |
| 221 | 3300032004 | Ga0307414_11447225 | Ga0307414_114472251 | 143 |
| 222 | 3300035111 | Ga0373923_0183539 | Ga0373923_0183539_195_632 | 143 |
| 223 | 3300035117 | Ga0373953_0088955 | Ga0373953_0088955_444_881 | 143 |
| 224 | 3300035118 | Ga0373954_0245862 | Ga0373954_0245862_364_801 | 143 |
| 225 | 3300035120 | Ga0373957_0105574 | Ga0373957_0105574_543_980 | 143 |
| 226 | 3300035410 | Ga0373924_0254028 | Ga0373924_0254028_112_549 | 143 |
| 227 | 3300035695 | Ga0373927_0000072 | Ga0373927_0000072_4234_4665 | 143 |
| 228 | 3300035724 | Ga0373933_0002118 | Ga0373933_0002118_9233_9670 | 143 |
| 229 | 3300036401 | Ga0373937_0001506 | Ga0373937_0001506_7245_7682 | 143 |
| 230 | 3300036401 | Ga0373937_0052574 | Ga0373937_0052574_2679_3116 | 143 |
| 231 | 3300037068 | Ga0373925_0018090 | Ga0373925_0018090_1299_1730 | 143 |
| 232 | 3300037853 | Ga0436364_0009932 | Ga0436364_0009932_161_598 | 143 |
| 233 | 3300037853 | Ga0436364_0022146 | Ga0436364_0022146_57_494 | 143 |
| 234 | 3300037853 | Ga0436364_0280617 | Ga0436364_0280617_1278_1715 | 143 |
| 235 | 3300037853 | Ga0436364_0537517 | Ga0436364_0537517_99_536 | 143 |
| 236 | 3300039437 | Ga0436365_1612656 | Ga0436365_1612656_351_788 | 143 |
| 237 | 3300039438 | Ga0436360_0876030 | Ga0436360_0876030_950_1381 | 143 |
| 238 | 3300039447 | Ga0436361_0014990 | Ga0436361_0014990_982_1428 | 143 |
| 239 | 3300039447 | Ga0436361_0373700 | Ga0436361_0373700_14291_14755 | 143 |
| 240 | 3300039447 | Ga0436361_0555756 | Ga0436361_0555756_67_510 | 143 |
| 241 | 3300039453 | Ga0436362_0010202 | Ga0436362_0010202_273_710 | 143 |
| 242 | 3300041413 | Ga0439465_0298617 | Ga0439465_0298617_103_543 | 143 |
| 243 | 3300044693 | Ga0466961_0191132 | Ga0466961_0191132_159_605 | 143 |
| 244 | 3300044694 | Ga0466963_0783930 | Ga0466963_0783930_14_460 | 143 |
| 245 | 3300044842 | Ga0466957_0666980 | Ga0466957_0666980_141_587 | 143 |
| 246 | 3300046506 | Ga0495583_0082370 | Ga0495583_0082370_125_568 | 143 |
| 247 | 3300046507 | Ga0495606_0000992 | Ga0495606_0000992_25440_25877 | 143 |
| 248 | 3300046512 | Ga0495610_0082001 | Ga0495610_0082001_483_920 | 143 |
| 249 | 3300046522 | Ga0495643_0183928 | Ga0495643_0183928_314_760 | 143 |
| 250 | 3300046524 | Ga0495648_0128438 | Ga0495648_0128438_101_535 | 143 |
| 251 | 3300046559 | Ga0495667_0122322 | Ga0495667_0122322_849_1286 | 143 |
| 252 | 3300046616 | Ga0495668_0078296 | Ga0495668_0078296_1255_1692 | 143 |
| 253 | 3300046642 | Ga0495634_0165043 | Ga0495634_0165043_727_1230 | 143 |
| 254 | 3300047322 | Ga0495680_0198772 | Ga0495680_0198772_678_1115 | 143 |
| 255 | 3300048906 | Ga0496103_0373790 | Ga0496103_0373790_82_525 | 143 |
| 256 | 3300048909 | Ga0496106_0026025 | Ga0496106_0026025_2361_2804 | 143 |
| 257 | 3300048915 | Ga0496112_0000059 | Ga0496112_0000059_51214_51657 | 143 |
| 258 | 3300048917 | Ga0496114_0454148 | Ga0496114_0454148_193_627 | 143 |
| 259 | 3300048920 | Ga0496117_0026817 | Ga0496117_0026817_2856_3299 | 143 |
| 260 | 3300048921 | Ga0496118_0002618 | Ga0496118_0002618_1253_1696 | 143 |
| 261 | 3300048924 | Ga0496121_0001522 | Ga0496121_0001522_1368_1811 | 143 |
| 262 | 3300048927 | Ga0496124_0002388 | Ga0496124_0002388_1075_1518 | 143 |
| 263 | 3300048928 | Ga0496125_0090729 | Ga0496125_0090729_405_848 | 143 |
| 264 | 3300048928 | Ga0496125_0563186 | Ga0496125_0563186_161_613 | 143 |
| 265 | 3300048929 | Ga0496126_0002018 | Ga0496126_0002018_3289_3741 | 143 |
| 266 | 3300048929 | Ga0496126_0011470 | Ga0496126_0011470_7409_7852 | 143 |
| 267 | 3300048929 | Ga0496126_0170593 | Ga0496126_0170593_397_849 | 143 |
| 268 | 3300049572 | Ga0501036_0269952 | Ga0501036_0269952_558_998 | 143 |
| 269 | 3300049576 | Ga0501040_0463673 | Ga0501040_0463673_424_864 | 143 |
| 270 | 3300049744 | Ga0501083_0508840 | Ga0501083_0508840_165_605 | 143 |
| 271 | 3300050515 | nmdc:mga0a205_450536_c1 | nmdc:mga0a205_450536_c1_480_917 | 143 |
| 272 | 3300053077 | Ga0495601_0378297 | Ga0495601_0378297_19_456 | 143 |
| 273 | 3300053084 | Ga0495595_0691298 | Ga0495595_0691298_66_503 | 143 |
| 274 | 3300053085 | Ga0495619_0180476 | Ga0495619_0180476_802_1239 | 143 |
| 275 | 3300053090 | Ga0500646_0093402 | Ga0500646_0093402_186_617 | 143 |
| 276 | 3300053109 | Ga0500569_206450 | Ga0500569_206450_38_484 | 143 |
| 277 | 3300053111 | Ga0500572_001893 | Ga0500572_001893_3212_3649 | 143 |
| 278 | 3300053139 | Ga0500568_0015830 | Ga0500568_0015830_567_1004 | 143 |
| 279 | 3300053177 | Ga0500636_0471679 | Ga0500636_0471679_25_486 | 143 |
| 280 | 3300053735 | Ga0500596_006335 | Ga0500596_006335_159_596 | 143 |
| 281 | 3300054114 | Ga0501084_0210821 | Ga0501084_0210821_685_1125 | 143 |
| 282 | 3300060353 | Ga0501082_1386217 | Ga0501082_1386217_19_465 | 143 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2h1c-assembly1.cif.gz_A | crystal structure of fitacb from neisseria gonorrhoeae | 0.9255 | 4 | 140 |
| 2h1o-assembly1.cif.gz_A | structure of fitab bound to ir36 dna fragment | 0.9077 | 4 | 143 |
| 2h1c-assembly1.cif.gz_A | crystal structure of fitacb from neisseria gonorrhoeae | 0.9068 | 4 | 140 |
| 6ifm-assembly1.cif.gz_C | crystal structure of dna bound vapbc from salmonella typhimurium | 0.8238 | 1 | 136 |
| 3tnd-assembly1.cif.gz_G | crystal structure of shigella flexneri vapbc toxin-antitoxin complex | 0.8123 | 1 | 138 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WF99_2_82_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9187 | 5 | 74 | 3.40.50.1010 |
| 2bsqA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9077 | 4 | 143 | 3.40.50.1010 |
| 2bsqA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.8841 | 4 | 143 | 3.40.50.1010 |
| af_F1R507_266_328_1.10.8.60 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.8365 | 83 | 112 | 1.10.8.60 |
| 3zvkB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.8104 | 4 | 137 | 3.40.50.1010 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N9N9E7-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 1.001 | 3 | 139 |
GO:0000287
GO:0004540 GO:0090729 |
| AF-T1CAQ3-F1-model_v4 | PilT domain-containing protein | 0.9984 | 24 | 142 |
GO:0004518
GO:0046872 |
| AF-A0A2M8R1R2-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9935 | 3 | 139 |
GO:0000287
GO:0004540 GO:0090729 |
| AF-A0A6B0WDR3-F1-model_v4 | Type II toxin-antitoxin system VapC family toxin | 0.9896 | 38 | 141 |
GO:0004518
GO:0046872 |
| AF-A0A6N6T1W5-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9832 | 3 | 139 |
GO:0000287
GO:0004540 GO:0090729 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar