F385066

General Info

Members Datasets Scaffolds Average Seq Length
282 183 280 145

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0389504|Ga0373933_0389504_347_775
Length 142
Sequence MAWLLDTNILSELRRLKPEPKVLEFIANHPLEELYISAVTLAELRFGIELLSHGTSRRDELNSWLTQKIRPMFDRRVLPVTEDIMFRWRVAVEEGRKAGHTFSQPDLIIAATALHHGLTVVTRDRSDFEKTGAPVLNPWETT

Samples

Sample ID Description Type Environment
1 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
2 2909042592 Labrys sp. LIt4 Isolate Nodule
3 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
60 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
61 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
89 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
94 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
117 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
152 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
174 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
175 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
176 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
177 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
180 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
181 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 1.06
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.16
Nodule 0.35
Rhizoplane 1.42
Rhizosphere 78.01
Stem 0
Stem Tuber 0
Unclassified 12.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10004496 3300003203 Bacteria 6491
2 JGI25406J46586_10013538 3300003203 Bacteria 3498
3 JGI25153J46596_10001821 3300003215 Bacteria 12633
4 rootH1_10016292 3300003316 Bacteria 16501
5 rootH1_10016292 3300003323 Bacteria 2576
6 rootL2_10016825 3300003322 Bacteria 3803
7 rootL2_10027282 3300003322 Bacteria 16821
8 Ga0070690_100559669 3300005330 Bacteria 863
9 Ga0070670_100108899 3300005331 Bacteria 2387
10 Ga0070666_10012775 3300005335 Bacteria 5309
11 Ga0070680_100537578 3300005336 Bacteria 1001
12 Ga0070689_100000004 3300005340 Bacteria 497771
13 Ga0070692_10014645 3300005345 Bacteria 3690
14 Ga0070668_101371547 3300005347 Unclassified 644
15 Ga0070671_100405575 3300005355 Unclassified 1166
16 Ga0070688_100146955 3300005365 Bacteria 1607
17 Ga0070708_101347198 3300005445 Bacteria 666
18 Ga0070678_100042980 3300005456 Unclassified 3216
19 Ga0070678_100226078 3300005456 Bacteria 1558
20 Ga0070681_10028534 3300005458 Bacteria 5611
21 Ga0070685_10093488 3300005466 Bacteria 1824
22 Ga0070684_100046985 3300005535 Bacteria 3741
23 Ga0070684_100143335 3300005535 Bacteria 2162
24 Ga0068853_100090724 3300005539 Bacteria 2686
25 Ga0068853_100386031 3300005539 Bacteria 1308
26 Ga0068853_101479547 3300005539 Unclassified 657
27 Ga0070686_100479605 3300005544 Unclassified 961
28 Ga0070665_100005590 3300005548 Bacteria 12928
29 Ga0070665_100199791 3300005548 Unclassified 2000
30 Ga0070665_100287847 3300005548 Unclassified 1645
31 Ga0070665_100638339 3300005548 Bacteria 1078
32 Ga0070664_100636371 3300005564 Bacteria 991
33 Ga0068854_100905636 3300005578 Bacteria 775
34 Ga0068852_100171836 3300005616 Unclassified 2032
35 Ga0068863_100128687 3300005841 Bacteria 2416
36 Ga0068863_100484014 3300005841 Bacteria 1217
37 Ga0068860_100691432 3300005843 Unclassified 1029
38 Ga0068860_101177992 3300005843 Bacteria 786
39 Ga0081455_10000463 3300005937 Bacteria 52989
40 Ga0081540_1102492 3300005983 Unclassified 1229
41 Ga0081539_10001091 3300005985 Bacteria 49336
42 Ga0081539_10001513 3300005985 Bacteria 39170
43 Ga0081539_10084293 3300005985 Bacteria 1661
44 Ga0075363_100147322 3300006048 Bacteria 1327
45 Ga0070715_10275805 3300006163 Bacteria 889
46 Ga0070716_100002966 3300006173 Bacteria 7915
47 Ga0075362_10065116 3300006177 Bacteria 1654
48 Ga0075369_10096078 3300006186 Bacteria 1326
49 Ga0075369_10368252 3300006186 Unclassified 675
50 Ga0075366_10423131 3300006195 Bacteria 821
51 Ga0075370_10080558 3300006353 Bacteria 1871
52 Ga0075433_10179259 3300006852 Bacteria 1885
53 Ga0099794_10146977 3300007265 Bacteria 1195
54 Ga0099795_10000999 3300007788 Bacteria 5801
55 Ga0099795_10094746 3300007788 Bacteria 1162
56 Ga0105240_10001494 3300009093 Bacteria 39835
57 Ga0105240_10003957 3300009093 Bacteria 22880
58 Ga0105240_10102240 3300009093 Bacteria 3483
59 Ga0105240_10212908 3300009093 Bacteria 2257
60 Ga0105240_10690269 3300009093 Unclassified 1115
61 Ga0105240_10770475 3300009093 Unclassified 1044
62 Ga0105240_10838027 3300009093 Bacteria 993
63 Ga0105247_10425974 3300009101 Unclassified 951
64 Ga0105243_11204847 3300009148 Bacteria 770
65 Ga0105241_10920652 3300009174 Bacteria 813
66 Ga0105248_10652037 3300009177 Bacteria 1188
67 Ga0105237_10001159 3300009545 Bacteria 35250
68 Ga0105237_10090916 3300009545 Bacteria 3042
69 Ga0105237_10205110 3300009545 Bacteria 1972
70 Ga0105237_11035372 3300009545 Bacteria 828
71 Ga0105237_11093048 3300009545 Unclassified 804
72 Ga0105238_10006892 3300009551 Bacteria 11350
73 Ga0105238_10055859 3300009551 Plasmid 3962
74 Ga0105238_10444370 3300009551 Unclassified 1293
75 Ga0105249_10085652 3300009553 Bacteria 2937
76 Ga0105249_11772740 3300009553 Bacteria 690
77 Ga0099796_10000518 3300010159 Bacteria 6572
78 Ga0099796_10026021 3300010159 Unclassified 1854
79 Ga0099796_10130454 3300010159 Bacteria 974
80 Ga0099796_10198076 3300010159 Bacteria 814
81 Ga0105239_10003776 3300010375 Bacteria 18431
82 Ga0105239_10071485 3300010375 Bacteria 3812
83 Ga0105239_10162142 3300010375 Bacteria 2498
84 Ga0105239_10685801 3300010375 Bacteria 1171
85 Ga0157369_10135960 3300013105 Bacteria 2603
86 Ga0157369_10180456 3300013105 Bacteria 2221
87 Ga0157369_10332678 3300013105 Bacteria 1578
88 Ga0157369_11361065 3300013105 Bacteria 723
89 Ga0157372_10090289 3300013307 Bacteria 3483
90 Ga0163163_10022248 3300014325 Bacteria 5999
91 Ga0157379_10181238 3300014968 Unclassified 1903
92 Ga0157379_10265954 3300014968 Unclassified 1559
93 Ga0157379_12664334 3300014968 Unclassified 501
94 Ga0213874_10175411 3300021377 Bacteria 760
95 Ga0213875_10028488 3300021388 Bacteria 2652
96 Ga0213875_10108831 3300021388 Unclassified 1293
97 Ga0213875_10539454 3300021388 Unclassified 562
98 Ga0228598_1046001 3300024227 Bacteria 864
99 Ga0209129_1034676 3300025258 Unclassified 825
100 Ga0209025_1000325 3300025294 Bacteria 106131
101 Ga0209758_1000204 3300025297 Bacteria 131754
102 Ga0207710_10478710 3300025900 Unclassified 645
103 Ga0207680_10064144 3300025903 Bacteria 2251
104 Ga0207685_10191254 3300025905 Bacteria 955
105 Ga0207654_10878260 3300025911 Bacteria 650
106 Ga0207707_10058721 3300025912 Bacteria 3347
107 Ga0207695_10002185 3300025913 Bacteria 29540
108 Ga0207695_10006094 3300025913 Bacteria 15732
109 Ga0207695_10104270 3300025913 Bacteria 2825
110 Ga0207695_10175918 3300025913 Bacteria 2063
111 Ga0207695_10471228 3300025913 Bacteria 1138
112 Ga0207671_10006050 3300025914 Bacteria 10915
113 Ga0207671_10099043 3300025914 Bacteria 2206
114 Ga0207671_10122713 3300025914 Bacteria 1987
115 Ga0207671_10126683 3300025914 Bacteria 1957
116 Ga0207671_10354692 3300025914 Unclassified 1163
117 Ga0207660_10442888 3300025917 Bacteria 1050
118 Ga0207694_10035096 3300025924 Bacteria 3846
119 Ga0207694_10342520 3300025924 Bacteria 1236
120 Ga0207694_10389810 3300025924 Unclassified 1157
121 Ga0207650_10565477 3300025925 Unclassified 954
122 Ga0207706_10715193 3300025933 Bacteria 855
123 Ga0207665_10062040 3300025939 Bacteria 2535
124 Ga0207711_10600414 3300025941 Bacteria 1027
125 Ga0207661_10287361 3300025944 Bacteria 1471
126 Ga0207679_10541185 3300025945 Bacteria 1044
127 Ga0207677_10434899 3300026023 Bacteria 1121
128 Ga0207703_10335236 3300026035 Unclassified 1389
129 Ga0207703_11038141 3300026035 Bacteria 787
130 Ga0207639_10071359 3300026041 Bacteria 2716
131 Ga0207678_10268059 3300026067 Bacteria 1464
132 Ga0207641_10112184 3300026088 Bacteria 2419
133 Ga0207641_10574446 3300026088 Bacteria 1102
134 Ga0207683_10064061 3300026121 Unclassified 3239
135 Ga0207683_10139652 3300026121 Bacteria 2182
136 Ga0209179_1071995 3300027512 Bacteria 758
137 Ga0209588_1065360 3300027671 Bacteria 1175
138 Ga0268266_10057853 3300028379 Bacteria 3337
139 Ga0268266_10113341 3300028379 Unclassified 2405
140 Ga0268266_10235974 3300028379 Bacteria 1686
141 Ga0268266_10469397 3300028379 Bacteria 1198
142 Ga0268264_11018966 3300028381 Bacteria 835
143 Ga0265337_1204649 3300028556 Unclassified 536
144 Ga0265334_10052129 3300028573 Unclassified 1566
145 Ga0265334_10071155 3300028573 Bacteria 1295
146 Ga0265318_10000170 3300028577 Bacteria 57549
147 Ga0265318_10016540 3300028577 Bacteria 3048
148 Ga0265318_10029323 3300028577 Bacteria 2146
149 Ga0265318_10061303 3300028577 Bacteria 1401
150 Ga0307515_10132188 3300028794 Bacteria 2739
151 Ga0307515_10202347 3300028794 Bacteria 1857
152 Ga0265338_10033652 3300028800 Bacteria 4969
153 Ga0265338_10069091 3300028800 Unclassified 3038
154 Ga0265338_10251103 3300028800 Bacteria 1305
155 Ga0265338_10289303 3300028800 Bacteria 1194
156 Ga0265324_10268893 3300029957 Unclassified 579
157 Ga0265762_1080230 3300030760 Bacteria 698
158 Ga0265763_1021150 3300030763 Bacteria 685
159 Ga0265760_10011146 3300031090 Bacteria 2569
160 Ga0265330_10000017 3300031235 Bacteria 166302
161 Ga0265332_10000249 3300031238 Bacteria 43066
162 Ga0265328_10000075 3300031239 Bacteria 52301
163 Ga0265328_10003239 3300031239 Bacteria 7216
164 Ga0265320_10000005 3300031240 Bacteria 354422
165 Ga0265325_10007195 3300031241 Bacteria 6692
166 Ga0265325_10018919 3300031241 Bacteria 3815
167 Ga0265329_10006371 3300031242 Bacteria 4685
168 Ga0265340_10027984 3300031247 Bacteria 2838
169 Ga0265340_10156842 3300031247 Bacteria 1036
170 Ga0265339_10014338 3300031249 Bacteria 4778
171 Ga0265339_10084638 3300031249 Bacteria 1671
172 Ga0265339_10200959 3300031249 Bacteria 983
173 Ga0265331_10000013 3300031250 Bacteria 296011
174 Ga0265331_10115879 3300031250 Bacteria 1227
175 Ga0265331_10354834 3300031250 Bacteria 657
176 Ga0265316_10007252 3300031344 Bacteria 10472
177 Ga0265316_10011048 3300031344 Bacteria 8181
178 Ga0265316_10028616 3300031344 Bacteria 4594
179 Ga0265316_10347634 3300031344 Unclassified 1074
180 Ga0307513_10003220 3300031456 Bacteria 22271
181 Ga0307513_10003325 3300031456 Bacteria 21887
182 Ga0307513_10771285 3300031456 Bacteria 667
183 Ga0265313_10000809 3300031595 Bacteria 31583
184 Ga0265313_10072401 3300031595 Unclassified 1584
185 Ga0265313_10164408 3300031595 Unclassified 941
186 Ga0307514_10013324 3300031649 Bacteria 6822
187 Ga0265314_10000024 3300031711 Bacteria 295216
188 Ga0265342_10018365 3300031712 Bacteria 4532
189 Ga0265342_10372104 3300031712 Bacteria 741
190 Ga0307414_11447225 3300032004 Bacteria 639
191 Ga0373923_0183539 3300035111 Bacteria 962
192 Ga0373953_0088955 3300035117 Bacteria 1290
193 Ga0373954_0245862 3300035118 Bacteria 880
194 Ga0373957_0105574 3300035120 Bacteria 1131
195 Ga0373957_0273014 3300035120 Unclassified 714
196 Ga0373924_0254028 3300035410 Bacteria 778
197 Ga0373927_0000072 3300035695 Bacteria 73717
198 Ga0373933_0002118 3300035724 Bacteria 11400
199 Ga0373933_0389504 3300035724 Unclassified 908
200 Ga0373937_0001506 3300036401 Bacteria 19564
201 Ga0373937_0052574 3300036401 Plasmid 3735
202 Ga0373925_0018090 3300037068 Bacteria 5118
203 Ga0436364_0009932 3300037853 Unclassified 861
204 Ga0436364_0022146 3300037853 Unclassified 548
205 Ga0436364_0280617 3300037853 Bacteria 2798
206 Ga0436364_0537517 3300037853 Plasmid 2814
207 Ga0436364_0690966 3300037853 Unclassified 1387
208 Ga0436364_1073147 3300037853 Bacteria 4396
209 Ga0436365_0371398 3300039437 Bacteria 1490
210 Ga0436365_1612656 3300039437 Unclassified 1884
211 Ga0436360_0876030 3300039438 Unclassified 1880
212 Ga0436361_0014990 3300039447 Bacteria 2325
213 Ga0436361_0373700 3300039447 Bacteria 30841
214 Ga0436361_0555756 3300039447 Bacteria 895
215 Ga0436362_0010202 3300039453 Unclassified 1549
216 Ga0439465_0298617 3300041413 Unclassified 602
217 Ga0466961_0191132 3300044693 Bacteria 1269
218 Ga0466963_0783930 3300044694 Bacteria 672
219 Ga0466957_0666980 3300044842 Unclassified 732
220 Ga0495583_0082370 3300046506 Bacteria 1396
221 Ga0495606_0000992 3300046507 Bacteria 41375
222 Ga0495608_0330220 3300046511 Bacteria 941
223 Ga0495610_0082001 3300046512 Bacteria 1479
224 Ga0495618_0100011 3300046514 Bacteria 1856
225 Ga0495628_0100507 3300046516 Unclassified 2233
226 Ga0495643_0183928 3300046522 Bacteria 1014
227 Ga0495648_0128438 3300046524 Bacteria 1351
228 Ga0495652_0553860 3300046529 Bacteria 790
229 Ga0495587_0821761 3300046536 Unclassified 507
230 Ga0495667_0122322 3300046559 Bacteria 1680
231 Ga0495668_0078296 3300046616 Bacteria 1815
232 Ga0495634_0165043 3300046642 Bacteria 1394
233 Ga0495635_0266376 3300046663 Bacteria 1153
234 Ga0495600_0073866 3300046809 Bacteria 2227
235 Ga0495680_0154728 3300047322 Unclassified 1669
236 Ga0495680_0198772 3300047322 Bacteria 1439
237 Ga0496103_0373790 3300048906 Unclassified 916
238 Ga0496106_0026025 3300048909 Bacteria 4354
239 Ga0496112_0000059 3300048915 Bacteria 74946
240 Ga0496114_0454148 3300048917 Bacteria 1135
241 Ga0496117_0026817 3300048920 Bacteria 4501
242 Ga0496118_0002618 3300048921 Bacteria 23874
243 Ga0496119_0001037 3300048922 Bacteria 35545
244 Ga0496120_0000843 3300048923 Bacteria 43594
245 Ga0496121_0001522 3300048924 Bacteria 38904
246 Ga0496124_0002388 3300048927 Bacteria 24716
247 Ga0496125_0090729 3300048928 Bacteria 2292
248 Ga0496125_0141859 3300048928 Bacteria 1669
249 Ga0496125_0563186 3300048928 Unclassified 629
250 Ga0496126_0002018 3300048929 Bacteria 28703
251 Ga0496126_0011470 3300048929 Bacteria 9168
252 Ga0496126_0170593 3300048929 Bacteria 1854
253 Ga0501036_0269952 3300049572 Bacteria 1424
254 Ga0501040_0463673 3300049576 Unclassified 912
255 Ga0501047_0698180 3300049581 Unclassified 832
256 Ga0501073_0014308 3300049589 Bacteria 5764
257 Ga0501080_0010723 3300049742 Bacteria 8384
258 Ga0501083_0508840 3300049744 Bacteria 784
259 nmdc:mga0k408_223013_c1 3300050493 Bacteria 1125
260 nmdc:mga07m45_184651_c1 3300050496 Bacteria 1212
261 nmdc:mga0n895_2226060_c1 3300050512 Unclassified 503
262 nmdc:mga0a205_450536_c1 3300050515 Bacteria 1147
263 nmdc:mga0sz30_125225_c1 3300050516 Bacteria 1130
264 Ga0495601_0378297 3300053077 Bacteria 919
265 Ga0495595_0008003 3300053084 Bacteria 4329
266 Ga0495595_0691298 3300053084 Unclassified 523
267 Ga0495619_0015974 3300053085 Bacteria 4752
268 Ga0495619_0180476 3300053085 Bacteria 1460
269 Ga0500646_0093402 3300053090 Bacteria 935
270 Ga0500651_0147937 3300053093 Bacteria 1412
271 Ga0500569_206450 3300053109 Unclassified 668
272 Ga0500572_001893 3300053111 Bacteria 5272
273 Ga0500614_266196 3300053123 Unclassified 536
274 Ga0500568_0015830 3300053139 Bacteria 3366
275 Ga0500568_0120466 3300053139 Unclassified 978
276 Ga0500604_0107862 3300053151 Unclassified 923
277 Ga0500636_0471679 3300053177 Bacteria 562
278 Ga0500596_006335 3300053735 Unclassified 2013
279 Ga0501084_0210821 3300054114 Bacteria 1639
280 Ga0501082_1386217 3300060353 Unclassified 614

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053093 Ga0500651_0147937 Ga0500651_0147937_14_427 137
2 iso_pu_bacteria 2909042592 2909046761 138
3 3300014325 Ga0163163_10022248 Ga0163163_100222484 139
4 3300039437 Ga0436365_0371398 Ga0436365_0371398_826_1260 139
5 3300005330 Ga0070690_100559669 Ga0070690_1005596691 140
6 3300005340 Ga0070689_100000004 Ga0070689_100000004371 140
7 3300005365 Ga0070688_100146955 Ga0070688_1001469554 140
8 3300005983 Ga0081540_1102492 Ga0081540_11024923 140
9 3300009093 Ga0105240_10690269 Ga0105240_106902691 140
10 3300009093 Ga0105240_10838027 Ga0105240_108380272 140
11 3300009551 Ga0105238_10444370 Ga0105238_104443702 140
12 3300025913 Ga0207695_10471228 Ga0207695_104712282 140
13 3300025924 Ga0207694_10389810 Ga0207694_103898102 140
14 3300028556 Ga0265337_1204649 Ga0265337_12046491 140
15 3300028573 Ga0265334_10052129 Ga0265334_100521292 140
16 3300028577 Ga0265318_10000170 Ga0265318_1000017018 140
17 3300028577 Ga0265318_10016540 Ga0265318_100165405 140
18 3300028800 Ga0265338_10069091 Ga0265338_100690914 140
19 3300029957 Ga0265324_10268893 Ga0265324_102688931 140
20 3300031235 Ga0265330_10000017 Ga0265330_100000173 140
21 3300031238 Ga0265332_10000249 Ga0265332_1000024934 140
22 3300031239 Ga0265328_10000075 Ga0265328_1000007558 140
23 3300031239 Ga0265328_10003239 Ga0265328_100032398 140
24 3300031240 Ga0265320_10000005 Ga0265320_1000000534 140
25 3300031242 Ga0265329_10006371 Ga0265329_100063713 140
26 3300031250 Ga0265331_10000013 Ga0265331_10000013225 140
27 3300031250 Ga0265331_10354834 Ga0265331_103548341 140
28 3300031344 Ga0265316_10011048 Ga0265316_100110484 140
29 3300031595 Ga0265313_10000809 Ga0265313_100008092 140
30 3300031595 Ga0265313_10072401 Ga0265313_100724014 140
31 3300031595 Ga0265313_10164408 Ga0265313_101644082 140
32 3300031711 Ga0265314_10000024 Ga0265314_1000002435 140
33 3300031712 Ga0265342_10018365 Ga0265342_100183653 140
34 3300031712 Ga0265342_10372104 Ga0265342_103721041 140
35 3300046511 Ga0495608_0330220 Ga0495608_0330220_97_519 140
36 3300046514 Ga0495618_0100011 Ga0495618_0100011_201_623 140
37 3300046516 Ga0495628_0100507 Ga0495628_0100507_589_1011 140
38 3300046529 Ga0495652_0553860 Ga0495652_0553860_237_659 140
39 3300046536 Ga0495587_0821761 Ga0495587_0821761_24_446 140
40 3300046663 Ga0495635_0266376 Ga0495635_0266376_144_566 140
41 3300046809 Ga0495600_0073866 Ga0495600_0073866_1627_2049 140
42 3300047322 Ga0495680_0154728 Ga0495680_0154728_844_1266 140
43 3300053084 Ga0495595_0008003 Ga0495595_0008003_3127_3549 140
44 3300053085 Ga0495619_0015974 Ga0495619_0015974_2936_3358 140
45 3300053123 Ga0500614_266196 Ga0500614_266196_104_526 140
46 3300003215 JGI25153J46596_10001821 JGI25153J46596_1000182111 141
47 3300005548 Ga0070665_100005590 Ga0070665_1000055909 141
48 3300005578 Ga0068854_100905636 Ga0068854_1009056362 141
49 3300006173 Ga0070716_100002966 Ga0070716_1000029663 141
50 3300009545 Ga0105237_10205110 Ga0105237_102051102 141
51 3300009553 Ga0105249_10085652 Ga0105249_100856524 141
52 3300010375 Ga0105239_10071485 Ga0105239_100714853 141
53 3300021388 Ga0213875_10028488 Ga0213875_100284884 141
54 3300025258 Ga0209129_1034676 Ga0209129_10346762 141
55 3300025294 Ga0209025_1000325 Ga0209025_100032541 141
56 3300025297 Ga0209758_1000204 Ga0209758_1000204103 141
57 3300025914 Ga0207671_10099043 Ga0207671_100990432 141
58 3300025914 Ga0207671_10122713 Ga0207671_101227132 141
59 3300025939 Ga0207665_10062040 Ga0207665_100620404 141
60 3300026067 Ga0207678_10268059 Ga0207678_102680592 141
61 3300028379 Ga0268266_10057853 Ga0268266_100578533 141
62 3300028800 Ga0265338_10289303 Ga0265338_102893033 141
63 3300031344 Ga0265316_10347634 Ga0265316_103476341 141
64 3300035120 Ga0373957_0273014 Ga0373957_0273014_159_587 141
65 3300035724 Ga0373933_0389504 Ga0373933_0389504_347_775 141
66 3300037853 Ga0436364_1073147 Ga0436364_1073147_190_615 141
67 3300048922 Ga0496119_0001037 Ga0496119_0001037_2586_3014 141
68 3300048923 Ga0496120_0000843 Ga0496120_0000843_33290_33718 141
69 3300048928 Ga0496125_0141859 Ga0496125_0141859_518_952 141
70 3300049589 Ga0501073_0014308 Ga0501073_0014308_1738_2163 141
71 3300049742 Ga0501080_0010723 Ga0501080_0010723_4057_4482 141
72 iso_pu_bacteria 2904541872 2904548950 141
73 iso_pu_bacteria 2929160207 2929160931 141
74 3300005345 Ga0070692_10014645 Ga0070692_100146454 142
75 3300005347 Ga0070668_101371547 Ga0070668_1013715471 142
76 3300005548 Ga0070665_100638339 Ga0070665_1006383392 142
77 3300006048 Ga0075363_100147322 Ga0075363_1001473222 142
78 3300006177 Ga0075362_10065116 Ga0075362_100651162 142
79 3300006186 Ga0075369_10096078 Ga0075369_100960782 142
80 3300006195 Ga0075366_10423131 Ga0075366_104231312 142
81 3300006353 Ga0075370_10080558 Ga0075370_100805582 142
82 3300007788 Ga0099795_10094746 Ga0099795_100947463 142
83 3300009148 Ga0105243_11204847 Ga0105243_112048472 142
84 3300014968 Ga0157379_12664334 Ga0157379_126643341 142
85 3300021388 Ga0213875_10539454 Ga0213875_105394542 142
86 3300028379 Ga0268266_10469397 Ga0268266_104693972 142
87 3300028573 Ga0265334_10071155 Ga0265334_100711553 142
88 3300028577 Ga0265318_10029323 Ga0265318_100293234 142
89 3300028800 Ga0265338_10251103 Ga0265338_102511032 142
90 3300030763 Ga0265763_1021150 Ga0265763_10211501 142
91 3300031241 Ga0265325_10018919 Ga0265325_100189193 142
92 3300031249 Ga0265339_10014338 Ga0265339_100143383 142
93 3300031250 Ga0265331_10115879 Ga0265331_101158793 142
94 3300031344 Ga0265316_10028616 Ga0265316_100286163 142
95 3300031649 Ga0307514_10013324 Ga0307514_100133242 142
96 3300037853 Ga0436364_0690966 Ga0436364_0690966_222_653 142
97 3300049581 Ga0501047_0698180 Ga0501047_0698180_277_705 142
98 3300050493 nmdc:mga0k408_223013_c1 nmdc:mga0k408_223013_c1_314_742 142
99 3300050496 nmdc:mga07m45_184651_c1 nmdc:mga07m45_184651_c1_100_528 142
100 3300050512 nmdc:mga0n895_2226060_c1 nmdc:mga0n895_2226060_c1_17_445 142
101 3300050516 nmdc:mga0sz30_125225_c1 nmdc:mga0sz30_125225_c1_525_953 142
102 3300053139 Ga0500568_0120466 Ga0500568_0120466_359_787 142
103 3300053151 Ga0500604_0107862 Ga0500604_0107862_337_765 142
104 3300003203 JGI25406J46586_10004496 JGI25406J46586_100044963 143
105 3300003203 JGI25406J46586_10013538 JGI25406J46586_100135384 143
106 3300003316 rootH1_10016292 rootH1_1001629211 143
107 3300003322 rootL2_10016825 rootL2_100168253 143
108 3300003322 rootL2_10027282 rootL2_1002728216 143
109 3300005331 Ga0070670_100108899 Ga0070670_1001088992 143
110 3300005335 Ga0070666_10012775 Ga0070666_100127754 143
111 3300005336 Ga0070680_100537578 Ga0070680_1005375781 143
112 3300005355 Ga0070671_100405575 Ga0070671_1004055752 143
113 3300005445 Ga0070708_101347198 Ga0070708_1013471981 143
114 3300005456 Ga0070678_100042980 Ga0070678_1000429803 143
115 3300005456 Ga0070678_100226078 Ga0070678_1002260783 143
116 3300005458 Ga0070681_10028534 Ga0070681_100285344 143
117 3300005466 Ga0070685_10093488 Ga0070685_100934882 143
118 3300005535 Ga0070684_100046985 Ga0070684_1000469854 143
119 3300005535 Ga0070684_100143335 Ga0070684_1001433353 143
120 3300005539 Ga0068853_100090724 Ga0068853_1000907243 143
121 3300005539 Ga0068853_100386031 Ga0068853_1003860312 143
122 3300005539 Ga0068853_101479547 Ga0068853_1014795471 143
123 3300005544 Ga0070686_100479605 Ga0070686_1004796051 143
124 3300005548 Ga0070665_100199791 Ga0070665_1001997912 143
125 3300005548 Ga0070665_100287847 Ga0070665_1002878471 143
126 3300005564 Ga0070664_100636371 Ga0070664_1006363712 143
127 3300005616 Ga0068852_100171836 Ga0068852_1001718362 143
128 3300005841 Ga0068863_100128687 Ga0068863_1001286873 143
129 3300005841 Ga0068863_100484014 Ga0068863_1004840141 143
130 3300005843 Ga0068860_100691432 Ga0068860_1006914321 143
131 3300005843 Ga0068860_101177992 Ga0068860_1011779921 143
132 3300005937 Ga0081455_10000463 Ga0081455_1000046312 143
133 3300005985 Ga0081539_10001091 Ga0081539_100010919 143
134 3300005985 Ga0081539_10001513 Ga0081539_1000151326 143
135 3300005985 Ga0081539_10084293 Ga0081539_100842933 143
136 3300006163 Ga0070715_10275805 Ga0070715_102758052 143
137 3300006186 Ga0075369_10368252 Ga0075369_103682522 143
138 3300006852 Ga0075433_10179259 Ga0075433_101792592 143
139 3300007265 Ga0099794_10146977 Ga0099794_101469772 143
140 3300007788 Ga0099795_10000999 Ga0099795_100009995 143
141 3300009093 Ga0105240_10001494 Ga0105240_1000149412 143
142 3300009093 Ga0105240_10003957 Ga0105240_1000395710 143
143 3300009093 Ga0105240_10102240 Ga0105240_101022405 143
144 3300009093 Ga0105240_10212908 Ga0105240_102129083 143
145 3300009093 Ga0105240_10770475 Ga0105240_107704752 143
146 3300009101 Ga0105247_10425974 Ga0105247_104259742 143
147 3300009174 Ga0105241_10920652 Ga0105241_109206522 143
148 3300009177 Ga0105248_10652037 Ga0105248_106520371 143
149 3300009545 Ga0105237_10001159 Ga0105237_1000115912 143
150 3300009545 Ga0105237_10090916 Ga0105237_100909166 143
151 3300009545 Ga0105237_11035372 Ga0105237_110353722 143
152 3300009545 Ga0105237_11093048 Ga0105237_110930482 143
153 3300009551 Ga0105238_10006892 Ga0105238_100068924 143
154 3300009551 Ga0105238_10055859 Ga0105238_100558592 143
155 3300009553 Ga0105249_11772740 Ga0105249_117727401 143
156 3300010159 Ga0099796_10000518 Ga0099796_100005186 143
157 3300010159 Ga0099796_10026021 Ga0099796_100260212 143
158 3300010159 Ga0099796_10130454 Ga0099796_101304542 143
159 3300010159 Ga0099796_10198076 Ga0099796_101980762 143
160 3300010375 Ga0105239_10003776 Ga0105239_100037765 143
161 3300010375 Ga0105239_10162142 Ga0105239_101621423 143
162 3300010375 Ga0105239_10685801 Ga0105239_106858012 143
163 3300013105 Ga0157369_10135960 Ga0157369_101359603 143
164 3300013105 Ga0157369_10180456 Ga0157369_101804562 143
165 3300013105 Ga0157369_10332678 Ga0157369_103326782 143
166 3300013105 Ga0157369_11361065 Ga0157369_113610652 143
167 3300013307 Ga0157372_10090289 Ga0157372_100902893 143
168 3300014968 Ga0157379_10181238 Ga0157379_101812384 143
169 3300014968 Ga0157379_10265954 Ga0157379_102659542 143
170 3300021377 Ga0213874_10175411 Ga0213874_101754111 143
171 3300021388 Ga0213875_10108831 Ga0213875_101088313 143
172 3300024227 Ga0228598_1046001 Ga0228598_10460012 143
173 3300025900 Ga0207710_10478710 Ga0207710_104787101 143
174 3300025903 Ga0207680_10064144 Ga0207680_100641442 143
175 3300025905 Ga0207685_10191254 Ga0207685_101912542 143
176 3300025911 Ga0207654_10878260 Ga0207654_108782601 143
177 3300025912 Ga0207707_10058721 Ga0207707_100587213 143
178 3300025913 Ga0207695_10002185 Ga0207695_1000218512 143
179 3300025913 Ga0207695_10006094 Ga0207695_100060948 143
180 3300025913 Ga0207695_10104270 Ga0207695_101042704 143
181 3300025913 Ga0207695_10175918 Ga0207695_101759182 143
182 3300025914 Ga0207671_10006050 Ga0207671_100060505 143
183 3300025914 Ga0207671_10126683 Ga0207671_101266833 143
184 3300025914 Ga0207671_10354692 Ga0207671_103546922 143
185 3300025917 Ga0207660_10442888 Ga0207660_104428882 143
186 3300025924 Ga0207694_10035096 Ga0207694_100350963 143
187 3300025924 Ga0207694_10342520 Ga0207694_103425201 143
188 3300025925 Ga0207650_10565477 Ga0207650_105654772 143
189 3300025933 Ga0207706_10715193 Ga0207706_107151932 143
190 3300025941 Ga0207711_10600414 Ga0207711_106004141 143
191 3300025944 Ga0207661_10287361 Ga0207661_102873613 143
192 3300025945 Ga0207679_10541185 Ga0207679_105411851 143
193 3300026023 Ga0207677_10434899 Ga0207677_104348991 143
194 3300026035 Ga0207703_10335236 Ga0207703_103352362 143
195 3300026035 Ga0207703_11038141 Ga0207703_110381412 143
196 3300026041 Ga0207639_10071359 Ga0207639_100713593 143
197 3300026088 Ga0207641_10112184 Ga0207641_101121842 143
198 3300026088 Ga0207641_10574446 Ga0207641_105744462 143
199 3300026121 Ga0207683_10064061 Ga0207683_100640613 143
200 3300026121 Ga0207683_10139652 Ga0207683_101396522 143
201 3300027512 Ga0209179_1071995 Ga0209179_10719951 143
202 3300027671 Ga0209588_1065360 Ga0209588_10653602 143
203 3300028379 Ga0268266_10113341 Ga0268266_101133412 143
204 3300028379 Ga0268266_10235974 Ga0268266_102359741 143
205 3300028381 Ga0268264_11018966 Ga0268264_110189662 143
206 3300028577 Ga0265318_10061303 Ga0265318_100613032 143
207 3300028794 Ga0307515_10132188 Ga0307515_101321882 143
208 3300028794 Ga0307515_10202347 Ga0307515_102023472 143
209 3300028800 Ga0265338_10033652 Ga0265338_100336523 143
210 3300030760 Ga0265762_1080230 Ga0265762_10802302 143
211 3300031090 Ga0265760_10011146 Ga0265760_100111464 143
212 3300031241 Ga0265325_10007195 Ga0265325_1000719512 143
213 3300031247 Ga0265340_10027984 Ga0265340_100279842 143
214 3300031247 Ga0265340_10156842 Ga0265340_101568422 143
215 3300031249 Ga0265339_10084638 Ga0265339_100846382 143
216 3300031249 Ga0265339_10200959 Ga0265339_102009592 143
217 3300031344 Ga0265316_10007252 Ga0265316_1000725212 143
218 3300031456 Ga0307513_10003220 Ga0307513_1000322026 143
219 3300031456 Ga0307513_10003325 Ga0307513_100033253 143
220 3300031456 Ga0307513_10771285 Ga0307513_107712852 143
221 3300032004 Ga0307414_11447225 Ga0307414_114472251 143
222 3300035111 Ga0373923_0183539 Ga0373923_0183539_195_632 143
223 3300035117 Ga0373953_0088955 Ga0373953_0088955_444_881 143
224 3300035118 Ga0373954_0245862 Ga0373954_0245862_364_801 143
225 3300035120 Ga0373957_0105574 Ga0373957_0105574_543_980 143
226 3300035410 Ga0373924_0254028 Ga0373924_0254028_112_549 143
227 3300035695 Ga0373927_0000072 Ga0373927_0000072_4234_4665 143
228 3300035724 Ga0373933_0002118 Ga0373933_0002118_9233_9670 143
229 3300036401 Ga0373937_0001506 Ga0373937_0001506_7245_7682 143
230 3300036401 Ga0373937_0052574 Ga0373937_0052574_2679_3116 143
231 3300037068 Ga0373925_0018090 Ga0373925_0018090_1299_1730 143
232 3300037853 Ga0436364_0009932 Ga0436364_0009932_161_598 143
233 3300037853 Ga0436364_0022146 Ga0436364_0022146_57_494 143
234 3300037853 Ga0436364_0280617 Ga0436364_0280617_1278_1715 143
235 3300037853 Ga0436364_0537517 Ga0436364_0537517_99_536 143
236 3300039437 Ga0436365_1612656 Ga0436365_1612656_351_788 143
237 3300039438 Ga0436360_0876030 Ga0436360_0876030_950_1381 143
238 3300039447 Ga0436361_0014990 Ga0436361_0014990_982_1428 143
239 3300039447 Ga0436361_0373700 Ga0436361_0373700_14291_14755 143
240 3300039447 Ga0436361_0555756 Ga0436361_0555756_67_510 143
241 3300039453 Ga0436362_0010202 Ga0436362_0010202_273_710 143
242 3300041413 Ga0439465_0298617 Ga0439465_0298617_103_543 143
243 3300044693 Ga0466961_0191132 Ga0466961_0191132_159_605 143
244 3300044694 Ga0466963_0783930 Ga0466963_0783930_14_460 143
245 3300044842 Ga0466957_0666980 Ga0466957_0666980_141_587 143
246 3300046506 Ga0495583_0082370 Ga0495583_0082370_125_568 143
247 3300046507 Ga0495606_0000992 Ga0495606_0000992_25440_25877 143
248 3300046512 Ga0495610_0082001 Ga0495610_0082001_483_920 143
249 3300046522 Ga0495643_0183928 Ga0495643_0183928_314_760 143
250 3300046524 Ga0495648_0128438 Ga0495648_0128438_101_535 143
251 3300046559 Ga0495667_0122322 Ga0495667_0122322_849_1286 143
252 3300046616 Ga0495668_0078296 Ga0495668_0078296_1255_1692 143
253 3300046642 Ga0495634_0165043 Ga0495634_0165043_727_1230 143
254 3300047322 Ga0495680_0198772 Ga0495680_0198772_678_1115 143
255 3300048906 Ga0496103_0373790 Ga0496103_0373790_82_525 143
256 3300048909 Ga0496106_0026025 Ga0496106_0026025_2361_2804 143
257 3300048915 Ga0496112_0000059 Ga0496112_0000059_51214_51657 143
258 3300048917 Ga0496114_0454148 Ga0496114_0454148_193_627 143
259 3300048920 Ga0496117_0026817 Ga0496117_0026817_2856_3299 143
260 3300048921 Ga0496118_0002618 Ga0496118_0002618_1253_1696 143
261 3300048924 Ga0496121_0001522 Ga0496121_0001522_1368_1811 143
262 3300048927 Ga0496124_0002388 Ga0496124_0002388_1075_1518 143
263 3300048928 Ga0496125_0090729 Ga0496125_0090729_405_848 143
264 3300048928 Ga0496125_0563186 Ga0496125_0563186_161_613 143
265 3300048929 Ga0496126_0002018 Ga0496126_0002018_3289_3741 143
266 3300048929 Ga0496126_0011470 Ga0496126_0011470_7409_7852 143
267 3300048929 Ga0496126_0170593 Ga0496126_0170593_397_849 143
268 3300049572 Ga0501036_0269952 Ga0501036_0269952_558_998 143
269 3300049576 Ga0501040_0463673 Ga0501040_0463673_424_864 143
270 3300049744 Ga0501083_0508840 Ga0501083_0508840_165_605 143
271 3300050515 nmdc:mga0a205_450536_c1 nmdc:mga0a205_450536_c1_480_917 143
272 3300053077 Ga0495601_0378297 Ga0495601_0378297_19_456 143
273 3300053084 Ga0495595_0691298 Ga0495595_0691298_66_503 143
274 3300053085 Ga0495619_0180476 Ga0495619_0180476_802_1239 143
275 3300053090 Ga0500646_0093402 Ga0500646_0093402_186_617 143
276 3300053109 Ga0500569_206450 Ga0500569_206450_38_484 143
277 3300053111 Ga0500572_001893 Ga0500572_001893_3212_3649 143
278 3300053139 Ga0500568_0015830 Ga0500568_0015830_567_1004 143
279 3300053177 Ga0500636_0471679 Ga0500636_0471679_25_486 143
280 3300053735 Ga0500596_006335 Ga0500596_006335_159_596 143
281 3300054114 Ga0501084_0210821 Ga0501084_0210821_685_1125 143
282 3300060353 Ga0501082_1386217 Ga0501082_1386217_19_465 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

3

134

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1c-assembly1.cif.gz_A crystal structure of fitacb from neisseria gonorrhoeae 0.9255 4 140
2h1o-assembly1.cif.gz_A structure of fitab bound to ir36 dna fragment 0.9077 4 143
2h1c-assembly1.cif.gz_A crystal structure of fitacb from neisseria gonorrhoeae 0.9068 4 140
6ifm-assembly1.cif.gz_C crystal structure of dna bound vapbc from salmonella typhimurium 0.8238 1 136
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.8123 1 138
ID Description Score Start End Superfamily
af_P9WF99_2_82_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9187 5 74 3.40.50.1010
2bsqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9077 4 143 3.40.50.1010
2bsqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8841 4 143 3.40.50.1010
af_F1R507_266_328_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8365 83 112 1.10.8.60
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8104 4 137 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A2N9N9E7-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 1.001 3 139 GO:0000287
GO:0004540
GO:0090729
AF-T1CAQ3-F1-model_v4 PilT domain-containing protein 0.9984 24 142 GO:0004518
GO:0046872
AF-A0A2M8R1R2-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9935 3 139 GO:0000287
GO:0004540
GO:0090729
AF-A0A6B0WDR3-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9896 38 141 GO:0004518
GO:0046872
AF-A0A6N6T1W5-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9832 3 139 GO:0000287
GO:0004540
GO:0090729

Feature Viewer

pLDDT pTM Quality
96.17 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map