F385041

General Info

Members Datasets Scaffolds Average Seq Length
282 129 269 108

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_11765456|Ga0307412_117654562
Length 116
Sequence MREFSDQFSLAELEKIVAERGLSGDSGSWTAKLFAGGMDKAAKKLGEEAVETVIAAVGGDKKALVSESADLLYHWLVVLALAGVPLSEVIGELERRTGQSGLAEKASRAKPDHGPG

Samples

Sample ID Description Type Environment
1 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
2 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
3 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
4 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
5 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
6 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
7 2738543024 Aminobacter sp. AP02 Isolate Unclassified
8 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
9 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
10 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
11 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
12 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
78 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
79 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
80 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
81 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
84 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
104 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
105 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
106 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
107 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
108 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
109 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
110 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
122 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
123 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
124 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
125 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
126 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
129 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.39
Metatranscriptomes 0
Isolates 4.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.87
Nodule 0.35
Rhizoplane 1.06
Rhizosphere 86.17
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1032256 3300002741 Bacteria 595
2 JGI25153J46596_10038732 3300003215 Bacteria 1498
3 rootL2_10149262 3300003322 Bacteria 1111
4 Ga0055530_10001146 3300003791 Bacteria 20621
5 Ga0055531_10010271 3300003794 Bacteria 4676
6 Ga0055531_10021117 3300003794 Bacteria 2542
7 Ga0055543_1012004 3300004625 Bacteria 1754
8 Ga0065165_1001756 3300005262 Bacteria 21578
9 Ga0065165_1014791 3300005262 Bacteria 3012
10 Ga0070680_100870061 3300005336 Bacteria 777
11 Ga0070668_101342080 3300005347 Bacteria 651
12 Ga0070659_100223133 3300005366 Bacteria 1556
13 Ga0070667_101113719 3300005367 Bacteria 738
14 Ga0070681_11218151 3300005458 Bacteria 675
15 Ga0070679_101038856 3300005530 Bacteria 764
16 Ga0070684_101316074 3300005535 Bacteria 680
17 Ga0068853_101293186 3300005539 Bacteria 705
18 Ga0070665_100059029 3300005548 Bacteria 3845
19 Ga0070665_100420255 3300005548 Bacteria 1346
20 Ga0070664_101163522 3300005564 Bacteria 727
21 Ga0070702_101191970 3300005615 Bacteria 613
22 Ga0068859_102684905 3300005617 Bacteria 547
23 Ga0075365_10108285 3300006038 Bacteria 1908
24 Ga0075362_10203621 3300006177 Bacteria 964
25 Ga0075370_10264305 3300006353 Bacteria 1021
26 Ga0097620_102684499 3300006931 Bacteria 547
27 Ga0105240_10623651 3300009093 Bacteria 1185
28 Ga0111539_10996812 3300009094 Bacteria 974
29 Ga0105241_10398727 3300009174 Bacteria 1206
30 Ga0105242_10682064 3300009176 Bacteria 1003
31 Ga0105248_11052713 3300009177 Bacteria 919
32 Ga0105237_10680220 3300009545 Bacteria 1036
33 Ga0105238_10082111 3300009551 Bacteria 3213
34 Ga0105238_10685916 3300009551 Bacteria 1036
35 Ga0105246_12201096 3300011119 Bacteria 536
36 Ga0157373_11077039 3300013100 Bacteria 602
37 Ga0157370_10803109 3300013104 Bacteria 856
38 Ga0157369_11827487 3300013105 Bacteria 617
39 Ga0157374_12457616 3300013296 Bacteria 548
40 Ga0157372_11875849 3300013307 Bacteria 689
41 Ga0163163_12110319 3300014325 Bacteria 623
42 Ga0157380_10591954 3300014326 Bacteria 1096
43 Ga0157380_11671661 3300014326 Bacteria 694
44 Ga0157379_11948682 3300014968 Bacteria 580
45 Ga0209026_1006675 3300025250 Bacteria 2774
46 Ga0209758_1002904 3300025297 Bacteria 16541
47 Ga0209050_1000053 3300025298 Bacteria 349521
48 Ga0209257_1000419 3300025304 Bacteria 81956
49 Ga0209257_1009287 3300025304 Bacteria 5312
50 Ga0207647_10195292 3300025904 Bacteria 1172
51 Ga0207654_10622716 3300025911 Bacteria 771
52 Ga0207707_10580987 3300025912 Bacteria 950
53 Ga0207694_10009138 3300025924 Bacteria 7481
54 Ga0207669_11341614 3300025937 Bacteria 608
55 Ga0207704_10911556 3300025938 Bacteria 739
56 Ga0207658_10642053 3300025986 Bacteria 956
57 Ga0207658_11153177 3300025986 Bacteria 708
58 Ga0207678_10848242 3300026067 Bacteria 807
59 Ga0207683_11358386 3300026121 Bacteria 657
60 Ga0207698_10481767 3300026142 Bacteria 1204
61 Ga0268266_10045861 3300028379 Bacteria 3741
62 Ga0307511_10062782 3300030521 Bacteria 2815
63 Ga0307408_100726909 3300031548 Bacteria 895
64 Ga0307413_10822165 3300031824 Bacteria 783
65 Ga0307413_12148365 3300031824 Bacteria 506
66 Ga0307407_10701839 3300031903 Bacteria 762
67 Ga0307412_10828086 3300031911 Bacteria 806
68 Ga0307412_11385444 3300031911 Bacteria 636
69 Ga0307412_11765456 3300031911 Bacteria 568
70 Ga0307412_11955213 3300031911 Bacteria 542
71 Ga0307416_100685253 3300032002 Bacteria 1113
72 Ga0307416_102797020 3300032002 Bacteria 584
73 Ga0307414_10980492 3300032004 Bacteria 777
74 Ga0307414_11139448 3300032004 Bacteria 721
75 Ga0307414_12194247 3300032004 Bacteria 516
76 Ga0307411_10825670 3300032005 Bacteria 818
77 Ga0395905_0525174 3300037471 Bacteria 1084
78 Ga0395905_1011685 3300037471 Bacteria 734
79 Ga0395901_1047884 3300038443 Bacteria 789
80 Ga0439436_0064919 3300041404 Bacteria 1020
81 Ga0439465_0025473 3300041413 Bacteria 1867
82 Ga0439465_0095805 3300041413 Bacteria 1020
83 Ga0451797_0795482 3300041453 Bacteria 932
84 Ga0439445_0053193 3300042004 Bacteria 1097
85 Ga0439449_0045226 3300042007 Bacteria 1632
86 Ga0453684_1567416 3300044712 Bacteria 677
87 Ga0495643_0304232 3300046522 Bacteria 725
88 Ga0495621_0257585 3300046539 Bacteria 714
89 Ga0495668_0034664 3300046616 Bacteria 2830
90 Ga0495668_0096779 3300046616 Bacteria 1615
91 Ga0495625_0068174 3300046660 Bacteria 2502
92 Ga0495686_0021718 3300047472 Bacteria 4257
93 Ga0495686_0035368 3300047472 Bacteria 3212
94 Ga0495686_0550053 3300047472 Bacteria 603
95 Ga0496101_0723213 3300048904 Bacteria 786
96 Ga0501031_0000002 3300049568 Bacteria 217588
97 Ga0501031_0003364 3300049568 Bacteria 10275
98 Ga0501031_0032716 3300049568 Bacteria 3391
99 Ga0501031_0403144 3300049568 Bacteria 884
100 Ga0501031_0449855 3300049568 Bacteria 832
101 Ga0501032_0000001 3300049569 Bacteria 422097
102 Ga0501032_0000004 3300049569 Bacteria 310855
103 Ga0501032_0001391 3300049569 Bacteria 19212
104 Ga0501032_0019524 3300049569 Bacteria 4740
105 Ga0501032_0019602 3300049569 Bacteria 4728
106 Ga0501032_0076741 3300049569 Bacteria 2225
107 Ga0501032_0079708 3300049569 Bacteria 2180
108 Ga0501032_0662764 3300049569 Bacteria 662
109 Ga0501032_0762128 3300049569 Bacteria 612
110 Ga0501033_0000016 3300049570 Bacteria 217458
111 Ga0501033_0000275 3300049570 Bacteria 49587
112 Ga0501033_0000304 3300049570 Bacteria 46485
113 Ga0501033_0004330 3300049570 Bacteria 11389
114 Ga0501033_0026069 3300049570 Bacteria 4400
115 Ga0501033_0034104 3300049570 Bacteria 3819
116 Ga0501033_0051113 3300049570 Bacteria 3063
117 Ga0501033_0111375 3300049570 Bacteria 1992
118 Ga0501034_0000011 3300049571 Bacteria 310855
119 Ga0501034_0002200 3300049571 Bacteria 24125
120 Ga0501034_0023386 3300049571 Bacteria 6297
121 Ga0501034_0025415 3300049571 Bacteria 6028
122 Ga0501034_0073201 3300049571 Bacteria 3435
123 Ga0501034_0101060 3300049571 Bacteria 2877
124 Ga0501034_0667637 3300049571 Bacteria 940
125 Ga0501036_0000001 3300049572 Bacteria 310855
126 Ga0501036_0000358 3300049572 Bacteria 32271
127 Ga0501036_0017283 3300049572 Bacteria 6028
128 Ga0501036_0062659 3300049572 Bacteria 3150
129 Ga0501036_0074161 3300049572 Bacteria 2877
130 Ga0501036_0735824 3300049572 Bacteria 814
131 Ga0501037_0000006 3300049573 Bacteria 217461
132 Ga0501037_0000091 3300049573 Bacteria 84811
133 Ga0501037_0000154 3300049573 Bacteria 64077
134 Ga0501037_0012627 3300049573 Bacteria 6223
135 Ga0501037_0020091 3300049573 Bacteria 4930
136 Ga0501037_0052023 3300049573 Bacteria 2996
137 Ga0501037_0079519 3300049573 Bacteria 2380
138 Ga0501037_0157533 3300049573 Bacteria 1620
139 Ga0501038_0000003 3300049574 Bacteria 310855
140 Ga0501038_0003916 3300049574 Bacteria 13845
141 Ga0501038_0021125 3300049574 Bacteria 5848
142 Ga0501038_0029504 3300049574 Bacteria 4859
143 Ga0501038_0033096 3300049574 Bacteria 4554
144 Ga0501038_0117117 3300049574 Bacteria 2201
145 Ga0501038_0143283 3300049574 Bacteria 1953
146 Ga0501038_0188067 3300049574 Bacteria 1663
147 Ga0501038_0893803 3300049574 Bacteria 656
148 Ga0501038_0989648 3300049574 Bacteria 618
149 Ga0501039_0000004 3300049575 Bacteria 310855
150 Ga0501039_0000011 3300049575 Bacteria 245124
151 Ga0501039_0149148 3300049575 Bacteria 1837
152 Ga0501039_0264676 3300049575 Bacteria 1351
153 Ga0501039_0684019 3300049575 Bacteria 803
154 Ga0501040_0029238 3300049576 Bacteria 3719
155 Ga0501042_0056204 3300049578 Bacteria 2808
156 Ga0501043_0000007 3300049579 Bacteria 224595
157 Ga0501043_0000016 3300049579 Bacteria 170869
158 Ga0501043_0000765 3300049579 Bacteria 28587
159 Ga0501043_0084093 3300049579 Bacteria 2501
160 Ga0501043_0235389 3300049579 Bacteria 1413
161 Ga0501043_0380999 3300049579 Bacteria 1068
162 Ga0501043_0691300 3300049579 Bacteria 746
163 Ga0501043_0859670 3300049579 Bacteria 653
164 Ga0501046_0062502 3300049580 Bacteria 2909
165 Ga0501046_0157742 3300049580 Bacteria 1708
166 Ga0501046_0679678 3300049580 Bacteria 726
167 Ga0501046_1271966 3300049580 Bacteria 503
168 Ga0501047_0000740 3300049581 Bacteria 34045
169 Ga0501047_0008050 3300049581 Bacteria 9947
170 Ga0501047_0022665 3300049581 Bacteria 6028
171 Ga0501047_0036656 3300049581 Bacteria 4740
172 Ga0501047_0119122 3300049581 Bacteria 2522
173 Ga0501047_0122110 3300049581 Bacteria 2486
174 Ga0501047_0143528 3300049581 Bacteria 2265
175 Ga0501047_0299407 3300049581 Bacteria 1451
176 Ga0501047_0314309 3300049581 Bacteria 1407
177 Ga0501047_0389838 3300049581 Bacteria 1226
178 Ga0501047_0402331 3300049581 Bacteria 1202
179 Ga0501047_0489511 3300049581 Bacteria 1057
180 Ga0501047_0706165 3300049581 Bacteria 826
181 Ga0501048_0454992 3300049582 Bacteria 917
182 Ga0501048_0743496 3300049582 Bacteria 704
183 Ga0501067_0108436 3300049583 Bacteria 1544
184 Ga0501067_0129477 3300049583 Bacteria 1404
185 Ga0501067_0527991 3300049583 Bacteria 661
186 Ga0501068_0005949 3300049584 Bacteria 6695
187 Ga0501068_0270779 3300049584 Bacteria 1084
188 Ga0501069_0000027 3300049585 Bacteria 106217
189 Ga0501069_0003825 3300049585 Bacteria 7752
190 Ga0501069_0036653 3300049585 Bacteria 2706
191 Ga0501069_0337867 3300049585 Bacteria 886
192 Ga0501070_0000650 3300049586 Bacteria 31944
193 Ga0501070_0006268 3300049586 Bacteria 10122
194 Ga0501070_0013025 3300049586 Bacteria 7009
195 Ga0501070_0021805 3300049586 Bacteria 5368
196 Ga0501070_0067979 3300049586 Bacteria 2950
197 Ga0501070_0119344 3300049586 Bacteria 2180
198 Ga0501070_0120278 3300049586 Bacteria 2170
199 Ga0501070_0221502 3300049586 Bacteria 1551
200 Ga0501070_0304549 3300049586 Bacteria 1298
201 Ga0501070_0532210 3300049586 Bacteria 942
202 Ga0501070_0798353 3300049586 Bacteria 741
203 Ga0501071_0004099 3300049587 Bacteria 9216
204 Ga0501071_0345322 3300049587 Bacteria 1132
205 Ga0501071_0558510 3300049587 Bacteria 879
206 Ga0501071_0867254 3300049587 Bacteria 696
207 Ga0501072_0324347 3300049588 Bacteria 1224
208 Ga0501072_0474788 3300049588 Bacteria 990
209 Ga0501072_1260158 3300049588 Bacteria 574
210 Ga0501073_0022973 3300049589 Bacteria 4485
211 Ga0501073_0039707 3300049589 Bacteria 3333
212 Ga0501073_0082465 3300049589 Bacteria 2237
213 Ga0501073_1065304 3300049589 Bacteria 556
214 Ga0501074_0000066 3300049590 Bacteria 50258
215 Ga0501074_0114302 3300049590 Bacteria 1931
216 Ga0501074_0120122 3300049590 Bacteria 1879
217 Ga0501074_0525538 3300049590 Bacteria 838
218 Ga0501074_0632687 3300049590 Bacteria 756
219 Ga0501074_0809630 3300049590 Bacteria 660
220 Ga0501076_0187438 3300049592 Bacteria 1688
221 Ga0501076_1600070 3300049592 Bacteria 535
222 Ga0501079_0052118 3300049741 Bacteria 3159
223 Ga0501080_0000667 3300049742 Bacteria 27300
224 Ga0501080_0007654 3300049742 Bacteria 9769
225 Ga0501080_0063009 3300049742 Bacteria 3451
226 Ga0501080_1252295 3300049742 Bacteria 636
227 Ga0501083_0000012 3300049744 Bacteria 178668
228 Ga0501083_0393785 3300049744 Bacteria 901
229 Ga0501083_1137227 3300049744 Bacteria 508
230 Ga0501035_0000009 3300049822 Bacteria 310827
231 Ga0501035_0000073 3300049822 Bacteria 122603
232 Ga0501035_0000806 3300049822 Bacteria 33416
233 Ga0501035_0002044 3300049822 Bacteria 20109
234 Ga0501035_0004944 3300049822 Bacteria 12646
235 Ga0501035_0004991 3300049822 Bacteria 12570
236 Ga0501035_0020802 3300049822 Bacteria 6028
237 Ga0501035_0022781 3300049822 Bacteria 5752
238 Ga0501035_0032575 3300049822 Bacteria 4740
239 Ga0501035_0047069 3300049822 Bacteria 3874
240 Ga0501035_0121551 3300049822 Bacteria 2282
241 Ga0501035_0354679 3300049822 Bacteria 1227
242 Ga0501035_0579672 3300049822 Bacteria 916
243 Ga0501044_0000005 3300049823 Bacteria 310855
244 Ga0501044_0000118 3300049823 Bacteria 95218
245 Ga0501044_0012534 3300049823 Bacteria 9183
246 Ga0501044_0015666 3300049823 Bacteria 8165
247 Ga0501044_0025239 3300049823 Bacteria 6301
248 Ga0501044_0027353 3300049823 Bacteria 6028
249 Ga0501044_0030135 3300049823 Bacteria 5719
250 Ga0501044_0042055 3300049823 Bacteria 4756
251 Ga0501044_0042840 3300049823 Bacteria 4706
252 Ga0501044_0063235 3300049823 Bacteria 3781
253 Ga0501044_0122144 3300049823 Bacteria 2604
254 Ga0501044_0310556 3300049823 Bacteria 1503
255 Ga0501045_0046287 3300049824 Bacteria 3168
256 Ga0501045_0067175 3300049824 Bacteria 2633
257 nmdc:mga0yw44_118732_c1 3300050492 Bacteria 1702
258 nmdc:mga0yw44_406987_c1 3300050492 Bacteria 920
259 nmdc:mga06z11_333924_c1 3300050494 Bacteria 905
260 nmdc:mga07m45_514709_c1 3300050496 Bacteria 693
261 Ga0500595_083182 3300053119 Bacteria 934
262 Ga0500568_0000010 3300053139 Bacteria 249043
263 Ga0500568_0251262 3300053139 Bacteria 644
264 Ga0500604_0007310 3300053151 Bacteria 2926
265 Ga0500616_0028689 3300053153 Bacteria 3066
266 Ga0500627_0028672 3300053158 Bacteria 2314
267 Ga0500645_000863 3300053730 Bacteria 17700
268 Ga0501084_0821411 3300054114 Bacteria 783
269 Ga0501082_0027361 3300060353 Bacteria 4909

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0706165 Ga0501047_0706165_498_782 92
2 iso_pu_bacteria 2510461069 2510839234 100
3 iso_pu_bacteria 2513237351 2514586529 100
4 iso_pu_bacteria 2558860983 2561468594 100
5 iso_pu_bacteria 2643221551 2643777585 100
6 iso_pu_bacteria 2643221555 2643796033 100
7 iso_pu_bacteria 2643221623 2644133974 100
8 iso_pu_bacteria 2738543024 2739310295 100
9 iso_pu_bacteria 2889790730 2889795830 100
10 iso_pu_bacteria 2889914905 2889917793 100
11 iso_pu_bacteria 2937843397 2937843715 100
12 iso_pu_bacteria 2996336353 2996341590 100
13 iso_pu_bacteria 8018150411 8018152135 100
14 3300049583 Ga0501067_0129477 Ga0501067_0129477_587_916 101
15 3300005366 Ga0070659_100223133 Ga0070659_1002231332 102
16 3300005535 Ga0070684_101316074 Ga0070684_1013160741 102
17 3300005564 Ga0070664_101163522 Ga0070664_1011635222 102
18 3300005615 Ga0070702_101191970 Ga0070702_1011919702 102
19 3300009094 Ga0111539_10996812 Ga0111539_109968122 102
20 3300009551 Ga0105238_10685916 Ga0105238_106859162 102
21 3300025937 Ga0207669_11341614 Ga0207669_113416141 102
22 3300048904 Ga0496101_0723213 Ga0496101_0723213_394_711 102
23 3300050492 nmdc:mga0yw44_406987_c1 nmdc:mga0yw44_406987_c1_297_614 102
24 3300003322 rootL2_10149262 rootL2_101492623 103
25 3300049569 Ga0501032_0019602 Ga0501032_0019602_1791_2153 103
26 3300049570 Ga0501033_0034104 Ga0501033_0034104_1791_2153 103
27 3300049571 Ga0501034_0025415 Ga0501034_0025415_1791_2153 103
28 3300049571 Ga0501034_0073201 Ga0501034_0073201_3063_3380 103
29 3300049572 Ga0501036_0017283 Ga0501036_0017283_3876_4238 103
30 3300049573 Ga0501037_0020091 Ga0501037_0020091_2778_3140 103
31 3300049574 Ga0501038_0029504 Ga0501038_0029504_622_984 103
32 3300049581 Ga0501047_0022665 Ga0501047_0022665_1791_2153 103
33 3300049586 Ga0501070_0067979 Ga0501070_0067979_2029_2391 103
34 3300049587 Ga0501071_0867254 Ga0501071_0867254_210_572 103
35 3300049822 Ga0501035_0020802 Ga0501035_0020802_3876_4238 103
36 3300049823 Ga0501044_0027353 Ga0501044_0027353_1791_2153 103
37 iso_pu_bacteria 2996310559 2996311601 103
38 3300005336 Ga0070680_100870061 Ga0070680_1008700612 104
39 3300005347 Ga0070668_101342080 Ga0070668_1013420802 104
40 3300005458 Ga0070681_11218151 Ga0070681_112181511 104
41 3300005530 Ga0070679_101038856 Ga0070679_1010388562 104
42 3300005548 Ga0070665_100059029 Ga0070665_1000590295 104
43 3300005548 Ga0070665_100420255 Ga0070665_1004202552 104
44 3300005617 Ga0068859_102684905 Ga0068859_1026849052 104
45 3300006038 Ga0075365_10108285 Ga0075365_101082853 104
46 3300006931 Ga0097620_102684499 Ga0097620_1026844992 104
47 3300009093 Ga0105240_10623651 Ga0105240_106236512 104
48 3300009176 Ga0105242_10682064 Ga0105242_106820643 104
49 3300013104 Ga0157370_10803109 Ga0157370_108031092 104
50 3300013105 Ga0157369_11827487 Ga0157369_118274872 104
51 3300013296 Ga0157374_12457616 Ga0157374_124576162 104
52 3300013307 Ga0157372_11875849 Ga0157372_118758492 104
53 3300014326 Ga0157380_10591954 Ga0157380_105919542 104
54 3300014326 Ga0157380_11671661 Ga0157380_116716612 104
55 3300025904 Ga0207647_10195292 Ga0207647_101952922 104
56 3300025912 Ga0207707_10580987 Ga0207707_105809872 104
57 3300026067 Ga0207678_10848242 Ga0207678_108482422 104
58 3300028379 Ga0268266_10045861 Ga0268266_100458614 104
59 3300031824 Ga0307413_10822165 Ga0307413_108221652 104
60 3300031824 Ga0307413_12148365 Ga0307413_121483651 104
61 3300031911 Ga0307412_11765456 Ga0307412_117654562 104
62 3300032002 Ga0307416_100685253 Ga0307416_1006852531 104
63 3300032004 Ga0307414_10980492 Ga0307414_109804921 104
64 3300032004 Ga0307414_12194247 Ga0307414_121942472 104
65 3300037471 Ga0395905_1011685 Ga0395905_1011685_165_488 104
66 3300038443 Ga0395901_1047884 Ga0395901_1047884_86_406 104
67 3300041453 Ga0451797_0795482 Ga0451797_0795482_424_747 104
68 3300046660 Ga0495625_0068174 Ga0495625_0068174_1743_2081 104
69 3300047472 Ga0495686_0035368 Ga0495686_0035368_1725_2048 104
70 3300047472 Ga0495686_0550053 Ga0495686_0550053_131_469 104
71 3300049568 Ga0501031_0000002 Ga0501031_0000002_162222_162545 104
72 3300049568 Ga0501031_0003364 Ga0501031_0003364_6823_7173 104
73 3300049568 Ga0501031_0032716 Ga0501031_0032716_873_1211 104
74 3300049568 Ga0501031_0403144 Ga0501031_0403144_352_672 104
75 3300049568 Ga0501031_0449855 Ga0501031_0449855_381_701 104
76 3300049569 Ga0501032_0000001 Ga0501032_0000001_180224_180574 104
77 3300049569 Ga0501032_0000004 Ga0501032_0000004_55078_55401 104
78 3300049569 Ga0501032_0001391 Ga0501032_0001391_14493_14813 104
79 3300049569 Ga0501032_0019524 Ga0501032_0019524_2612_2950 104
80 3300049569 Ga0501032_0076741 Ga0501032_0076741_1123_1443 104
81 3300049569 Ga0501032_0079708 Ga0501032_0079708_1109_1435 104
82 3300049569 Ga0501032_0662764 Ga0501032_0662764_152_472 104
83 3300049569 Ga0501032_0762128 Ga0501032_0762128_201_524 104
84 3300049570 Ga0501033_0000016 Ga0501033_0000016_162058_162381 104
85 3300049570 Ga0501033_0000275 Ga0501033_0000275_47422_47772 104
86 3300049570 Ga0501033_0000304 Ga0501033_0000304_22488_22808 104
87 3300049570 Ga0501033_0004330 Ga0501033_0004330_5380_5706 104
88 3300049570 Ga0501033_0026069 Ga0501033_0026069_48_368 104
89 3300049570 Ga0501033_0051113 Ga0501033_0051113_935_1273 104
90 3300049570 Ga0501033_0111375 Ga0501033_0111375_522_845 104
91 3300049571 Ga0501034_0000011 Ga0501034_0000011_55078_55401 104
92 3300049571 Ga0501034_0002200 Ga0501034_0002200_22388_22738 104
93 3300049571 Ga0501034_0023386 Ga0501034_0023386_364_702 104
94 3300049571 Ga0501034_0101060 Ga0501034_0101060_749_1087 104
95 3300049571 Ga0501034_0667637 Ga0501034_0667637_345_665 104
96 3300049572 Ga0501036_0000001 Ga0501036_0000001_55078_55401 104
97 3300049572 Ga0501036_0000358 Ga0501036_0000358_26319_26669 104
98 3300049572 Ga0501036_0062659 Ga0501036_0062659_2723_3043 104
99 3300049572 Ga0501036_0074161 Ga0501036_0074161_1791_2129 104
100 3300049572 Ga0501036_0735824 Ga0501036_0735824_312_635 104
101 3300049573 Ga0501037_0000006 Ga0501037_0000006_162061_162384 104
102 3300049573 Ga0501037_0000091 Ga0501037_0000091_55580_55930 104
103 3300049573 Ga0501037_0000154 Ga0501037_0000154_49022_49342 104
104 3300049573 Ga0501037_0012627 Ga0501037_0012627_2612_2950 104
105 3300049573 Ga0501037_0079519 Ga0501037_0079519_837_1157 104
106 3300049573 Ga0501037_0157533 Ga0501037_0157533_854_1180 104
107 3300049574 Ga0501038_0000003 Ga0501038_0000003_55078_55401 104
108 3300049574 Ga0501038_0003916 Ga0501038_0003916_1919_2269 104
109 3300049574 Ga0501038_0021125 Ga0501038_0021125_4770_5090 104
110 3300049574 Ga0501038_0033096 Ga0501038_0033096_1048_1386 104
111 3300049574 Ga0501038_0117117 Ga0501038_0117117_295_615 104
112 3300049574 Ga0501038_0143283 Ga0501038_0143283_495_821 104
113 3300049574 Ga0501038_0188067 Ga0501038_0188067_773_1093 104
114 3300049574 Ga0501038_0893803 Ga0501038_0893803_256_579 104
115 3300049574 Ga0501038_0989648 Ga0501038_0989648_106_426 104
116 3300049575 Ga0501039_0000004 Ga0501039_0000004_55078_55401 104
117 3300049575 Ga0501039_0000011 Ga0501039_0000011_242984_243334 104
118 3300049575 Ga0501039_0149148 Ga0501039_0149148_623_961 104
119 3300049575 Ga0501039_0264676 Ga0501039_0264676_154_474 104
120 3300049575 Ga0501039_0684019 Ga0501039_0684019_143_466 104
121 3300049576 Ga0501040_0029238 Ga0501040_0029238_261_584 104
122 3300049578 Ga0501042_0056204 Ga0501042_0056204_1048_1386 104
123 3300049579 Ga0501043_0000007 Ga0501043_0000007_33162_33482 104
124 3300049579 Ga0501043_0000016 Ga0501043_0000016_163605_163955 104
125 3300049579 Ga0501043_0000765 Ga0501043_0000765_25030_25353 104
126 3300049579 Ga0501043_0084093 Ga0501043_0084093_474_794 104
127 3300049579 Ga0501043_0235389 Ga0501043_0235389_301_624 104
128 3300049579 Ga0501043_0380999 Ga0501043_0380999_435_782 104
129 3300049579 Ga0501043_0691300 Ga0501043_0691300_111_434 104
130 3300049579 Ga0501043_0859670 Ga0501043_0859670_240_560 104
131 3300049580 Ga0501046_0062502 Ga0501046_0062502_2094_2417 104
132 3300049580 Ga0501046_0157742 Ga0501046_0157742_868_1218 104
133 3300049580 Ga0501046_0679678 Ga0501046_0679678_342_662 104
134 3300049580 Ga0501046_1271966 Ga0501046_1271966_116_436 104
135 3300049581 Ga0501047_0000740 Ga0501047_0000740_29399_29719 104
136 3300049581 Ga0501047_0008050 Ga0501047_0008050_6300_6623 104
137 3300049581 Ga0501047_0036656 Ga0501047_0036656_1791_2129 104
138 3300049581 Ga0501047_0119122 Ga0501047_0119122_622_942 104
139 3300049581 Ga0501047_0122110 Ga0501047_0122110_1159_1485 104
140 3300049581 Ga0501047_0143528 Ga0501047_0143528_1926_2246 104
141 3300049581 Ga0501047_0299407 Ga0501047_0299407_378_698 104
142 3300049581 Ga0501047_0314309 Ga0501047_0314309_163_483 104
143 3300049581 Ga0501047_0389838 Ga0501047_0389838_693_1016 104
144 3300049581 Ga0501047_0402331 Ga0501047_0402331_43_369 104
145 3300049581 Ga0501047_0489511 Ga0501047_0489511_669_992 104
146 3300049582 Ga0501048_0454992 Ga0501048_0454992_499_819 104
147 3300049582 Ga0501048_0743496 Ga0501048_0743496_44_367 104
148 3300049583 Ga0501067_0108436 Ga0501067_0108436_258_584 104
149 3300049583 Ga0501067_0527991 Ga0501067_0527991_57_377 104
150 3300049584 Ga0501068_0005949 Ga0501068_0005949_2672_2992 104
151 3300049584 Ga0501068_0270779 Ga0501068_0270779_223_549 104
152 3300049585 Ga0501069_0000027 Ga0501069_0000027_72731_73051 104
153 3300049585 Ga0501069_0003825 Ga0501069_0003825_3539_3859 104
154 3300049585 Ga0501069_0036653 Ga0501069_0036653_267_593 104
155 3300049585 Ga0501069_0337867 Ga0501069_0337867_405_743 104
156 3300049586 Ga0501070_0000650 Ga0501070_0000650_23867_24187 104
157 3300049586 Ga0501070_0006268 Ga0501070_0006268_3979_4302 104
158 3300049586 Ga0501070_0013025 Ga0501070_0013025_4296_4616 104
159 3300049586 Ga0501070_0021805 Ga0501070_0021805_1152_1478 104
160 3300049586 Ga0501070_0119344 Ga0501070_0119344_888_1208 104
161 3300049586 Ga0501070_0120278 Ga0501070_0120278_588_914 104
162 3300049586 Ga0501070_0221502 Ga0501070_0221502_581_901 104
163 3300049586 Ga0501070_0304549 Ga0501070_0304549_878_1198 104
164 3300049586 Ga0501070_0532210 Ga0501070_0532210_219_569 104
165 3300049586 Ga0501070_0798353 Ga0501070_0798353_114_437 104
166 3300049587 Ga0501071_0004099 Ga0501071_0004099_3221_3541 104
167 3300049587 Ga0501071_0345322 Ga0501071_0345322_397_717 104
168 3300049587 Ga0501071_0558510 Ga0501071_0558510_106_426 104
169 3300049588 Ga0501072_0324347 Ga0501072_0324347_110_433 104
170 3300049588 Ga0501072_0474788 Ga0501072_0474788_104_430 104
171 3300049588 Ga0501072_1260158 Ga0501072_1260158_54_374 104
172 3300049589 Ga0501073_0022973 Ga0501073_0022973_3602_3922 104
173 3300049589 Ga0501073_0039707 Ga0501073_0039707_2769_3107 104
174 3300049589 Ga0501073_0082465 Ga0501073_0082465_942_1262 104
175 3300049589 Ga0501073_1065304 Ga0501073_1065304_97_420 104
176 3300049590 Ga0501074_0000066 Ga0501074_0000066_23032_23352 104
177 3300049590 Ga0501074_0114302 Ga0501074_0114302_1098_1424 104
178 3300049590 Ga0501074_0120122 Ga0501074_0120122_494_832 104
179 3300049590 Ga0501074_0525538 Ga0501074_0525538_181_504 104
180 3300049590 Ga0501074_0632687 Ga0501074_0632687_161_481 104
181 3300049590 Ga0501074_0809630 Ga0501074_0809630_86_406 104
182 3300049592 Ga0501076_0187438 Ga0501076_0187438_767_1087 104
183 3300049592 Ga0501076_1600070 Ga0501076_1600070_197_523 104
184 3300049741 Ga0501079_0052118 Ga0501079_0052118_484_804 104
185 3300049742 Ga0501080_0000667 Ga0501080_0000667_25647_25967 104
186 3300049742 Ga0501080_0007654 Ga0501080_0007654_9207_9533 104
187 3300049742 Ga0501080_0063009 Ga0501080_0063009_1576_1914 104
188 3300049742 Ga0501080_1252295 Ga0501080_1252295_279_599 104
189 3300049744 Ga0501083_0000012 Ga0501083_0000012_145030_145350 104
190 3300049744 Ga0501083_0393785 Ga0501083_0393785_313_651 104
191 3300049744 Ga0501083_1137227 Ga0501083_1137227_41_364 104
192 3300049822 Ga0501035_0000009 Ga0501035_0000009_255427_255750 104
193 3300049822 Ga0501035_0000073 Ga0501035_0000073_60661_60981 104
194 3300049822 Ga0501035_0000806 Ga0501035_0000806_12028_12354 104
195 3300049822 Ga0501035_0002044 Ga0501035_0002044_9275_9595 104
196 3300049822 Ga0501035_0004944 Ga0501035_0004944_11835_12158 104
197 3300049822 Ga0501035_0004991 Ga0501035_0004991_3024_3344 104
198 3300049822 Ga0501035_0022781 Ga0501035_0022781_3484_3834 104
199 3300049822 Ga0501035_0032575 Ga0501035_0032575_2612_2950 104
200 3300049822 Ga0501035_0121551 Ga0501035_0121551_181_504 104
201 3300049822 Ga0501035_0579672 Ga0501035_0579672_476_796 104
202 3300049823 Ga0501044_0000005 Ga0501044_0000005_55078_55401 104
203 3300049823 Ga0501044_0000118 Ga0501044_0000118_61709_62029 104
204 3300049823 Ga0501044_0015666 Ga0501044_0015666_631_951 104
205 3300049823 Ga0501044_0025239 Ga0501044_0025239_5636_5962 104
206 3300049823 Ga0501044_0030135 Ga0501044_0030135_876_1199 104
207 3300049823 Ga0501044_0042055 Ga0501044_0042055_3747_4097 104
208 3300049823 Ga0501044_0042840 Ga0501044_0042840_367_687 104
209 3300049823 Ga0501044_0063235 Ga0501044_0063235_1653_1991 104
210 3300049823 Ga0501044_0122144 Ga0501044_0122144_381_701 104
211 3300049823 Ga0501044_0310556 Ga0501044_0310556_750_1073 104
212 3300049824 Ga0501045_0046287 Ga0501045_0046287_1158_1496 104
213 3300049824 Ga0501045_0067175 Ga0501045_0067175_849_1172 104
214 3300050492 nmdc:mga0yw44_118732_c1 nmdc:mga0yw44_118732_c1_327_650 104
215 3300050494 nmdc:mga06z11_333924_c1 nmdc:mga06z11_333924_c1_32_355 104
216 3300053151 Ga0500604_0007310 Ga0500604_0007310_301_624 104
217 3300053153 Ga0500616_0028689 Ga0500616_0028689_361_684 104
218 3300053158 Ga0500627_0028672 Ga0500627_0028672_880_1203 104
219 3300054114 Ga0501084_0821411 Ga0501084_0821411_172_495 104
220 3300060353 Ga0501082_0027361 Ga0501082_0027361_3838_4158 104
221 3300053139 Ga0500568_0000010 Ga0500568_0000010_170208_170531 105
222 3300031903 Ga0307407_10701839 Ga0307407_107018391 106
223 3300031911 Ga0307412_10828086 Ga0307412_108280862 106
224 3300031911 Ga0307412_11385444 Ga0307412_113854442 106
225 3300041404 Ga0439436_0064919 Ga0439436_0064919_497_835 106
226 3300041413 Ga0439465_0025473 Ga0439465_0025473_1165_1515 106
227 3300042004 Ga0439445_0053193 Ga0439445_0053193_723_1061 106
228 3300042007 Ga0439449_0045226 Ga0439449_0045226_927_1265 106
229 3300002741 JGI25157J39369_1032256 JGI25157J39369_10322561 107
230 3300003215 JGI25153J46596_10038732 JGI25153J46596_100387322 107
231 3300003791 Ga0055530_10001146 Ga0055530_100011468 107
232 3300003794 Ga0055531_10010271 Ga0055531_100102712 107
233 3300003794 Ga0055531_10021117 Ga0055531_100211172 107
234 3300004625 Ga0055543_1012004 Ga0055543_10120041 107
235 3300005262 Ga0065165_1001756 Ga0065165_10017566 107
236 3300005262 Ga0065165_1014791 Ga0065165_10147914 107
237 3300005367 Ga0070667_101113719 Ga0070667_1011137191 107
238 3300005539 Ga0068853_101293186 Ga0068853_1012931861 107
239 3300006177 Ga0075362_10203621 Ga0075362_102036212 107
240 3300006353 Ga0075370_10264305 Ga0075370_102643052 107
241 3300009174 Ga0105241_10398727 Ga0105241_103987272 107
242 3300009177 Ga0105248_11052713 Ga0105248_110527132 107
243 3300009545 Ga0105237_10680220 Ga0105237_106802202 107
244 3300009551 Ga0105238_10082111 Ga0105238_100821113 107
245 3300011119 Ga0105246_12201096 Ga0105246_122010962 107
246 3300013100 Ga0157373_11077039 Ga0157373_110770392 107
247 3300014325 Ga0163163_12110319 Ga0163163_121103191 107
248 3300014968 Ga0157379_11948682 Ga0157379_119486821 107
249 3300025250 Ga0209026_1006675 Ga0209026_10066752 107
250 3300025297 Ga0209758_1002904 Ga0209758_100290412 107
251 3300025298 Ga0209050_1000053 Ga0209050_1000053102 107
252 3300025304 Ga0209257_1000419 Ga0209257_100041946 107
253 3300025304 Ga0209257_1009287 Ga0209257_10092874 107
254 3300025911 Ga0207654_10622716 Ga0207654_106227162 107
255 3300025924 Ga0207694_10009138 Ga0207694_100091384 107
256 3300025938 Ga0207704_10911556 Ga0207704_109115561 107
257 3300025986 Ga0207658_10642053 Ga0207658_106420532 107
258 3300025986 Ga0207658_11153177 Ga0207658_111531771 107
259 3300026121 Ga0207683_11358386 Ga0207683_113583861 107
260 3300026142 Ga0207698_10481767 Ga0207698_104817672 107
261 3300030521 Ga0307511_10062782 Ga0307511_100627822 107
262 3300031548 Ga0307408_100726909 Ga0307408_1007269092 107
263 3300031911 Ga0307412_11955213 Ga0307412_119552131 107
264 3300032002 Ga0307416_102797020 Ga0307416_1027970202 107
265 3300032004 Ga0307414_11139448 Ga0307414_111394481 107
266 3300032005 Ga0307411_10825670 Ga0307411_108256701 107
267 3300037471 Ga0395905_0525174 Ga0395905_0525174_617_949 107
268 3300041413 Ga0439465_0095805 Ga0439465_0095805_218_541 107
269 3300044712 Ga0453684_1567416 Ga0453684_1567416_303_626 107
270 3300046522 Ga0495643_0304232 Ga0495643_0304232_118_441 107
271 3300046539 Ga0495621_0257585 Ga0495621_0257585_11_340 107
272 3300046616 Ga0495668_0034664 Ga0495668_0034664_1889_2221 107
273 3300046616 Ga0495668_0096779 Ga0495668_0096779_1219_1542 107
274 3300047472 Ga0495686_0021718 Ga0495686_0021718_3894_4217 107
275 3300049573 Ga0501037_0052023 Ga0501037_0052023_241_564 107
276 3300049822 Ga0501035_0047069 Ga0501035_0047069_1532_1855 107
277 3300049822 Ga0501035_0354679 Ga0501035_0354679_421_750 107
278 3300049823 Ga0501044_0012534 Ga0501044_0012534_4095_4418 107
279 3300050496 nmdc:mga07m45_514709_c1 nmdc:mga07m45_514709_c1_20_349 107
280 3300053119 Ga0500595_083182 Ga0500595_083182_558_887 107
281 3300053139 Ga0500568_0251262 Ga0500568_0251262_309_632 107
282 3300053730 Ga0500645_000863 Ga0500645_000863_8515_8838 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01503

PRA-PH

Phosphoribosyl-ATP pyrophosphohydrolase

10

97

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j2l-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.943 7 91
5zwl-assembly1.cif.gz_E crystal structure of the gamma - epsilon complex of photosynthetic cyanobacterial f1-atpase 0.9427 34 81
6j22-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.9377 7 91
4eve-assembly1.cif.gz_A crystal structure hp-nap from strain ys29 in apo form 0.9373 35 80
5lbh-assembly1.cif.gz_A crystal structure of helicobacter cinaedi caip 0.9356 35 80
ID Description Score Start End Superfamily
af_Q2G0A8_1_95_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 1.004 35 78 1.20.58.80
af_I1KJL7_87_236_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.9944 35 78 1.20.120.290
af_Q54P12_52_173_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.9616 35 80 1.20.120.230
af_A0A2C9C3B1_117_208_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9515 35 77 1.20.1280.290
5zwlE02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9424 36 81 1.10.287.540
ID Description Score Start End GO Terms
AF-S9R367-F1-model_v4 phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) 0.9717 9 105 GO:0000105
GO:0004636
GO:0005524
AF-A0A1I1SGH5-F1-model_v4 Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) 0.9692 8 104 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A2M7ERF3-F1-model_v4 phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) 0.9669 8 91 GO:0000105
GO:0004636
GO:0005524
AF-A0A328AYL1-F1-model_v4 Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) 0.9656 1 103 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A645IMW7-F1-model_v4 phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) 0.9655 8 93 GO:0000105
GO:0004636
GO:0005524

Feature Viewer

pLDDT pTM Quality
90.95 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map