F384848

General Info

Members Datasets Scaffolds Average Seq Length
282 178 564 155

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10249498|Ga0075364_102494983
Length 162
Sequence MPRRKVVAKRVILPDPIYGSQVVAKFVNHVMVKGKKSLAESIVYGAFEMIEEKIKRDPVEIFKRAIENIRPTVEVRSRRVGGATYQIPVEVRQNRALALAMRWLVEYSRKRSEKGITAQLAGEIVDAADEEGGGRGKGGAVKKREDVHRMAEANKAFSHFKW

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
64 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
96 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
106 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
108 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
114 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
115 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
116 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
137 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
148 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
149 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
160 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
173 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 2643221580 Devosia sp. Root635 Isolate Unclassified
176 2643221674 Devosia sp. Root436 Isolate Unclassified
177 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
178 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.94
Metatranscriptomes 10.64
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.77
Nodule 0
Rhizoplane 1.06
Rhizosphere 96.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10249498 3300006051 Bacteria 1206
2 LJQas_1005839 3300000549 Bacteria 1547
3 JGI24748J21848_1000017 3300002074 Bacteria 133780
4 JGI25405J52794_10010497 3300003911 Bacteria 1762
5 Ga0065712_10102906 3300005290 Bacteria 1993
6 Ga0065707_10004638 3300005295 Bacteria 3401
7 Ga0065707_10639104 3300005295 Bacteria 669
8 Ga0068869_100105782 3300005334 Bacteria 2135
9 Ga0070680_100764888 3300005336 Bacteria 832
10 Ga0070689_100103866 3300005340 Bacteria 2252
11 Ga0070687_100194142 3300005343 Bacteria 1225
12 Ga0070692_10076986 3300005345 Bacteria 1789
13 Ga0070669_100265531 3300005353 Bacteria 1371
14 Ga0070671_100483263 3300005355 Bacteria 1064
15 Ga0070688_100028412 3300005365 Bacteria 3338
16 Ga0070667_101661461 3300005367 Bacteria 601
17 Ga0070703_10307932 3300005406 Bacteria 663
18 Ga0070714_100173942 3300005435 Bacteria 1956
19 Ga0070713_100702337 3300005436 Bacteria 966
20 Ga0070710_10053720 3300005437 Bacteria 2271
21 Ga0070711_100019639 3300005439 Bacteria 4339
22 Ga0070705_100017469 3300005440 Bacteria 3745
23 Ga0070705_100320528 3300005440 Bacteria 1119
24 Ga0070705_100686308 3300005440 Bacteria 803
25 Ga0070705_101098312 3300005440 Bacteria 651
26 Ga0070700_100215304 3300005441 Bacteria 1358
27 Ga0070694_100256612 3300005444 Bacteria 1325
28 Ga0070694_100311183 3300005444 Bacteria 1210
29 Ga0070708_100061775 3300005445 Bacteria 3348
30 Ga0070708_100864425 3300005445 Bacteria 849
31 Ga0070708_101247131 3300005445 Bacteria 695
32 Ga0068867_100244044 3300005459 Bacteria 1458
33 Ga0070685_10006654 3300005466 Bacteria 5901
34 Ga0070706_100005920 3300005467 Bacteria 11575
35 Ga0070706_100008019 3300005467 Bacteria 9853
36 Ga0070707_100233117 3300005468 Bacteria 1792
37 Ga0070707_100233558 3300005468 Bacteria 1790
38 Ga0070707_100481976 3300005468 Bacteria 1202
39 Ga0070698_100048203 3300005471 Bacteria 4354
40 Ga0070698_100173928 3300005471 Bacteria 2093
41 Ga0070698_100216464 3300005471 Bacteria 1849
42 Ga0070698_101410038 3300005471 Bacteria 647
43 Ga0070699_100034255 3300005518 Bacteria 4389
44 Ga0070699_100186526 3300005518 Bacteria 1842
45 Ga0070699_100327723 3300005518 Bacteria 1377
46 Ga0070699_100526611 3300005518 Bacteria 1075
47 Ga0070699_100670187 3300005518 Bacteria 947
48 Ga0070699_101604518 3300005518 Bacteria 596
49 Ga0070697_100252726 3300005536 Bacteria 1508
50 Ga0070697_100537065 3300005536 Bacteria 1025
51 Ga0070697_100957180 3300005536 Bacteria 760
52 Ga0070695_100033809 3300005545 Bacteria 3201
53 Ga0070695_100423872 3300005545 Bacteria 1014
54 Ga0070695_100750090 3300005545 Bacteria 778
55 Ga0070696_100187605 3300005546 Bacteria 1537
56 Ga0070693_100331387 3300005547 Bacteria 1036
57 Ga0070704_101112414 3300005549 Bacteria 718
58 Ga0068857_100531418 3300005577 Bacteria 1106
59 Ga0068859_100083557 3300005617 Bacteria 3236
60 Ga0068861_100597032 3300005719 Bacteria 1013
61 Ga0068870_10032200 3300005840 Bacteria 2663
62 Ga0068860_100458184 3300005843 Bacteria 1268
63 Ga0068862_100205406 3300005844 Bacteria 1778
64 Ga0068862_101114825 3300005844 Bacteria 785
65 Ga0081455_10004632 3300005937 Bacteria 15327
66 Ga0075364_10090154 3300006051 Bacteria 2033
67 Ga0070715_10002185 3300006163 Bacteria 5931
68 Ga0075428_100182680 3300006844 Bacteria 2270
69 Ga0075433_10007691 3300006852 Bacteria 8560
70 Ga0075433_10059325 3300006852 Bacteria 3348
71 Ga0075433_10286983 3300006852 Bacteria 1458
72 Ga0075434_100004156 3300006871 Bacteria 12971
73 Ga0075434_100037155 3300006871 Bacteria 4820
74 Ga0075434_100259204 3300006871 Bacteria 1758
75 Ga0075434_100513509 3300006871 Bacteria 1219
76 Ga0075434_100541717 3300006871 Bacteria 1184
77 Ga0075429_100487788 3300006880 Bacteria 1080
78 Ga0075436_100002742 3300006914 Bacteria 12116
79 Ga0075436_100040897 3300006914 Bacteria 3198
80 Ga0097620_100083564 3300006931 Bacteria 3236
81 Ga0075435_100016744 3300007076 Bacteria 5531
82 Ga0075435_100230689 3300007076 Bacteria 1573
83 Ga0075435_100464126 3300007076 Bacteria 1093
84 Ga0099794_10000098 3300007265 Bacteria 32096
85 Ga0105240_10270657 3300009093 Bacteria 1956
86 Ga0111539_10017827 3300009094 Bacteria 8792
87 Ga0111539_10083580 3300009094 Bacteria 3754
88 Ga0105245_10620112 3300009098 Bacteria 1110
89 Ga0105247_10285743 3300009101 Bacteria 1139
90 Ga0105241_10844799 3300009174 Bacteria 846
91 Ga0105242_10581820 3300009176 Bacteria 1078
92 Ga0105248_10002379 3300009177 Bacteria 20890
93 Ga0105237_11673208 3300009545 Bacteria 643
94 Ga0105249_11202396 3300009553 Bacteria 829
95 Ga0105239_10027221 3300010375 Bacteria 6294
96 Ga0105239_10120479 3300010375 Bacteria 2913
97 Ga0105239_11015973 3300010375 Bacteria 953
98 Ga0105239_11175847 3300010375 Bacteria 884
99 Ga0105246_10919870 3300011119 Bacteria 786
100 Ga0105246_11233471 3300011119 Bacteria 690
101 Ga0157329_1000240 3300012491 Bacteria 1856
102 Ga0157326_1000497 3300012513 Bacteria 4699
103 Ga0157374_10001592 3300013296 Bacteria 19051
104 Ga0163162_10195720 3300013306 Bacteria 2150
105 Ga0163163_10082386 3300014325 Bacteria 3221
106 Ga0157380_10026723 3300014326 Bacteria 4385
107 Ga0157380_10138125 3300014326 Bacteria 2089
108 Ga0157379_10002804 3300014968 Bacteria 14685
109 Ga0157376_10694271 3300014969 Bacteria 1022
110 Ga0182006_1166839 3300015261 Bacteria 739
111 Ga0182007_10038891 3300015262 Bacteria 1593
112 Ga0207685_10000024 3300025905 Bacteria 113741
113 Ga0207643_10178461 3300025908 Bacteria 1284
114 Ga0207684_10238072 3300025910 Bacteria 1570
115 Ga0207684_10470204 3300025910 Bacteria 1079
116 Ga0207663_10058845 3300025916 Bacteria 2428
117 Ga0207660_10630122 3300025917 Bacteria 874
118 Ga0207662_10032722 3300025918 Bacteria 3028
119 Ga0207646_10034478 3300025922 Bacteria 4574
120 Ga0207646_10161026 3300025922 Bacteria 2025
121 Ga0207646_10242931 3300025922 Bacteria 1627
122 Ga0207646_10925469 3300025922 Bacteria 773
123 Ga0207681_10243401 3300025923 Bacteria 1401
124 Ga0207706_10563058 3300025933 Bacteria 980
125 Ga0207686_10056762 3300025934 Bacteria 2463
126 Ga0207686_10110725 3300025934 Bacteria 1851
127 Ga0207670_10048895 3300025936 Bacteria 2825
128 Ga0207711_10003637 3300025941 Bacteria 13332
129 Ga0207689_10029975 3300025942 Bacteria 4536
130 Ga0207667_10941210 3300025949 Bacteria 854
131 Ga0207651_10172968 3300025960 Bacteria 1705
132 Ga0207712_10846324 3300025961 Bacteria 806
133 Ga0207703_10003530 3300026035 Bacteria 13083
134 Ga0207648_10229495 3300026089 Bacteria 1651
135 Ga0207674_10656774 3300026116 Bacteria 1013
136 Ga0207674_10779633 3300026116 Bacteria 923
137 Ga0207428_10018360 3300027907 Bacteria 5977
138 Ga0268265_10491660 3300028380 Bacteria 1154
139 Ga0268265_10846980 3300028380 Bacteria 894
140 Ga0268264_10403525 3300028381 Bacteria 1314
141 Ga0316575_10209567 3300031665 Bacteria 812
142 Ga0316579_10008511 3300031691 Bacteria 4280
143 Ga0316576_10098461 3300031727 Bacteria 2184
144 Ga0316576_10215933 3300031727 Bacteria 1443
145 Ga0316578_10071961 3300031728 Bacteria 2047
146 Ga0307405_10507560 3300031731 Bacteria 968
147 Ga0316577_10019937 3300031733 Bacteria 3714
148 Ga0307413_10813642 3300031824 Bacteria 786
149 Ga0307409_102621178 3300031995 Bacteria 532
150 Ga0307416_100320747 3300032002 Bacteria 1551
151 Ga0307416_100348078 3300032002 Bacteria 1498
152 Ga0307415_100082154 3300032126 Bacteria 2304
153 Ga0316585_10006526 3300032137 Bacteria 3338
154 Ga0316593_10010813 3300032168 Bacteria 2633
155 Ga0316593_10031986 3300032168 Bacteria 1716
156 Ga0316593_10044681 3300032168 Bacteria 1483
157 Ga0316593_10052214 3300032168 Bacteria 1383
158 Ga0316593_10065525 3300032168 Bacteria 1249
159 Ga0316593_10077370 3300032168 Bacteria 1157
160 Ga0316593_10091335 3300032168 Bacteria 1072
161 Ga0316593_10101184 3300032168 Bacteria 1022
162 Ga0307507_10000482 3300033179 Bacteria 83990
163 Ga0316592_1011646 3300033524 Bacteria 1792
164 Ga0316592_1043087 3300033524 Bacteria 1001
165 Ga0316592_1106058 3300033524 Bacteria 648
166 Ga0316592_1112788 3300033524 Bacteria 629
167 Ga0316586_1039792 3300033527 Bacteria 824
168 Ga0316588_1025943 3300033528 Bacteria 1356
169 Ga0316588_1076274 3300033528 Bacteria 827
170 Ga0316588_1087563 3300033528 Bacteria 774
171 Ga0316587_1016562 3300033529 Bacteria 1231
172 Ga0316587_1059073 3300033529 Bacteria 709
173 Ga0316596_1004051 3300033541 Bacteria 3255
174 Ga0316596_1011355 3300033541 Bacteria 2175
175 Ga0316596_1060990 3300033541 Bacteria 1006
176 Ga0373940_0006888 3300035088 Bacteria 2545
177 Ga0373961_0441984 3300035241 Bacteria 506
178 Ga0316574_0223694 3300035398 Bacteria 1205
179 Ga0316582_0016856 3300036647 Bacteria 4212
180 Ga0316582_0039536 3300036647 Bacteria 2937
181 Ga0316582_0963626 3300036647 Bacteria 583
182 Ga0395899_0191690 3300037312 Bacteria 1430
183 Ga0395900_0292288 3300037418 Bacteria 1618
184 Ga0395898_0171525 3300037466 Bacteria 2074
185 Ga0395905_1333486 3300037471 Bacteria 621
186 Ga0316581_0002636 3300037588 Bacteria 4335
187 Ga0395901_0050324 3300038443 Bacteria 4329
188 Ga0439453_0042348 3300041408 Bacteria 897
189 Ga0439446_0205144 3300042156 Bacteria 667
190 Ga0451577_0043833 3300042876 Bacteria 4005
191 Ga0451577_0080971 3300042876 Bacteria 2895
192 Ga0451577_0089835 3300042876 Bacteria 2741
193 Ga0451577_0165425 3300042876 Bacteria 1992
194 Ga0451577_0562249 3300042876 Bacteria 1035
195 Ga0451577_0730088 3300042876 Bacteria 896
196 Ga0453683_0008266 3300044673 Bacteria 6996
197 Ga0453683_0061095 3300044673 Bacteria 2356
198 Ga0453683_0068155 3300044673 Bacteria 2224
199 Ga0453683_0258112 3300044673 Bacteria 1111
200 Ga0453683_0550582 3300044673 Bacteria 750
201 Ga0453684_0001988 3300044712 Bacteria 52441
202 Ga0453684_0004808 3300044712 Bacteria 27796
203 Ga0453684_0009271 3300044712 Bacteria 17276
204 Ga0453684_0144493 3300044712 Bacteria 2836
205 Ga0453684_0161086 3300044712 Bacteria 2654
206 Ga0453684_0165243 3300044712 Bacteria 2613
207 Ga0453684_0213587 3300044712 Bacteria 2240
208 Ga0453684_0332779 3300044712 Bacteria 1717
209 Ga0453684_0362862 3300044712 Bacteria 1630
210 Ga0453684_0548911 3300044712 Bacteria 1273
211 Ga0453684_1087632 3300044712 Bacteria 845
212 Ga0453684_1554806 3300044712 Bacteria 680
213 Ga0453684_2003861 3300044712 Bacteria 583
214 Ga0466957_0794507 3300044842 Bacteria 672
215 Ga0451576_0007199 3300045051 Bacteria 13406
216 Ga0451576_0012220 3300045051 Bacteria 9673
217 Ga0451576_0019555 3300045051 Bacteria 7390
218 Ga0451576_0034297 3300045051 Bacteria 5391
219 Ga0451576_0573364 3300045051 Bacteria 1186
220 Ga0451576_0787322 3300045051 Bacteria 999
221 Ga0451576_1380453 3300045051 Bacteria 733
222 Ga0495603_0063821 3300046455 Bacteria 2172
223 Ga0495629_0098715 3300046459 Bacteria 2038
224 Ga0495582_0535517 3300046473 Bacteria 677
225 Ga0495594_0072845 3300046499 Bacteria 1911
226 Ga0495644_0016648 3300046523 Bacteria 2813
227 Ga0495666_0250070 3300046526 Bacteria 808
228 Ga0495598_0010529 3300046537 Bacteria 2217
229 Ga0495621_0312260 3300046539 Bacteria 653
230 Ga0495645_0395215 3300046543 Bacteria 882
231 Ga0495659_0000523 3300046664 Bacteria 14144
232 Ga0495588_0015815 3300046674 Bacteria 3638
233 Ga0495676_0026962 3300047321 Bacteria 4935
234 Ga0496104_0125055 3300048907 Bacteria 2469
235 Ga0496110_0153288 3300048913 Bacteria 2087
236 Ga0496113_1256986 3300048916 Bacteria 577
237 Ga0501308_032194 3300049128 Bacteria 708
238 Ga0501305_018074 3300049161 Bacteria 1018
239 Ga0501305_081342 3300049161 Bacteria 583
240 Ga0501291_021733 3300049514 Bacteria 1025
241 Ga0501298_029346 3300049521 Bacteria 1072
242 Ga0501312_066874 3300049528 Bacteria 631
243 Ga0501317_007609 3300049533 Bacteria 1227
244 Ga0501318_016674 3300049534 Bacteria 890
245 Ga0501320_029256 3300049536 Bacteria 678
246 Ga0501325_003692 3300049541 Bacteria 1131
247 Ga0501340_008249 3300049556 Bacteria 732
248 Ga0501033_0837928 3300049570 Bacteria 620
249 Ga0501041_0376700 3300049577 Bacteria 898
250 Ga0501048_0714921 3300049582 Bacteria 719
251 Ga0501073_1029965 3300049589 Bacteria 566
252 Ga0501216_047348 3300049660 Bacteria 838
253 Ga0501243_142832 3300049675 Bacteria 507
254 Ga0501080_0521434 3300049742 Bacteria 1060
255 Ga0501081_0356844 3300049743 Bacteria 1078
256 Ga0501268_156447 3300049765 Bacteria 529
257 nmdc:mga09592_40151_c1 3300050508 Bacteria 3931
258 nmdc:mga09592_469932_c1 3300050508 Bacteria 1084
259 nmdc:mga0qj67_697171_c1 3300050509 Bacteria 808
260 nmdc:mga08y16_50061_c1 3300050511 Bacteria 4372
261 nmdc:mga0n895_1688857_c1 3300050512 Bacteria 596
262 nmdc:mga0n895_178223_c1 3300050512 Bacteria 2156
263 nmdc:mga0n895_259501_c1 3300050512 Bacteria 1764
264 nmdc:mga0n895_467986_c1 3300050512 Bacteria 1272
265 nmdc:mga0n895_90903_c1 3300050512 Bacteria 3055
266 nmdc:mga0rr50_188891_c1 3300050513 Bacteria 1687
267 nmdc:mga0rr50_3666_c1 3300050513 Bacteria 8894
268 nmdc:mga0rr50_544268_c1 3300050513 Bacteria 988
269 nmdc:mga08x19_7580_c1 3300050514 Bacteria 6444
270 nmdc:mga0a205_1116538_c1 3300050515 Bacteria 636
271 nmdc:mga0a205_15510_c1 3300050515 Bacteria 7120
272 nmdc:mga0a205_64393_c1 3300050515 Bacteria 3541
273 nmdc:mga0a205_740418_c1 3300050515 Bacteria 832
274 nmdc:mga0a205_836858_c1 3300050515 Bacteria 767
275 Ga0495619_0009034 3300053085 Bacteria 6287
276 Ga0500569_049018 3300053109 Bacteria 1267
277 Ga0500608_000323 3300053122 Bacteria 18325
278 Ga0500568_0095528 3300053139 Bacteria 1118
279 2643911576 2643221580 Bacteria 3816678
280 2644410368 2643221674 Bacteria 3919126
281 2899278130 2899275550 Bacteria 3958688
282 8057134010 8057132660 Bacteria 4061191
283 Ga0075364_10249498
284 LJQas_1005839
285 JGI24748J21848_1000017
286 JGI25405J52794_10010497
287 Ga0065712_10102906
288 Ga0065707_10004638
289 Ga0065707_10639104
290 Ga0068869_100105782
291 Ga0070680_100764888
292 Ga0070689_100103866
293 Ga0070687_100194142
294 Ga0070692_10076986
295 Ga0070669_100265531
296 Ga0070671_100483263
297 Ga0070688_100028412
298 Ga0070667_101661461
299 Ga0070703_10307932
300 Ga0070714_100173942
301 Ga0070713_100702337
302 Ga0070710_10053720
303 Ga0070711_100019639
304 Ga0070705_100017469
305 Ga0070705_100320528
306 Ga0070705_100686308
307 Ga0070705_101098312
308 Ga0070700_100215304
309 Ga0070694_100256612
310 Ga0070694_100311183
311 Ga0070708_100061775
312 Ga0070708_100864425
313 Ga0070708_101247131
314 Ga0068867_100244044
315 Ga0070685_10006654
316 Ga0070706_100005920
317 Ga0070706_100008019
318 Ga0070707_100233117
319 Ga0070707_100233558
320 Ga0070707_100481976
321 Ga0070698_100048203
322 Ga0070698_100173928
323 Ga0070698_100216464
324 Ga0070698_101410038
325 Ga0070699_100034255
326 Ga0070699_100186526
327 Ga0070699_100327723
328 Ga0070699_100526611
329 Ga0070699_100670187
330 Ga0070699_101604518
331 Ga0070697_100252726
332 Ga0070697_100537065
333 Ga0070697_100957180
334 Ga0070695_100033809
335 Ga0070695_100423872
336 Ga0070695_100750090
337 Ga0070696_100187605
338 Ga0070693_100331387
339 Ga0070704_101112414
340 Ga0068857_100531418
341 Ga0068859_100083557
342 Ga0068861_100597032
343 Ga0068870_10032200
344 Ga0068860_100458184
345 Ga0068862_100205406
346 Ga0068862_101114825
347 Ga0081455_10004632
348 Ga0075364_10090154
349 Ga0070715_10002185
350 Ga0075428_100182680
351 Ga0075433_10007691
352 Ga0075433_10059325
353 Ga0075433_10286983
354 Ga0075434_100004156
355 Ga0075434_100037155
356 Ga0075434_100259204
357 Ga0075434_100513509
358 Ga0075434_100541717
359 Ga0075429_100487788
360 Ga0075436_100002742
361 Ga0075436_100040897
362 Ga0097620_100083564
363 Ga0075435_100016744
364 Ga0075435_100230689
365 Ga0075435_100464126
366 Ga0099794_10000098
367 Ga0105240_10270657
368 Ga0111539_10017827
369 Ga0111539_10083580
370 Ga0105245_10620112
371 Ga0105247_10285743
372 Ga0105241_10844799
373 Ga0105242_10581820
374 Ga0105248_10002379
375 Ga0105237_11673208
376 Ga0105249_11202396
377 Ga0105239_10027221
378 Ga0105239_10120479
379 Ga0105239_11015973
380 Ga0105239_11175847
381 Ga0105246_10919870
382 Ga0105246_11233471
383 Ga0157329_1000240
384 Ga0157326_1000497
385 Ga0157374_10001592
386 Ga0163162_10195720
387 Ga0163163_10082386
388 Ga0157380_10026723
389 Ga0157380_10138125
390 Ga0157379_10002804
391 Ga0157376_10694271
392 Ga0182006_1166839
393 Ga0182007_10038891
394 Ga0207685_10000024
395 Ga0207643_10178461
396 Ga0207684_10238072
397 Ga0207684_10470204
398 Ga0207663_10058845
399 Ga0207660_10630122
400 Ga0207662_10032722
401 Ga0207646_10034478
402 Ga0207646_10161026
403 Ga0207646_10242931
404 Ga0207646_10925469
405 Ga0207681_10243401
406 Ga0207706_10563058
407 Ga0207686_10056762
408 Ga0207686_10110725
409 Ga0207670_10048895
410 Ga0207711_10003637
411 Ga0207689_10029975
412 Ga0207667_10941210
413 Ga0207651_10172968
414 Ga0207712_10846324
415 Ga0207703_10003530
416 Ga0207648_10229495
417 Ga0207674_10656774
418 Ga0207674_10779633
419 Ga0207428_10018360
420 Ga0268265_10491660
421 Ga0268265_10846980
422 Ga0268264_10403525
423 Ga0316575_10209567
424 Ga0316579_10008511
425 Ga0316576_10098461
426 Ga0316576_10215933
427 Ga0316578_10071961
428 Ga0307405_10507560
429 Ga0316577_10019937
430 Ga0307413_10813642
431 Ga0307409_102621178
432 Ga0307416_100320747
433 Ga0307416_100348078
434 Ga0307415_100082154
435 Ga0316585_10006526
436 Ga0316593_10010813
437 Ga0316593_10031986
438 Ga0316593_10044681
439 Ga0316593_10052214
440 Ga0316593_10065525
441 Ga0316593_10077370
442 Ga0316593_10091335
443 Ga0316593_10101184
444 Ga0307507_10000482
445 Ga0316592_1011646
446 Ga0316592_1043087
447 Ga0316592_1106058
448 Ga0316592_1112788
449 Ga0316586_1039792
450 Ga0316588_1025943
451 Ga0316588_1076274
452 Ga0316588_1087563
453 Ga0316587_1016562
454 Ga0316587_1059073
455 Ga0316596_1004051
456 Ga0316596_1011355
457 Ga0316596_1060990
458 Ga0373940_0006888
459 Ga0373961_0441984
460 Ga0316574_0223694
461 Ga0316582_0016856
462 Ga0316582_0039536
463 Ga0316582_0963626
464 Ga0395899_0191690
465 Ga0395900_0292288
466 Ga0395898_0171525
467 Ga0395905_1333486
468 Ga0316581_0002636
469 Ga0395901_0050324
470 Ga0439453_0042348
471 Ga0439446_0205144
472 Ga0451577_0043833
473 Ga0451577_0080971
474 Ga0451577_0089835
475 Ga0451577_0165425
476 Ga0451577_0562249
477 Ga0451577_0730088
478 Ga0453683_0008266
479 Ga0453683_0061095
480 Ga0453683_0068155
481 Ga0453683_0258112
482 Ga0453683_0550582
483 Ga0453684_0001988
484 Ga0453684_0004808
485 Ga0453684_0009271
486 Ga0453684_0144493
487 Ga0453684_0161086
488 Ga0453684_0165243
489 Ga0453684_0213587
490 Ga0453684_0332779
491 Ga0453684_0362862
492 Ga0453684_0548911
493 Ga0453684_1087632
494 Ga0453684_1554806
495 Ga0453684_2003861
496 Ga0466957_0794507
497 Ga0451576_0007199
498 Ga0451576_0012220
499 Ga0451576_0019555
500 Ga0451576_0034297
501 Ga0451576_0573364
502 Ga0451576_0787322
503 Ga0451576_1380453
504 Ga0495603_0063821
505 Ga0495629_0098715
506 Ga0495582_0535517
507 Ga0495594_0072845
508 Ga0495644_0016648
509 Ga0495666_0250070
510 Ga0495598_0010529
511 Ga0495621_0312260
512 Ga0495645_0395215
513 Ga0495659_0000523
514 Ga0495588_0015815
515 Ga0495676_0026962
516 Ga0496104_0125055
517 Ga0496110_0153288
518 Ga0496113_1256986
519 Ga0501308_032194
520 Ga0501305_018074
521 Ga0501305_081342
522 Ga0501291_021733
523 Ga0501298_029346
524 Ga0501312_066874
525 Ga0501317_007609
526 Ga0501318_016674
527 Ga0501320_029256
528 Ga0501325_003692
529 Ga0501340_008249
530 Ga0501033_0837928
531 Ga0501041_0376700
532 Ga0501048_0714921
533 Ga0501073_1029965
534 Ga0501216_047348
535 Ga0501243_142832
536 Ga0501080_0521434
537 Ga0501081_0356844
538 Ga0501268_156447
539 nmdc:mga09592_40151_c1
540 nmdc:mga09592_469932_c1
541 nmdc:mga0qj67_697171_c1
542 nmdc:mga08y16_50061_c1
543 nmdc:mga0n895_1688857_c1
544 nmdc:mga0n895_178223_c1
545 nmdc:mga0n895_259501_c1
546 nmdc:mga0n895_467986_c1
547 nmdc:mga0n895_90903_c1
548 nmdc:mga0rr50_188891_c1
549 nmdc:mga0rr50_3666_c1
550 nmdc:mga0rr50_544268_c1
551 nmdc:mga08x19_7580_c1
552 nmdc:mga0a205_1116538_c1
553 nmdc:mga0a205_15510_c1
554 nmdc:mga0a205_64393_c1
555 nmdc:mga0a205_740418_c1
556 nmdc:mga0a205_836858_c1
557 Ga0495619_0009034
558 Ga0500569_049018
559 Ga0500608_000323
560 Ga0500568_0095528
561 2643911576
562 2644410368
563 2899278130
564 8057134010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00177

Ribosomal_S7

Ribosomal protein S7p/S5e

2

155

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cdv-assembly1.cif.gz_H rnase r bound to a 30s degradation intermediate (state ii) 0.9776 18 127
7nhl-assembly1.cif.gz_h vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus 0.9771 12 152
7nhl-assembly1.cif.gz_h vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus 0.9702 12 152
5o61-assembly1.cif.gz_BG the complete structure of the mycobacterium smegmatis 70s ribosome 0.9696 2 156
7nhn-assembly1.cif.gz_h vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9692 12 152
ID Description Score Start End Superfamily
af_P48940_2_156_1.10.455.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9643 2 156 1.10.455.10
af_P48940_2_156_1.10.455.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9583 2 156 1.10.455.10
af_A0A0P0YBF7_5_147_1.10.455.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9503 22 156 1.10.455.10
5mmjg00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9474 3 155 1.10.455.10
4qcoG00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9447 3 156 1.10.455.10
ID Description Score Start End GO Terms
AF-G0YD96-F1-model_v4 Ribosomal protein S7 0.9911 58 155 GO:0003735
GO:0006412
GO:0009536
GO:0015935
GO:0019843
AF-A0A3B8RAG7-F1-model_v4 30S ribosomal protein S7 0.9907 47 156 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A4Q3EJX6-F1-model_v4 deleted 0.9896 42 156
AF-A0A355GRF5-F1-model_v4 30S ribosomal protein S7 0.9896 52 145 GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A838VDW6-F1-model_v4 30S ribosomal protein S7 0.989 51 156 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843

Map